F359883

General Info

Members Datasets Scaffolds Average Seq Length
248 181 496 224

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_10004267|Ga0163162_100042672
Length 258
Sequence LRVAHRSDADLSSLRSASGTTMRGSKHGAIAMQLYIGNKNYSSWSMRPWVLKRHFAIPFDEVMVRFDNLDTGSIFKQRIAEVAPTGRVPVLVDDGLAVWDTLAIAEYLAERFTAHPLWPRGARERARARSLCAEMHSGFSALRVACPQNIEASLPEVGRRVLQEQPAVRSDLERLQTMWREALRASGGPFLFGEFGIADAYFAPVAGRMRTYALPLDAPVQGYAERLFASPGVAAWVRDALNERDFLGFEEPYRTSRD

Samples

Sample ID Description Type Environment
1 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
60 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
63 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
96 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
97 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
98 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
99 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
100 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
101 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
102 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
103 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
104 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
105 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
106 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
113 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
114 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
115 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
116 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
117 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
118 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
119 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
120 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
121 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
122 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
123 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
124 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
125 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
126 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
127 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
128 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
129 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
130 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
131 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
132 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
133 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
134 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
135 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
136 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
137 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
138 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
139 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
140 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
141 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
142 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
143 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
144 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
149 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
150 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
151 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
152 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
154 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
155 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
156 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
157 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
158 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
159 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
160 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
161 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
162 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
163 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
164 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
165 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
166 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
167 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
168 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
169 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
170 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
171 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
172 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
173 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
174 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
175 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
176 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
177 2831864461 Roseateles noduli HZ7 Isolate Nodule
178 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
179 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
180 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
181 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.16
Metatranscriptomes 0
Isolates 4.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.45
Nodule 0.4
Rhizoplane 2.02
Rhizosphere 80.24
Stem 0
Stem Tuber 0
Unclassified 1.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163162_10004267 3300013306 Bacteria 13751
2 JGI25156J39149_1000273 3300002705 Bacteria 35022
3 rootH1_10027548 3300003316 Bacteria 2080
4 rootH1_10145797 3300003316 Bacteria 1235
5 rootH2_10013109 3300003320 Bacteria 10321
6 Ga0055539_1010761 3300003752 Bacteria 1132
7 Ga0065707_10090408 3300005295 Bacteria 4147
8 Ga0070658_10070902 3300005327 Bacteria 2853
9 Ga0070676_10005990 3300005328 Bacteria 6488
10 Ga0070690_100504647 3300005330 Bacteria 905
11 Ga0068869_100053547 3300005334 Bacteria 2935
12 Ga0068868_100052700 3300005338 Bacteria 3203
13 Ga0070689_100082852 3300005340 Bacteria 2520
14 Ga0070689_100130648 3300005340 Bacteria 2014
15 Ga0070689_100354488 3300005340 Bacteria 1231
16 Ga0070687_100012122 3300005343 Bacteria 3795
17 Ga0070668_100057612 3300005347 Bacteria 3003
18 Ga0070669_100050292 3300005353 Bacteria 3044
19 Ga0070671_100030390 3300005355 Bacteria 4458
20 Ga0070671_100182504 3300005355 Bacteria 1777
21 Ga0070673_100076078 3300005364 Bacteria 2710
22 Ga0070688_100073365 3300005365 Bacteria 2195
23 Ga0070688_100401687 3300005365 Bacteria 1014
24 Ga0070667_100001934 3300005367 Bacteria 18379
25 Ga0070667_100009643 3300005367 Bacteria 8010
26 Ga0070667_100021857 3300005367 Bacteria 5309
27 Ga0070667_100124216 3300005367 Bacteria 2248
28 Ga0070700_100018098 3300005441 Bacteria 4045
29 Ga0070694_100202026 3300005444 Unclassified 1482
30 Ga0070678_100343206 3300005456 Bacteria 1282
31 Ga0068867_100000605 3300005459 Bacteria 23775
32 Ga0068867_100008124 3300005459 Bacteria 7415
33 Ga0068867_100592092 3300005459 Bacteria 966
34 Ga0070698_100002538 3300005471 Bacteria 20106
35 Ga0070698_100593097 3300005471 Bacteria 1048
36 Ga0068853_100044880 3300005539 Bacteria 3785
37 Ga0068853_100153395 3300005539 Bacteria 2074
38 Ga0070672_100074861 3300005543 Bacteria 2702
39 Ga0070686_100051412 3300005544 Bacteria 2623
40 Ga0070686_100414131 3300005544 Bacteria 1028
41 Ga0070686_100474903 3300005544 Bacteria 966
42 Ga0070665_100002777 3300005548 Bacteria 18978
43 Ga0068855_100096252 3300005563 Bacteria 3411
44 Ga0068852_100015571 3300005616 Bacteria 5905
45 Ga0068852_100324740 3300005616 Bacteria 1495
46 Ga0068859_100049503 3300005617 Bacteria 4220
47 Ga0068859_100083712 3300005617 Bacteria 3234
48 Ga0068861_100001008 3300005719 Bacteria 17201
49 Ga0068861_100056316 3300005719 Unclassified 3000
50 Ga0068861_100163706 3300005719 Bacteria 1837
51 Ga0068851_10040172 3300005834 Bacteria 2351
52 Ga0068863_100013265 3300005841 Bacteria 7950
53 Ga0068863_100069989 3300005841 Bacteria 3318
54 Ga0068863_100091683 3300005841 Bacteria 2882
55 Ga0068858_100004551 3300005842 Bacteria 13580
56 Ga0068860_100000384 3300005843 Bacteria 57893
57 Ga0068860_100015888 3300005843 Bacteria 7347
58 Ga0068860_100119917 3300005843 Bacteria 2518
59 Ga0068860_100539698 3300005843 Bacteria 1167
60 Ga0068860_100579343 3300005843 Bacteria 1126
61 Ga0068862_100018372 3300005844 Bacteria 5822
62 Ga0068862_100277524 3300005844 Bacteria 1535
63 Ga0075366_10188013 3300006195 Bacteria 1255
64 Ga0068871_100058650 3300006358 Bacteria 3135
65 Ga0075430_100019628 3300006846 Bacteria 5751
66 Ga0075429_100000224 3300006880 Bacteria 38311
67 Ga0068865_100001306 3300006881 Bacteria 14493
68 Ga0068865_100283428 3300006881 Bacteria 1320
69 Ga0097620_100049503 3300006931 Bacteria 4220
70 Ga0097620_100083711 3300006931 Bacteria 3234
71 Ga0099795_10000102 3300007788 Bacteria 14126
72 Ga0105240_10024255 3300009093 Bacteria 8003
73 Ga0105240_10172468 3300009093 Bacteria 2560
74 Ga0105243_10045552 3300009148 Bacteria 3447
75 Ga0105243_10736405 3300009148 Bacteria 965
76 Ga0105242_10417468 3300009176 Bacteria 1256
77 Ga0105248_10185086 3300009177 Bacteria 2347
78 Ga0105237_10086761 3300009545 Bacteria 3120
79 Ga0105249_10007351 3300009553 Bacteria 9602
80 Ga0099796_10000420 3300010159 Bacteria 7039
81 Ga0105239_11012285 3300010375 Bacteria 955
82 Ga0157378_10014039 3300013297 Bacteria 7012
83 Ga0163162_10082669 3300013306 Bacteria 3284
84 Ga0157375_10087416 3300013308 Bacteria 3169
85 Ga0157375_10106276 3300013308 Bacteria 2899
86 Ga0157375_10110088 3300013308 Bacteria 2851
87 Ga0157380_10014579 3300014326 Bacteria 5755
88 Ga0157379_10002106 3300014968 Bacteria 16495
89 Ga0157379_10034997 3300014968 Bacteria 4476
90 Ga0157376_10131581 3300014969 Bacteria 2233
91 Ga0163161_10362743 3300017792 Bacteria 1154
92 Ga0207427_100825 3300025231 Bacteria 13857
93 Ga0209258_102754 3300025242 Bacteria 4263
94 Ga0209677_101960 3300025253 Bacteria 8209
95 Ga0209759_1011243 3300025256 Bacteria 2558
96 Ga0209759_1021223 3300025256 Bacteria 1484
97 Ga0207656_10218709 3300025321 Bacteria 925
98 Ga0207642_10313729 3300025899 Bacteria 913
99 Ga0207680_10101608 3300025903 Bacteria 1849
100 Ga0207699_10452608 3300025906 Bacteria 921
101 Ga0207645_10002476 3300025907 Bacteria 14491
102 Ga0207705_10051601 3300025909 Bacteria 2960
103 Ga0207695_10020731 3300025913 Bacteria 7520
104 Ga0207695_10052682 3300025913 Bacteria 4260
105 Ga0207662_10029286 3300025918 Bacteria 3189
106 Ga0207662_10267954 3300025918 Bacteria 1126
107 Ga0207681_10678606 3300025923 Bacteria 855
108 Ga0207644_10023648 3300025931 Bacteria 4212
109 Ga0207644_10611444 3300025931 Bacteria 905
110 Ga0207709_10114716 3300025935 Bacteria 1808
111 Ga0207670_10017410 3300025936 Bacteria 4344
112 Ga0207670_10043682 3300025936 Bacteria 2962
113 Ga0207670_10133695 3300025936 Bacteria 1821
114 Ga0207670_10362365 3300025936 Bacteria 1151
115 Ga0207704_10129148 3300025938 Bacteria 1746
116 Ga0207704_10196567 3300025938 Bacteria 1472
117 Ga0207691_10006206 3300025940 Bacteria 11546
118 Ga0207691_10051674 3300025940 Bacteria 3756
119 Ga0207711_10025270 3300025941 Bacteria 4983
120 Ga0207689_10061061 3300025942 Bacteria 3099
121 Ga0207667_10023843 3300025949 Bacteria 6735
122 Ga0207651_10158477 3300025960 Bacteria 1771
123 Ga0207668_10027086 3300025972 Bacteria 3731
124 Ga0207658_10017834 3300025986 Bacteria 4892
125 Ga0207658_10026544 3300025986 Bacteria 4061
126 Ga0207677_10029317 3300026023 Bacteria 3495
127 Ga0207703_10031574 3300026035 Bacteria 4189
128 Ga0207703_10078041 3300026035 Bacteria 2751
129 Ga0207639_10035627 3300026041 Bacteria 3684
130 Ga0207708_10026776 3300026075 Bacteria 4366
131 Ga0207708_10112596 3300026075 Bacteria 2114
132 Ga0207641_10005295 3300026088 Bacteria 11020
133 Ga0207641_10074502 3300026088 Bacteria 2928
134 Ga0207641_10584655 3300026088 Bacteria 1092
135 Ga0207648_10009307 3300026089 Bacteria 9418
136 Ga0207648_10013992 3300026089 Bacteria 7436
137 Ga0207648_10165114 3300026089 Bacteria 1956
138 Ga0207675_100001873 3300026118 Bacteria 21025
139 Ga0207675_100032509 3300026118 Bacteria 4859
140 Ga0207675_100243192 3300026118 Bacteria 1739
141 Ga0207683_10383164 3300026121 Bacteria 1293
142 Ga0207683_10818222 3300026121 Bacteria 865
143 Ga0207698_10021292 3300026142 Bacteria 4481
144 Ga0209179_1000960 3300027512 Bacteria 3274
145 Ga0268265_10006473 3300028380 Bacteria 7937
146 Ga0268265_10292931 3300028380 Bacteria 1462
147 Ga0268265_10738219 3300028380 Unclassified 955
148 Ga0268264_10002327 3300028381 Bacteria 16797
149 Ga0268264_10375785 3300028381 Bacteria 1360
150 Ga0268264_10456691 3300028381 Bacteria 1239
151 Ga0268264_10698787 3300028381 Bacteria 1007
152 Ga0307515_10000089 3300028794 Bacteria 215736
153 Ga0307515_10070106 3300028794 Bacteria 4777
154 Ga0265324_10038315 3300029957 Bacteria 1663
155 Ga0307511_10073558 3300030521 Bacteria 2471
156 Ga0307513_10002535 3300031456 Bacteria 25239
157 Ga0307513_10037112 3300031456 Bacteria 5426
158 Ga0307408_100000020 3300031548 Bacteria 340408
159 Ga0307410_10299340 3300031852 Bacteria 1269
160 Ga0307507_10121125 3300033179 Bacteria 2092
161 Ga0373936_0036415 3300035113 Bacteria 1962
162 Ga0373939_0059766 3300035114 Bacteria 1210
163 Ga0373961_0000166 3300035241 Bacteria 32229
164 Ga0373937_0076364 3300036401 Bacteria 3094
165 Ga0373925_0001792 3300037068 Bacteria 17899
166 Ga0373925_0057668 3300037068 Bacteria 2910
167 Ga0395899_0001500 3300037312 Bacteria 19821
168 Ga0395900_0044505 3300037418 Bacteria 4573
169 Ga0395898_0014598 3300037466 Bacteria 8066
170 Ga0395905_0132563 3300037471 Bacteria 2344
171 Ga0395905_0193544 3300037471 Bacteria 1907
172 Ga0395901_0010306 3300038443 Bacteria 9467
173 Ga0395901_0020407 3300038443 Bacteria 6782
174 Ga0436363_1601503 3300039450 Bacteria 1578
175 Ga0451789_1252533 3300041443 Bacteria 1091
176 Ga0439455_0102597 3300042012 Bacteria 791
177 Ga0451577_0040030 3300042876 Bacteria 4209
178 Ga0466969_0019023 3300044656 Bacteria 3573
179 Ga0466977_0000036 3300044666 Bacteria 22554
180 Ga0466965_0121330 3300044683 Bacteria 1350
181 Ga0466966_0029611 3300044684 Bacteria 3560
182 Ga0466966_0174964 3300044684 Bacteria 1304
183 Ga0466961_0035256 3300044693 Bacteria 3213
184 Ga0466963_0384736 3300044694 Bacteria 989
185 Ga0453684_0222387 3300044712 Bacteria 2186
186 Ga0466971_0021115 3300044719 Bacteria 2896
187 Ga0466960_0039801 3300044901 Bacteria 2219
188 Ga0466960_0078143 3300044901 Bacteria 1661
189 Ga0466959_0009248 3300045049 Bacteria 7003
190 Ga0451576_0003144 3300045051 Bacteria 23130
191 Ga0451576_0045450 3300045051 Bacteria 4625
192 Ga0466967_0997876 3300045976 Bacteria 834
193 Ga0495583_0000428 3300046506 Bacteria 63526
194 Ga0495606_0000821 3300046507 Bacteria 47099
195 Ga0495625_0062527 3300046660 Bacteria 2631
196 Ga0495647_0116672 3300046681 Bacteria 1119
197 Ga0495669_0047699 3300046684 Bacteria 1914
198 Ga0495671_0218492 3300046692 Bacteria 923
199 Ga0495649_0000523 3300046694 Bacteria 32634
200 Ga0495589_0001294 3300046794 Bacteria 14757
201 Ga0495683_0181151 3300047323 Bacteria 962
202 Ga0495686_0019921 3300047472 Bacteria 4476
203 Ga0496106_0451364 3300048909 Bacteria 1033
204 Ga0496122_0019951 3300048925 Bacteria 6095
205 Ga0496122_0148291 3300048925 Bacteria 1453
206 Ga0496123_0030321 3300048926 Bacteria 3961
207 Ga0496123_0035366 3300048926 Bacteria 3560
208 Ga0496124_0090438 3300048927 Bacteria 2497
209 Ga0496125_0004191 3300048928 Bacteria 16798
210 Ga0496126_0067499 3300048929 Bacteria 3195
211 Ga0501043_0000058 3300049579 Bacteria 102030
212 Ga0501046_0000051 3300049580 Bacteria 133545
213 Ga0501047_0000003 3300049581 Bacteria 508375
214 Ga0501048_0000321 3300049582 Bacteria 32907
215 Ga0501067_0119947 3300049583 Bacteria 1463
216 Ga0501071_0121532 3300049587 Bacteria 1936
217 Ga0501077_0407840 3300049593 Bacteria 869
218 Ga0501083_0078955 3300049744 Bacteria 2183
219 Ga0501044_0016706 3300049823 Bacteria 7879
220 Ga0501045_0003740 3300049824 Bacteria 10467
221 nmdc:mga09592_819_c1 3300050508 Bacteria 24059
222 nmdc:mga0qj67_26569_c1 3300050509 Bacteria 4480
223 nmdc:mga08y16_870249_c1 3300050511 Bacteria 889
224 nmdc:mga0n895_613364_c1 3300050512 Bacteria 1089
225 Ga0500647_0119704 3300053091 Bacteria 1247
226 Ga0500566_0039743 3300053094 Bacteria 2719
227 Ga0500640_001566 3300053095 Bacteria 7035
228 Ga0500554_000511 3300053102 Bacteria 8073
229 Ga0500560_076243 3300053107 Bacteria 1110
230 Ga0500572_011152 3300053111 Bacteria 2165
231 Ga0500595_000227 3300053119 Bacteria 38046
232 Ga0500614_000050 3300053123 Bacteria 25084
233 Ga0500559_0117437 3300053136 Bacteria 1235
234 Ga0500636_0010685 3300053177 Bacteria 5360
235 Ga0500661_035555 3300055283 Bacteria 881
236 Ga0466962_0016515 3300061719 Bacteria 3560
237 2600443477 2600254954 Bacteria 5100516
238 2602009069 2600255389 Bacteria 5275336
239 2643967926 2643221592 Bacteria 6608788
240 2644143174 2643221625 Bacteria 6512927
241 2644271738 2643221648 Bacteria 6521465
242 2644301128 2643221654 Bacteria 5273570
243 2823425087 2823421272 Bacteria 5372474
244 2831867648 2831864461 Bacteria 6502356
245 2919501803 2919501602 Bacteria 5286340
246 2926063476 2926063275 Bacteria 5285848
247 651177201 651053060 Bacteria 4689946
248 8034963061 8034962539 Bacteria 4884839
249 Ga0163162_10004267
250 JGI25156J39149_1000273
251 rootH1_10027548
252 rootH1_10145797
253 rootH2_10013109
254 Ga0055539_1010761
255 Ga0065707_10090408
256 Ga0070658_10070902
257 Ga0070676_10005990
258 Ga0070690_100504647
259 Ga0068869_100053547
260 Ga0068868_100052700
261 Ga0070689_100082852
262 Ga0070689_100130648
263 Ga0070689_100354488
264 Ga0070687_100012122
265 Ga0070668_100057612
266 Ga0070669_100050292
267 Ga0070671_100030390
268 Ga0070671_100182504
269 Ga0070673_100076078
270 Ga0070688_100073365
271 Ga0070688_100401687
272 Ga0070667_100001934
273 Ga0070667_100009643
274 Ga0070667_100021857
275 Ga0070667_100124216
276 Ga0070700_100018098
277 Ga0070694_100202026
278 Ga0070678_100343206
279 Ga0068867_100000605
280 Ga0068867_100008124
281 Ga0068867_100592092
282 Ga0070698_100002538
283 Ga0070698_100593097
284 Ga0068853_100044880
285 Ga0068853_100153395
286 Ga0070672_100074861
287 Ga0070686_100051412
288 Ga0070686_100414131
289 Ga0070686_100474903
290 Ga0070665_100002777
291 Ga0068855_100096252
292 Ga0068852_100015571
293 Ga0068852_100324740
294 Ga0068859_100049503
295 Ga0068859_100083712
296 Ga0068861_100001008
297 Ga0068861_100056316
298 Ga0068861_100163706
299 Ga0068851_10040172
300 Ga0068863_100013265
301 Ga0068863_100069989
302 Ga0068863_100091683
303 Ga0068858_100004551
304 Ga0068860_100000384
305 Ga0068860_100015888
306 Ga0068860_100119917
307 Ga0068860_100539698
308 Ga0068860_100579343
309 Ga0068862_100018372
310 Ga0068862_100277524
311 Ga0075366_10188013
312 Ga0068871_100058650
313 Ga0075430_100019628
314 Ga0075429_100000224
315 Ga0068865_100001306
316 Ga0068865_100283428
317 Ga0097620_100049503
318 Ga0097620_100083711
319 Ga0099795_10000102
320 Ga0105240_10024255
321 Ga0105240_10172468
322 Ga0105243_10045552
323 Ga0105243_10736405
324 Ga0105242_10417468
325 Ga0105248_10185086
326 Ga0105237_10086761
327 Ga0105249_10007351
328 Ga0099796_10000420
329 Ga0105239_11012285
330 Ga0157378_10014039
331 Ga0163162_10082669
332 Ga0157375_10087416
333 Ga0157375_10106276
334 Ga0157375_10110088
335 Ga0157380_10014579
336 Ga0157379_10002106
337 Ga0157379_10034997
338 Ga0157376_10131581
339 Ga0163161_10362743
340 Ga0207427_100825
341 Ga0209258_102754
342 Ga0209677_101960
343 Ga0209759_1011243
344 Ga0209759_1021223
345 Ga0207656_10218709
346 Ga0207642_10313729
347 Ga0207680_10101608
348 Ga0207699_10452608
349 Ga0207645_10002476
350 Ga0207705_10051601
351 Ga0207695_10020731
352 Ga0207695_10052682
353 Ga0207662_10029286
354 Ga0207662_10267954
355 Ga0207681_10678606
356 Ga0207644_10023648
357 Ga0207644_10611444
358 Ga0207709_10114716
359 Ga0207670_10017410
360 Ga0207670_10043682
361 Ga0207670_10133695
362 Ga0207670_10362365
363 Ga0207704_10129148
364 Ga0207704_10196567
365 Ga0207691_10006206
366 Ga0207691_10051674
367 Ga0207711_10025270
368 Ga0207689_10061061
369 Ga0207667_10023843
370 Ga0207651_10158477
371 Ga0207668_10027086
372 Ga0207658_10017834
373 Ga0207658_10026544
374 Ga0207677_10029317
375 Ga0207703_10031574
376 Ga0207703_10078041
377 Ga0207639_10035627
378 Ga0207708_10026776
379 Ga0207708_10112596
380 Ga0207641_10005295
381 Ga0207641_10074502
382 Ga0207641_10584655
383 Ga0207648_10009307
384 Ga0207648_10013992
385 Ga0207648_10165114
386 Ga0207675_100001873
387 Ga0207675_100032509
388 Ga0207675_100243192
389 Ga0207683_10383164
390 Ga0207683_10818222
391 Ga0207698_10021292
392 Ga0209179_1000960
393 Ga0268265_10006473
394 Ga0268265_10292931
395 Ga0268265_10738219
396 Ga0268264_10002327
397 Ga0268264_10375785
398 Ga0268264_10456691
399 Ga0268264_10698787
400 Ga0307515_10000089
401 Ga0307515_10070106
402 Ga0265324_10038315
403 Ga0307511_10073558
404 Ga0307513_10002535
405 Ga0307513_10037112
406 Ga0307408_100000020
407 Ga0307410_10299340
408 Ga0307507_10121125
409 Ga0373936_0036415
410 Ga0373939_0059766
411 Ga0373961_0000166
412 Ga0373937_0076364
413 Ga0373925_0001792
414 Ga0373925_0057668
415 Ga0395899_0001500
416 Ga0395900_0044505
417 Ga0395898_0014598
418 Ga0395905_0132563
419 Ga0395905_0193544
420 Ga0395901_0010306
421 Ga0395901_0020407
422 Ga0436363_1601503
423 Ga0451789_1252533
424 Ga0439455_0102597
425 Ga0451577_0040030
426 Ga0466969_0019023
427 Ga0466977_0000036
428 Ga0466965_0121330
429 Ga0466966_0029611
430 Ga0466966_0174964
431 Ga0466961_0035256
432 Ga0466963_0384736
433 Ga0453684_0222387
434 Ga0466971_0021115
435 Ga0466960_0039801
436 Ga0466960_0078143
437 Ga0466959_0009248
438 Ga0451576_0003144
439 Ga0451576_0045450
440 Ga0466967_0997876
441 Ga0495583_0000428
442 Ga0495606_0000821
443 Ga0495625_0062527
444 Ga0495647_0116672
445 Ga0495669_0047699
446 Ga0495671_0218492
447 Ga0495649_0000523
448 Ga0495589_0001294
449 Ga0495683_0181151
450 Ga0495686_0019921
451 Ga0496106_0451364
452 Ga0496122_0019951
453 Ga0496122_0148291
454 Ga0496123_0030321
455 Ga0496123_0035366
456 Ga0496124_0090438
457 Ga0496125_0004191
458 Ga0496126_0067499
459 Ga0501043_0000058
460 Ga0501046_0000051
461 Ga0501047_0000003
462 Ga0501048_0000321
463 Ga0501067_0119947
464 Ga0501071_0121532
465 Ga0501077_0407840
466 Ga0501083_0078955
467 Ga0501044_0016706
468 Ga0501045_0003740
469 nmdc:mga09592_819_c1
470 nmdc:mga0qj67_26569_c1
471 nmdc:mga08y16_870249_c1
472 nmdc:mga0n895_613364_c1
473 Ga0500647_0119704
474 Ga0500566_0039743
475 Ga0500640_001566
476 Ga0500554_000511
477 Ga0500560_076243
478 Ga0500572_011152
479 Ga0500595_000227
480 Ga0500614_000050
481 Ga0500559_0117437
482 Ga0500636_0010685
483 Ga0500661_035555
484 Ga0466962_0016515
485 2600443477
486 2602009069
487 2643967926
488 2644143174
489 2644271738
490 2644301128
491 2823425087
492 2831867648
493 2919501803
494 2926063476
495 651177201
496 8034963061

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

41

111

0.89

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

35

110

0.81

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

38

116

0.81

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

126

239

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
4mp4-assembly2.cif.gz_C-2 crystal structure of a glutathione transferase family member from acinetobacter baumannii, target efi-501785, apo structure 0.8773 2 208
4isd-assembly3.cif.gz_E-2 crystal structure of glutathione transferase homolog from burkholderia gl bgr1, target efi-501803, with bound glutathione 0.8619 2 208
4mp4-assembly1.cif.gz_A crystal structure of a glutathione transferase family member from acinetobacter baumannii, target efi-501785, apo structure 0.8595 2 211
3bby-assembly1.cif.gz_A-2 crystal structure of glutathione s-transferase (np_416804.1) from escherichia coli k12 at 1.85 a resolution 0.859 2 210
4jbb-assembly1.cif.gz_A-2 crystal structure of glutathione s-transferase a6tby7(target efi-507184) from klebsiella pneumoniae mgh 78578, gsh complex 0.8575 2 210
ID Description Score Start End Superfamily
4mp4A01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8668 2 83 3.40.30.10
4isdD01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.866 2 84 3.40.30.10
4jbbA02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.8641 87 197 1.20.1050.10
1yy7B01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.854 2 83 3.40.30.10
4mp4C02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.8512 86 197 1.20.1050.10
ID Description Score Start End GO Terms
AF-A0A536XIR5-F1-model_v4 Glutathione S-transferase family protein 0.9864 1 199 GO:0004364
GO:0006559
GO:0006749
GO:0016034
AF-A0A3D3D1N6-F1-model_v4 deleted 0.9864 82 217
AF-A0A2U0YJ11-F1-model_v4 deleted 0.9826 2 225
AF-A0A1Q3J4K8-F1-model_v4 deleted 0.9805 2 164
AF-A0A7J6Z5Q8-F1-model_v4 deleted 0.9779 2 151

Map