F360109

General Info

Members Datasets Scaffolds Average Seq Length
248 148 496 117

Family's Representative Sequence

Representative Sequence 3300044658|Ga0466972_0047837|Ga0466972_0047837_1576_1956
Length 126
Sequence MLSAKYRFHGHGSLRYVYKNGQAVRSRLITIKHTSNPHRKVSRFSVVVSKKVHKSAVGRNRIRRRIYEIVRHEIPKMRGVHDVAIMVFSSEVITMPHEELQQTVLQLLDQAHLYPKEEKDGILKDR

Samples

Sample ID Description Type Environment
1 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
31 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
36 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
49 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
81 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
82 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
83 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
84 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
85 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
86 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
87 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
88 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
89 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
90 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
91 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
92 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
93 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
94 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
95 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
96 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
97 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
98 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
99 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
100 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
101 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
102 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
103 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
104 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
105 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
106 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
107 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
108 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
109 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
110 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
111 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
112 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
113 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
114 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
115 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
116 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
117 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
118 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
122 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
123 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
124 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
125 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
126 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
127 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
128 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
129 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
130 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
131 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
132 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
133 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
134 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
135 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
136 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
137 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
138 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
139 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
140 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
141 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
142 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
143 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
144 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
145 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
146 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
147 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
148 3300053738 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 27.42
Nodule 0
Rhizoplane 0.4
Rhizosphere 69.35
Stem 0
Stem Tuber 0
Unclassified 17.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466972_0047837 3300044658 Bacteria 2067
2 JGI24736J21556_1005805 3300001904 Bacteria 2086
3 JGI24740J21852_10028232 3300001979 Bacteria 1856
4 JGI24739J22299_10000063 3300001989 Bacteria 29854
5 JGI24739J22299_10037068 3300001989 Bacteria 1644
6 JGI24737J22298_10000145 3300001990 Bacteria 22015
7 JGI24743J22301_10003289 3300001991 Unclassified 2543
8 JGI24735J21928_10000067 3300002067 Bacteria 42751
9 JGI24738J21930_10000073 3300002075 Bacteria 21429
10 rootH2_10004711 3300003320 Bacteria 129035
11 rootH2_10231047 3300003320 Unclassified 2868
12 rootL2_10212901 3300003322 Bacteria 2667
13 rootL2_10283333 3300003322 Unclassified 1693
14 rootH1_10021217 3300003323 Bacteria 85014
15 rootH1_10103469 3300003323 Bacteria 10129
16 Ga0070658_10000009 3300005327 Bacteria 319868
17 Ga0070658_10709224 3300005327 Bacteria 873
18 Ga0070680_100231373 3300005336 Unclassified 1561
19 Ga0070660_100001123 3300005339 Bacteria 18053
20 Ga0070660_100543711 3300005339 Bacteria 969
21 Ga0070661_100023437 3300005344 Bacteria 4424
22 Ga0070661_100618677 3300005344 Bacteria 877
23 Ga0070675_100145257 3300005354 Bacteria 2030
24 Ga0070659_100001064 3300005366 Bacteria 20072
25 Ga0070662_100039453 3300005457 Unclassified 3358
26 Ga0070662_101408827 3300005457 Unclassified 600
27 Ga0070679_100097683 3300005530 Bacteria 2924
28 Ga0070684_100374788 3300005535 Bacteria 1310
29 Ga0068853_101400223 3300005539 Unclassified 676
30 Ga0068855_100000017 3300005563 Bacteria 212278
31 Ga0068855_100007452 3300005563 Bacteria 13252
32 Ga0068855_100799868 3300005563 Unclassified 1002
33 Ga0070664_100000338 3300005564 Bacteria 34161
34 Ga0068857_100001672 3300005577 Bacteria 17821
35 Ga0068854_100004390 3300005578 Bacteria 8897
36 Ga0068856_100000060 3300005614 Bacteria 101415
37 Ga0068856_100000117 3300005614 Bacteria 79068
38 Ga0068856_100443079 3300005614 Bacteria 1319
39 Ga0068856_101474926 3300005614 Bacteria 694
40 Ga0068852_100045261 3300005616 Unclassified 3742
41 Ga0068852_100084623 3300005616 Bacteria 2823
42 Ga0081455_10000006 3300005937 Bacteria 323066
43 Ga0075365_10000004 3300006038 Bacteria 144817
44 Ga0075365_10000106 3300006038 Bacteria 24747
45 Ga0075365_10004161 3300006038 Bacteria 7614
46 Ga0075365_10044911 3300006038 Bacteria 2897
47 Ga0075365_10156453 3300006038 Bacteria 1586
48 Ga0075368_10005731 3300006042 Bacteria 4294
49 Ga0075363_100015595 3300006048 Bacteria 3738
50 Ga0075364_10011613 3300006051 Bacteria 5355
51 Ga0075362_10012492 3300006177 Bacteria 3376
52 Ga0075367_10003180 3300006178 Bacteria 7749
53 Ga0075367_10257879 3300006178 Unclassified 1094
54 Ga0075369_10000335 3300006186 Bacteria 14037
55 Ga0075366_10001364 3300006195 Bacteria 12202
56 Ga0075366_10004907 3300006195 Bacteria 7217
57 Ga0075366_10080593 3300006195 Bacteria 1944
58 Ga0075366_10518650 3300006195 Bacteria 737
59 Ga0097621_100666898 3300006237 Bacteria 955
60 Ga0075370_10151733 3300006353 Unclassified 1358
61 Ga0075370_10322338 3300006353 Unclassified 920
62 Ga0075370_10335679 3300006353 Unclassified 902
63 Ga0068871_100142625 3300006358 Bacteria 2038
64 Ga0075428_100183960 3300006844 Bacteria 2261
65 Ga0068865_100000969 3300006881 Bacteria 16387
66 Ga0105240_10000030 3300009093 Bacteria 321312
67 Ga0105240_10003612 3300009093 Bacteria 23956
68 Ga0105240_10915364 3300009093 Bacteria 942
69 Ga0105245_10124226 3300009098 Bacteria 2414
70 Ga0105241_10803539 3300009174 Bacteria 867
71 Ga0105241_10989316 3300009174 Bacteria 786
72 Ga0105241_11315789 3300009174 Unclassified 689
73 Ga0105237_10000001 3300009545 Bacteria 1009213
74 Ga0105238_10562192 3300009551 Bacteria 1146
75 Ga0105249_13455568 3300009553 Unclassified 508
76 Ga0105032_100002 3300009979 Bacteria 303884
77 Ga0105032_100010 3300009979 Bacteria 81059
78 Ga0105029_102216 3300009984 Bacteria 1256
79 Ga0105029_119864 3300009984 Unclassified 558
80 Ga0105239_10002161 3300010375 Bacteria 25290
81 Ga0105246_10003793 3300011119 Bacteria 9154
82 Ga0105246_10519101 3300011119 Bacteria 1015
83 Ga0105246_10823925 3300011119 Unclassified 825
84 Ga0157373_10006025 3300013100 Bacteria 9067
85 Ga0157373_10012732 3300013100 Bacteria 6181
86 Ga0157373_10404148 3300013100 Unclassified 979
87 Ga0157373_10974507 3300013100 Unclassified 632
88 Ga0157371_10035325 3300013102 Bacteria 3582
89 Ga0157371_10077373 3300013102 Bacteria 2355
90 Ga0157370_10000812 3300013104 Bacteria 39488
91 Ga0157370_10000984 3300013104 Bacteria 36041
92 Ga0157370_10048283 3300013104 Bacteria 4078
93 Ga0157370_10154312 3300013104 Bacteria 2136
94 Ga0157369_10000003 3300013105 Bacteria 507337
95 Ga0157369_10000026 3300013105 Bacteria 216023
96 Ga0157369_10000199 3300013105 Bacteria 83451
97 Ga0157369_10023455 3300013105 Bacteria 6872
98 Ga0157369_10058495 3300013105 Bacteria 4158
99 Ga0157369_10083971 3300013105 Bacteria 3405
100 Ga0157374_10116961 3300013296 Bacteria 2569
101 Ga0157374_11064371 3300013296 Bacteria 829
102 Ga0157372_10000007 3300013307 Bacteria 340690
103 Ga0157372_10000027 3300013307 Bacteria 186906
104 Ga0157372_10071168 3300013307 Bacteria 3916
105 Ga0157372_10093755 3300013307 Bacteria 3417
106 Ga0157377_10000264 3300014745 Bacteria 25782
107 Ga0157376_10000054 3300014969 Bacteria 99154
108 Ga0157376_10010602 3300014969 Bacteria 6749
109 Ga0207688_10014552 3300025901 Unclassified 4274
110 Ga0207647_10000177 3300025904 Bacteria 51270
111 Ga0207705_10000010 3300025909 Bacteria 518023
112 Ga0207654_10026476 3300025911 Bacteria 3140
113 Ga0207654_10780925 3300025911 Unclassified 689
114 Ga0207654_11202305 3300025911 Bacteria 552
115 Ga0207695_10000009 3300025913 Bacteria 1034276
116 Ga0207695_10003061 3300025913 Bacteria 23962
117 Ga0207671_10000003 3300025914 Bacteria 1065461
118 Ga0207657_10002733 3300025919 Bacteria 18998
119 Ga0207657_10003013 3300025919 Bacteria 18055
120 Ga0207649_10032594 3300025920 Bacteria 3108
121 Ga0207652_10933743 3300025921 Unclassified 765
122 Ga0207690_10012004 3300025932 Bacteria 5181
123 Ga0207690_10013713 3300025932 Bacteria 4878
124 Ga0207706_10000004 3300025933 Bacteria 280765
125 Ga0207704_10001729 3300025938 Bacteria 9776
126 Ga0207661_10046264 3300025944 Unclassified 3450
127 Ga0207661_10581165 3300025944 Bacteria 1027
128 Ga0207679_10000069 3300025945 Bacteria 93919
129 Ga0207667_10000048 3300025949 Bacteria 238293
130 Ga0207667_10004604 3300025949 Bacteria 16915
131 Ga0207667_11815170 3300025949 Unclassified 574
132 Ga0207640_10006327 3300025981 Bacteria 6494
133 Ga0207639_11357209 3300026041 Unclassified 667
134 Ga0207702_10000097 3300026078 Bacteria 101497
135 Ga0207702_10000271 3300026078 Bacteria 59575
136 Ga0207702_10191784 3300026078 Bacteria 1889
137 Ga0207702_11643376 3300026078 Bacteria 635
138 Ga0207674_10000667 3300026116 Bacteria 44679
139 Ga0207698_10000107 3300026142 Bacteria 52384
140 Ga0207698_10065194 3300026142 Bacteria 2859
141 Ga0209813_10001109 3300027866 Bacteria 6014
142 Ga0316177_1020215 3300030731 Bacteria 811
143 Ga0314311_1169809 3300030733 Bacteria 4227
144 Ga0316179_1072927 3300030734 Bacteria 8292
145 Ga0316180_1165797 3300030736 Bacteria 3820
146 Ga0316183_1037085 3300030742 Bacteria 2830
147 Ga0316183_1135303 3300030742 Bacteria 739
148 Ga0316183_1185963 3300030742 Bacteria 1540
149 Ga0316183_1187333 3300030742 Bacteria 18619
150 Ga0316181_1072339 3300030744 Unclassified 755
151 Ga0316181_1212132 3300030744 Unclassified 781
152 Ga0316181_1226594 3300030744 Bacteria 25946
153 Ga0316182_1038782 3300030745 Bacteria 5372
154 Ga0316182_1039584 3300030745 Bacteria 7468
155 Ga0316182_1078268 3300030745 Bacteria 1381
156 Ga0316182_1100023 3300030745 Bacteria 663
157 Ga0316182_1185273 3300030745 Bacteria 13671
158 Ga0316182_1376285 3300030745 Bacteria 16690
159 Ga0307516_10007258 3300031730 Bacteria 12764
160 Ga0307405_10064315 3300031731 Bacteria 2331
161 Ga0307412_10011652 3300031911 Bacteria 5100
162 Ga0395899_0009895 3300037312 Bacteria 7311
163 Ga0395900_0000001 3300037418 Bacteria 931146
164 Ga0395898_0000002 3300037466 Bacteria 931013
165 Ga0395901_0000006 3300038443 Bacteria 514112
166 Ga0439447_005497 3300041407 Bacteria 4206
167 Ga0439461_0000070 3300041410 Bacteria 13169
168 Ga0439461_0000652 3300041410 Bacteria 5006
169 Ga0439466_0069867 3300041411 Bacteria 1120
170 Ga0439442_031833 3300042002 Bacteria 1102
171 Ga0439442_068827 3300042002 Bacteria 753
172 Ga0439445_0001134 3300042004 Bacteria 5705
173 Ga0439432_005224 3300042006 Bacteria 4688
174 Ga0439432_082656 3300042006 Bacteria 972
175 Ga0439463_002381 3300042016 Bacteria 4792
176 Ga0439463_051001 3300042016 Bacteria 1055
177 Ga0450919_007288 3300042121 Bacteria 1294
178 Ga0450920_001940 3300042122 Bacteria 3480
179 Ga0450903_031224 3300042138 Bacteria 803
180 Ga0450906_005836 3300042145 Bacteria 2512
181 Ga0439446_0000002 3300042156 Bacteria 177065
182 Ga0439446_0002594 3300042156 Bacteria 4358
183 Ga0450909_003971 3300042185 Bacteria 2107
184 Ga0439434_0001460 3300042435 Bacteria 6792
185 Ga0439434_0005759 3300042435 Bacteria 3616
186 Ga0439434_0099465 3300042435 Bacteria 936
187 Ga0439464_0000042 3300042439 Bacteria 16260
188 Ga0450918_009327 3300042531 Unclassified 1722
189 Ga0466965_0000077 3300044683 Bacteria 28675
190 Ga0466960_0158444 3300044901 Unclassified 1214
191 Ga0495638_0000285 3300046460 Bacteria 67536
192 Ga0495597_0044645 3300046542 Bacteria 1970
193 Ga0495671_0032804 3300046692 Bacteria 2649
194 Ga0495660_0000005 3300046810 Bacteria 574567
195 Ga0496113_1308866 3300048916 Unclassified 563
196 Ga0501034_0000170 3300049571 Bacteria 120823
197 Ga0501034_0023419 3300049571 Bacteria 6292
198 Ga0501037_0000011 3300049573 Bacteria 196525
199 Ga0501038_0027298 3300049574 Bacteria 5081
200 Ga0501044_1325393 3300049823 Bacteria 586
201 nmdc:mga03683_8268_c1 3300050489 Bacteria 3651
202 nmdc:mga03n38_57688_c1 3300050490 Bacteria 1756
203 nmdc:mga00v17_25452_c1 3300050491 Bacteria 3440
204 nmdc:mga00v17_29607_c1 3300050491 Bacteria 3215
205 nmdc:mga0yw44_110663_c1 3300050492 Unclassified 1759
206 nmdc:mga0yw44_11_c1 3300050492 Bacteria 130624
207 nmdc:mga0yw44_127695_c1 3300050492 Bacteria 1643
208 nmdc:mga0yw44_35315_c1 3300050492 Unclassified 2937
209 nmdc:mga0yw44_5_c1 3300050492 Bacteria 313167
210 nmdc:mga0yw44_82_c2 3300050492 Bacteria 32345
211 nmdc:mga0k408_1863_c2 3300050493 Bacteria 10923
212 nmdc:mga0k408_1914_c1 3300050493 Bacteria 11140
213 nmdc:mga0k408_567292_c1 3300050493 Bacteria 670
214 nmdc:mga0k408_772152_c1 3300050493 Unclassified 561
215 nmdc:mga06z11_208344_c1 3300050494 Unclassified 1138
216 nmdc:mga06z11_321_c1 3300050494 Bacteria 18195
217 nmdc:mga04h51_1053_c1 3300050495 Bacteria 6340
218 nmdc:mga07m45_140972_c1 3300050496 Unclassified 1396
219 nmdc:mga07m45_163375_c1 3300050496 Unclassified 1293
220 nmdc:mga07m45_20177_c1 3300050496 Bacteria 1979
221 nmdc:mga07m45_40692_c1 3300050496 Bacteria 2601
222 nmdc:mga07m45_468600_c1 3300050496 Unclassified 730
223 Ga0500643_003279 3300053087 Bacteria 7872
224 Ga0500644_0015554 3300053088 Bacteria 2173
225 Ga0500646_0000002 3300053090 Bacteria 178770
226 Ga0500583_0000167 3300053092 Bacteria 27217
227 Ga0500651_0000021 3300053093 Bacteria 137927
228 Ga0500641_0000001 3300053096 Bacteria 1115973
229 Ga0500650_0034447 3300053098 Bacteria 2314
230 Ga0500555_000023 3300053103 Bacteria 150521
231 Ga0500569_000009 3300053109 Bacteria 67536
232 Ga0500569_149067 3300053109 Unclassified 789
233 Ga0500593_159971 3300053117 Unclassified 862
234 Ga0500594_0000008 3300053118 Bacteria 102101
235 Ga0500652_000001 3300053131 Bacteria 946868
236 Ga0500652_148010 3300053131 Bacteria 975
237 Ga0500577_0003634 3300053142 Bacteria 4017
238 Ga0500577_0121360 3300053142 Bacteria 1088
239 Ga0500588_0000078 3300053146 Bacteria 13106
240 Ga0500616_0000012 3300053153 Bacteria 681798
241 Ga0500616_0015088 3300053153 Unclassified 4427
242 Ga0500616_0069294 3300053153 Unclassified 1804
243 Ga0500620_003540 3300053155 Bacteria 3353
244 Ga0500620_046355 3300053155 Unclassified 1444
245 Ga0500570_117357 3300053724 Unclassified 1057
246 Ga0500570_164228 3300053724 Bacteria 757
247 Ga0500656_016332 3300053732 Bacteria 878
248 Ga0500613_031923 3300053738 Unclassified 760
249 Ga0466972_0047837
250 JGI24736J21556_1005805
251 JGI24740J21852_10028232
252 JGI24739J22299_10000063
253 JGI24739J22299_10037068
254 JGI24737J22298_10000145
255 JGI24743J22301_10003289
256 JGI24735J21928_10000067
257 JGI24738J21930_10000073
258 rootH2_10004711
259 rootH2_10231047
260 rootL2_10212901
261 rootL2_10283333
262 rootH1_10021217
263 rootH1_10103469
264 Ga0070658_10000009
265 Ga0070658_10709224
266 Ga0070680_100231373
267 Ga0070660_100001123
268 Ga0070660_100543711
269 Ga0070661_100023437
270 Ga0070661_100618677
271 Ga0070675_100145257
272 Ga0070659_100001064
273 Ga0070662_100039453
274 Ga0070662_101408827
275 Ga0070679_100097683
276 Ga0070684_100374788
277 Ga0068853_101400223
278 Ga0068855_100000017
279 Ga0068855_100007452
280 Ga0068855_100799868
281 Ga0070664_100000338
282 Ga0068857_100001672
283 Ga0068854_100004390
284 Ga0068856_100000060
285 Ga0068856_100000117
286 Ga0068856_100443079
287 Ga0068856_101474926
288 Ga0068852_100045261
289 Ga0068852_100084623
290 Ga0081455_10000006
291 Ga0075365_10000004
292 Ga0075365_10000106
293 Ga0075365_10004161
294 Ga0075365_10044911
295 Ga0075365_10156453
296 Ga0075368_10005731
297 Ga0075363_100015595
298 Ga0075364_10011613
299 Ga0075362_10012492
300 Ga0075367_10003180
301 Ga0075367_10257879
302 Ga0075369_10000335
303 Ga0075366_10001364
304 Ga0075366_10004907
305 Ga0075366_10080593
306 Ga0075366_10518650
307 Ga0097621_100666898
308 Ga0075370_10151733
309 Ga0075370_10322338
310 Ga0075370_10335679
311 Ga0068871_100142625
312 Ga0075428_100183960
313 Ga0068865_100000969
314 Ga0105240_10000030
315 Ga0105240_10003612
316 Ga0105240_10915364
317 Ga0105245_10124226
318 Ga0105241_10803539
319 Ga0105241_10989316
320 Ga0105241_11315789
321 Ga0105237_10000001
322 Ga0105238_10562192
323 Ga0105249_13455568
324 Ga0105032_100002
325 Ga0105032_100010
326 Ga0105029_102216
327 Ga0105029_119864
328 Ga0105239_10002161
329 Ga0105246_10003793
330 Ga0105246_10519101
331 Ga0105246_10823925
332 Ga0157373_10006025
333 Ga0157373_10012732
334 Ga0157373_10404148
335 Ga0157373_10974507
336 Ga0157371_10035325
337 Ga0157371_10077373
338 Ga0157370_10000812
339 Ga0157370_10000984
340 Ga0157370_10048283
341 Ga0157370_10154312
342 Ga0157369_10000003
343 Ga0157369_10000026
344 Ga0157369_10000199
345 Ga0157369_10023455
346 Ga0157369_10058495
347 Ga0157369_10083971
348 Ga0157374_10116961
349 Ga0157374_11064371
350 Ga0157372_10000007
351 Ga0157372_10000027
352 Ga0157372_10071168
353 Ga0157372_10093755
354 Ga0157377_10000264
355 Ga0157376_10000054
356 Ga0157376_10010602
357 Ga0207688_10014552
358 Ga0207647_10000177
359 Ga0207705_10000010
360 Ga0207654_10026476
361 Ga0207654_10780925
362 Ga0207654_11202305
363 Ga0207695_10000009
364 Ga0207695_10003061
365 Ga0207671_10000003
366 Ga0207657_10002733
367 Ga0207657_10003013
368 Ga0207649_10032594
369 Ga0207652_10933743
370 Ga0207690_10012004
371 Ga0207690_10013713
372 Ga0207706_10000004
373 Ga0207704_10001729
374 Ga0207661_10046264
375 Ga0207661_10581165
376 Ga0207679_10000069
377 Ga0207667_10000048
378 Ga0207667_10004604
379 Ga0207667_11815170
380 Ga0207640_10006327
381 Ga0207639_11357209
382 Ga0207702_10000097
383 Ga0207702_10000271
384 Ga0207702_10191784
385 Ga0207702_11643376
386 Ga0207674_10000667
387 Ga0207698_10000107
388 Ga0207698_10065194
389 Ga0209813_10001109
390 Ga0316177_1020215
391 Ga0314311_1169809
392 Ga0316179_1072927
393 Ga0316180_1165797
394 Ga0316183_1037085
395 Ga0316183_1135303
396 Ga0316183_1185963
397 Ga0316183_1187333
398 Ga0316181_1072339
399 Ga0316181_1212132
400 Ga0316181_1226594
401 Ga0316182_1038782
402 Ga0316182_1039584
403 Ga0316182_1078268
404 Ga0316182_1100023
405 Ga0316182_1185273
406 Ga0316182_1376285
407 Ga0307516_10007258
408 Ga0307405_10064315
409 Ga0307412_10011652
410 Ga0395899_0009895
411 Ga0395900_0000001
412 Ga0395898_0000002
413 Ga0395901_0000006
414 Ga0439447_005497
415 Ga0439461_0000070
416 Ga0439461_0000652
417 Ga0439466_0069867
418 Ga0439442_031833
419 Ga0439442_068827
420 Ga0439445_0001134
421 Ga0439432_005224
422 Ga0439432_082656
423 Ga0439463_002381
424 Ga0439463_051001
425 Ga0450919_007288
426 Ga0450920_001940
427 Ga0450903_031224
428 Ga0450906_005836
429 Ga0439446_0000002
430 Ga0439446_0002594
431 Ga0450909_003971
432 Ga0439434_0001460
433 Ga0439434_0005759
434 Ga0439434_0099465
435 Ga0439464_0000042
436 Ga0450918_009327
437 Ga0466965_0000077
438 Ga0466960_0158444
439 Ga0495638_0000285
440 Ga0495597_0044645
441 Ga0495671_0032804
442 Ga0495660_0000005
443 Ga0496113_1308866
444 Ga0501034_0000170
445 Ga0501034_0023419
446 Ga0501037_0000011
447 Ga0501038_0027298
448 Ga0501044_1325393
449 nmdc:mga03683_8268_c1
450 nmdc:mga03n38_57688_c1
451 nmdc:mga00v17_25452_c1
452 nmdc:mga00v17_29607_c1
453 nmdc:mga0yw44_110663_c1
454 nmdc:mga0yw44_11_c1
455 nmdc:mga0yw44_127695_c1
456 nmdc:mga0yw44_35315_c1
457 nmdc:mga0yw44_5_c1
458 nmdc:mga0yw44_82_c2
459 nmdc:mga0k408_1863_c2
460 nmdc:mga0k408_1914_c1
461 nmdc:mga0k408_567292_c1
462 nmdc:mga0k408_772152_c1
463 nmdc:mga06z11_208344_c1
464 nmdc:mga06z11_321_c1
465 nmdc:mga04h51_1053_c1
466 nmdc:mga07m45_140972_c1
467 nmdc:mga07m45_163375_c1
468 nmdc:mga07m45_20177_c1
469 nmdc:mga07m45_40692_c1
470 nmdc:mga07m45_468600_c1
471 Ga0500643_003279
472 Ga0500644_0015554
473 Ga0500646_0000002
474 Ga0500583_0000167
475 Ga0500651_0000021
476 Ga0500641_0000001
477 Ga0500650_0034447
478 Ga0500555_000023
479 Ga0500569_000009
480 Ga0500569_149067
481 Ga0500593_159971
482 Ga0500594_0000008
483 Ga0500652_000001
484 Ga0500652_148010
485 Ga0500577_0003634
486 Ga0500577_0121360
487 Ga0500588_0000078
488 Ga0500616_0000012
489 Ga0500616_0015088
490 Ga0500616_0069294
491 Ga0500620_003540
492 Ga0500620_046355
493 Ga0500570_117357
494 Ga0500570_164228
495 Ga0500656_016332
496 Ga0500613_031923

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00825

Ribonuclease_P

Ribonuclease P

2

112

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1a6f-assembly1.cif.gz_A rnase p protein from bacillus subtilis 0.9152 5 120
4jg4-assembly1.cif.gz_A ligand concentration regulates the pathways of coupled protein folding and binding 0.9128 5 121
1a6f-assembly1.cif.gz_A rnase p protein from bacillus subtilis 0.9077 5 120
4jg4-assembly1.cif.gz_A ligand concentration regulates the pathways of coupled protein folding and binding 0.9054 5 121
6ov1-assembly1.cif.gz_A structure of staphylococcus aureus rnase p protein mutant with defective mrna degradation activity 0.8949 10 117
ID Description Score Start End Superfamily
1a6fA00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.9152 5 120 3.30.230.10
af_P9WGZ3_1_112_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.9131 6 117 3.30.230.10
1a6fA00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.9077 5 120 3.30.230.10
6d1rA00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.8831 11 120 3.30.230.10
af_P9WGZ3_1_112_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.883 6 117 3.30.230.10
ID Description Score Start End GO Terms
AF-A0A563DEE3-F1-model_v4 Ribonuclease P protein component (RNase P protein) (RNaseP protein) (EC 3.1.26.5) (Protein C5) 0.9831 6 120 GO:0000049
GO:0001682
GO:0004526
GO:0030677
GO:0042781
AF-A0A431HKQ5-F1-model_v4 Ribonuclease P protein component (RNase P protein) (RNaseP protein) (EC 3.1.26.5) (Protein C5) 0.9787 6 120 GO:0000049
GO:0001682
GO:0004526
GO:0030677
GO:0042781
AF-A0A5C7J840-F1-model_v4 Ribonuclease P protein component (RNase P protein) (RNaseP protein) (EC 3.1.26.5) (Protein C5) 0.9774 6 119 GO:0000049
GO:0001682
GO:0004526
GO:0030677
GO:0042781
AF-A0A521GZR5-F1-model_v4 Ribonuclease P protein component (RNase P protein) (RNaseP protein) (EC 3.1.26.5) (Protein C5) 0.9766 6 119 GO:0000049
GO:0001682
GO:0004526
GO:0030677
GO:0042781
AF-A0A7W4HPX7-F1-model_v4 Ribonuclease P protein component (RNase P protein) (RNaseP protein) (EC 3.1.26.5) (Protein C5) 0.9764 6 119 GO:0000049
GO:0001682
GO:0004526
GO:0005976
GO:0016779
GO:0030677
GO:0042781

Map