F360125

General Info

Members Datasets Scaffolds Average Seq Length
248 141 248 190

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0319786|Ga0451576_0319786_857_1429
Length 183
Sequence MLLFREKVPADWLPKVLNNLPAVLVDHAHLERKAATSALNLEKYRDLFPRVAELNAIAIEELQHFQLVLDLLQRRGIPFGQPGLXXXXRNGQRHQVIDHLICCSLIEGRSCEKFQLLAAELKSVDAELAALYAGLVESEGNHYATYLLMAKAIDEPETQRRLDAFLDLDAKLIRQPNPLPMLH

Samples

Sample ID Description Type Environment
1 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
2 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
5 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
82 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
84 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
85 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
86 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
87 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
88 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
89 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
90 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
91 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
92 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
93 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
94 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
95 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
96 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
97 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
98 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
99 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
100 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
101 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
102 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
103 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
104 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
105 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
106 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
107 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
108 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
109 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
110 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
111 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
112 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
113 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
114 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
115 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
116 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
117 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
118 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
119 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
120 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
121 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
122 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
123 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
124 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
125 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
126 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
127 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
128 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
129 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
130 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
131 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
132 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
135 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
136 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
137 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
138 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
139 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
140 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
141 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.21
Rhizosphere 98.79
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070666_10082327 3300005335 Unclassified 2201
2 Ga0070660_100429152 3300005339 Unclassified 1095
3 Ga0070689_100200406 3300005340 Unclassified 1629
4 Ga0070689_100372920 3300005340 Bacteria 1201
5 Ga0070689_100591744 3300005340 Unclassified 960
6 Ga0070689_101267213 3300005340 Unclassified 663
7 Ga0070669_100674425 3300005353 Unclassified 871
8 Ga0070688_100600777 3300005365 Unclassified 842
9 Ga0070667_100233630 3300005367 Bacteria 1640
10 Ga0070709_10468133 3300005434 Bacteria 952
11 Ga0070714_100029547 3300005435 Bacteria 4557
12 Ga0070713_100399284 3300005436 Unclassified 1284
13 Ga0070701_10000701 3300005438 Bacteria 11860
14 Ga0070711_100354518 3300005439 Unclassified 1180
15 Ga0070694_100019085 3300005444 Bacteria 4358
16 Ga0070694_100727647 3300005444 Bacteria 809
17 Ga0070662_100141630 3300005457 Unclassified 1864
18 Ga0070681_10043866 3300005458 Bacteria 4476
19 Ga0070681_10981992 3300005458 Unclassified 764
20 Ga0068867_100223878 3300005459 Bacteria 1517
21 Ga0070707_100387062 3300005468 Unclassified 1358
22 Ga0070707_100757813 3300005468 Unclassified 934
23 Ga0070679_100420396 3300005530 Unclassified 1282
24 Ga0070679_100536378 3300005530 Unclassified 1114
25 Ga0070679_100551586 3300005530 Unclassified 1096
26 Ga0070684_100597411 3300005535 Unclassified 1026
27 Ga0070697_100542614 3300005536 Bacteria 1019
28 Ga0070686_100010624 3300005544 Bacteria 5201
29 Ga0070665_100683549 3300005548 Unclassified 1039
30 Ga0070704_100065315 3300005549 Bacteria 2619
31 Ga0070704_100206422 3300005549 Bacteria 1589
32 Ga0070704_100266169 3300005549 Bacteria 1414
33 Ga0068855_100019401 3300005563 Bacteria 8170
34 Ga0068855_100110612 3300005563 Bacteria 3154
35 Ga0068855_101014350 3300005563 Unclassified 871
36 Ga0068855_101133573 3300005563 Unclassified 816
37 Ga0068855_101406397 3300005563 Bacteria 719
38 Ga0068855_101457606 3300005563 Bacteria 704
39 Ga0068857_100009468 3300005577 Bacteria 8458
40 Ga0068857_100054229 3300005577 Bacteria 3557
41 Ga0068856_100194258 3300005614 Bacteria 2043
42 Ga0068856_100479163 3300005614 Bacteria 1265
43 Ga0068856_100662665 3300005614 Bacteria 1064
44 Ga0068859_100156071 3300005617 Unclassified 2359
45 Ga0068859_100325378 3300005617 Bacteria 1631
46 Ga0068864_100554473 3300005618 Bacteria 1111
47 Ga0068863_100089455 3300005841 Bacteria 2919
48 Ga0068863_100423120 3300005841 Bacteria 1305
49 Ga0068863_100833689 3300005841 Unclassified 920
50 Ga0068863_101078646 3300005841 Bacteria 807
51 Ga0068858_100132257 3300005842 Bacteria 2340
52 Ga0068858_100237674 3300005842 Unclassified 1728
53 Ga0068858_101237172 3300005842 Bacteria 734
54 Ga0068860_100730341 3300005843 Bacteria 1001
55 Ga0097621_100187746 3300006237 Unclassified 1789
56 Ga0068871_100189804 3300006358 Unclassified 1769
57 Ga0068871_100803292 3300006358 Unclassified 867
58 Ga0068871_100903910 3300006358 Bacteria 818
59 Ga0068871_101119383 3300006358 Unclassified 737
60 Ga0068871_101453475 3300006358 Unclassified 647
61 Ga0075428_100328422 3300006844 Bacteria 1643
62 Ga0075431_100038834 3300006847 Bacteria 4904
63 Ga0075431_101284745 3300006847 Unclassified 693
64 Ga0075434_100411698 3300006871 Unclassified 1373
65 Ga0075429_100147705 3300006880 Unclassified 2058
66 Ga0075436_100127942 3300006914 Unclassified 1780
67 Ga0075436_100185810 3300006914 Bacteria 1470
68 Ga0097620_100156071 3300006931 Unclassified 2359
69 Ga0097620_100325404 3300006931 Bacteria 1631
70 Ga0075435_100261050 3300007076 Bacteria 1476
71 Ga0105240_10011804 3300009093 Bacteria 12135
72 Ga0105240_10014799 3300009093 Bacteria 10634
73 Ga0105240_10340491 3300009093 Bacteria 1704
74 Ga0105240_10999019 3300009093 Unclassified 895
75 Ga0111539_10069344 3300009094 Bacteria 4163
76 Ga0111539_10073017 3300009094 Bacteria 4045
77 Ga0111539_10131769 3300009094 Bacteria 2927
78 Ga0111539_10142691 3300009094 Unclassified 2803
79 Ga0105245_10338428 3300009098 Unclassified 1487
80 Ga0105242_10038497 3300009176 Unclassified 3846
81 Ga0105242_10786877 3300009176 Unclassified 940
82 Ga0105248_10191365 3300009177 Bacteria 2305
83 Ga0105248_10444565 3300009177 Bacteria 1461
84 Ga0105237_10003096 3300009545 Bacteria 20039
85 Ga0105238_10066439 3300009551 Bacteria 3608
86 Ga0099796_10350249 3300010159 Unclassified 636
87 Ga0157370_10145332 3300013104 Bacteria 2208
88 Ga0157370_10354529 3300013104 Unclassified 1352
89 Ga0157374_10057388 3300013296 Bacteria 3636
90 Ga0157378_10304624 3300013297 Bacteria 1543
91 Ga0157378_10924450 3300013297 Unclassified 904
92 Ga0163162_11322287 3300013306 Unclassified 819
93 Ga0157375_10000006 3300013308 Bacteria 384086
94 Ga0157375_10069506 3300013308 Bacteria 3528
95 Ga0163163_10000138 3300014325 Bacteria 75256
96 Ga0163163_10058472 3300014325 Bacteria 3812
97 Ga0163163_10794520 3300014325 Bacteria 1010
98 Ga0157376_10309529 3300014969 Unclassified 1498
99 Ga0157376_10334152 3300014969 Bacteria 1445
100 Ga0157376_11124329 3300014969 Unclassified 812
101 Ga0207705_10233602 3300025909 Bacteria 1399
102 Ga0207707_10033514 3300025912 Bacteria 4494
103 Ga0207707_10381117 3300025912 Bacteria 1212
104 Ga0207695_10051420 3300025913 Bacteria 4327
105 Ga0207695_10690134 3300025913 Unclassified 901
106 Ga0207671_10009276 3300025914 Bacteria 8239
107 Ga0207663_10297299 3300025916 Unclassified 1205
108 Ga0207657_10429542 3300025919 Unclassified 1038
109 Ga0207652_11080454 3300025921 Unclassified 703
110 Ga0207694_10012116 3300025924 Bacteria 6503
111 Ga0207694_10361546 3300025924 Unclassified 1203
112 Ga0207694_10569195 3300025924 Unclassified 952
113 Ga0207659_10305486 3300025926 Unclassified 1308
114 Ga0207700_10239589 3300025928 Unclassified 1545
115 Ga0207664_10078728 3300025929 Bacteria 2674
116 Ga0207706_10134661 3300025933 Unclassified 2173
117 Ga0207686_10037862 3300025934 Archaea 2914
118 Ga0207670_10067329 3300025936 Unclassified 2464
119 Ga0207670_10101181 3300025936 Bacteria 2059
120 Ga0207670_10312621 3300025936 Bacteria 1234
121 Ga0207670_10844279 3300025936 Bacteria 765
122 Ga0207711_10272735 3300025941 Bacteria 1557
123 Ga0207711_10279311 3300025941 Unclassified 1538
124 Ga0207661_10195647 3300025944 Bacteria 1775
125 Ga0207667_10048863 3300025949 Bacteria 4472
126 Ga0207667_10268953 3300025949 Unclassified 1742
127 Ga0207667_10439721 3300025949 Unclassified 1326
128 Ga0207667_10458630 3300025949 Unclassified 1295
129 Ga0207667_10687433 3300025949 Bacteria 1026
130 Ga0207667_10910780 3300025949 Unclassified 871
131 Ga0207712_10442719 3300025961 Bacteria 1100
132 Ga0207668_10456496 3300025972 Unclassified 1092
133 Ga0207703_10131905 3300026035 Bacteria 2159
134 Ga0207703_10650543 3300026035 Unclassified 1000
135 Ga0207708_10159619 3300026075 Bacteria 1780
136 Ga0207708_10329839 3300026075 Bacteria 1247
137 Ga0207702_10287379 3300026078 Bacteria 1557
138 Ga0207702_11113743 3300026078 Unclassified 783
139 Ga0207641_10364777 3300026088 Bacteria 1380
140 Ga0207641_10457668 3300026088 Bacteria 1234
141 Ga0207641_10516985 3300026088 Bacteria 1161
142 Ga0207648_10504785 3300026089 Unclassified 1107
143 Ga0207674_10017666 3300026116 Bacteria 7777
144 Ga0207674_10049705 3300026116 Bacteria 4287
145 Ga0207675_100259662 3300026118 Unclassified 1683
146 Ga0207428_10080355 3300027907 Unclassified 2547
147 Ga0207428_10526535 3300027907 Unclassified 856
148 Ga0268264_10701477 3300028381 Bacteria 1005
149 Ga0265338_10035585 3300028800 Bacteria 4783
150 Ga0265338_10036139 3300028800 Bacteria 4734
151 Ga0265338_10050871 3300028800 Bacteria 3739
152 Ga0265338_10109705 3300028800 Bacteria 2226
153 Ga0265338_10632812 3300028800 Bacteria 743
154 Ga0265338_10683948 3300028800 Unclassified 709
155 Ga0265324_10128539 3300029957 Bacteria 860
156 Ga0265329_10004018 3300031242 Bacteria 6263
157 Ga0265327_10020133 3300031251 Bacteria 4077
158 Ga0265316_10189946 3300031344 Unclassified 1526
159 Ga0307408_100022877 3300031548 Bacteria 4253
160 Ga0265314_10001177 3300031711 Bacteria 30027
161 Ga0265342_10280993 3300031712 Bacteria 881
162 Ga0307411_10062900 3300032005 Bacteria 2478
163 Ga0307411_11454414 3300032005 Bacteria 629
164 Ga0373944_0077418 3300035089 Unclassified 1093
165 Ga0373954_0100964 3300035118 Bacteria 1392
166 Ga0373946_0029996 3300035171 Bacteria 2169
167 Ga0373931_0163464 3300035691 Bacteria 1307
168 Ga0373935_0090408 3300035692 Bacteria 2003
169 Ga0373927_0057845 3300035695 Bacteria 2507
170 Ga0373947_0002964 3300035725 Bacteria 10127
171 Ga0373925_0001908 3300037068 Bacteria 17300
172 Ga0451577_0013700 3300042876 Bacteria 7579
173 Ga0451577_0144807 3300042876 Bacteria 2136
174 Ga0453683_0179178 3300044673 Bacteria 1344
175 Ga0453684_0016301 3300044712 Bacteria 11635
176 Ga0453684_0028852 3300044712 Bacteria 7899
177 Ga0451576_0086794 3300045051 Bacteria 3255
178 Ga0451576_0171948 3300045051 Bacteria 2261
179 Ga0451576_0319786 3300045051 Unclassified 1624
180 Ga0451576_0446140 3300045051 Bacteria 1358
181 Ga0451576_0555494 3300045051 Bacteria 1206
182 Ga0451576_0666491 3300045051 Unclassified 1093
183 Ga0451576_1014926 3300045051 Bacteria 869
184 Ga0451576_1054804 3300045051 Unclassified 851
185 Ga0451576_1303300 3300045051 Unclassified 757
186 Ga0495592_0000087 3300046454 Bacteria 81851
187 Ga0495592_0044472 3300046454 Bacteria 3318
188 Ga0495592_0217018 3300046454 Bacteria 1281
189 Ga0495651_0097241 3300046462 Bacteria 2199
190 Ga0495582_0096756 3300046473 Unclassified 1651
191 Ga0495662_0026711 3300046476 Bacteria 2788
192 Ga0495662_0039131 3300046476 Bacteria 2291
193 Ga0495664_0246379 3300046477 Unclassified 1081
194 Ga0495618_0009956 3300046514 Bacteria 5750
195 Ga0495618_0218391 3300046514 Bacteria 1203
196 Ga0495628_0000056 3300046516 Bacteria 89432
197 Ga0495628_0089069 3300046516 Bacteria 2391
198 Ga0495628_0110476 3300046516 Bacteria 2115
199 Ga0495628_0329794 3300046516 Unclassified 1125
200 Ga0495630_0000024 3300046517 Bacteria 155139
201 Ga0495630_0003631 3300046517 Bacteria 10756
202 Ga0495630_0786386 3300046517 Unclassified 727
203 Ga0495666_0006812 3300046526 Bacteria 5737
204 Ga0495640_0008846 3300046533 Bacteria 7871
205 Ga0495640_0016078 3300046533 Bacteria 5607
206 Ga0495586_0000006 3300046535 Bacteria 168866
207 Ga0495586_0005578 3300046535 Bacteria 6735
208 Ga0495587_0687197 3300046536 Bacteria 561
209 Ga0495645_0566109 3300046543 Unclassified 703
210 Ga0495657_0228131 3300046675 Unclassified 1127
211 Ga0495599_0089817 3300046678 Bacteria 1917
212 Ga0495599_0180761 3300046678 Bacteria 1300
213 Ga0495658_0046214 3300046683 Bacteria 2447
214 Ga0495669_0070586 3300046684 Bacteria 1591
215 Ga0495613_0085794 3300046689 Unclassified 2284
216 Ga0495613_0503125 3300046689 Unclassified 816
217 Ga0495624_0223889 3300046690 Bacteria 1140
218 Ga0495624_0316833 3300046690 Bacteria 939
219 Ga0495600_0659159 3300046809 Unclassified 632
220 Ga0495674_0001327 3300047319 Bacteria 24098
221 Ga0495674_0088903 3300047319 Bacteria 2641
222 Ga0495676_0011987 3300047321 Bacteria 7820
223 Ga0495683_0181742 3300047323 Bacteria 960
224 Ga0495684_0445433 3300047471 Bacteria 901
225 Ga0495684_0542290 3300047471 Unclassified 793
226 Ga0496109_0674646 3300048912 Unclassified 971
227 Ga0496114_0405457 3300048917 Unclassified 1207
228 Ga0496115_0009462 3300048918 Bacteria 7238
229 Ga0501297_013517 3300049520 Bacteria 959
230 Ga0501034_1000745 3300049571 Bacteria 720
231 Ga0501039_0108768 3300049575 Unclassified 2167
232 Ga0501044_0610957 3300049823 Unclassified 983
233 nmdc:mga09592_194543_c1 3300050508 Unclassified 1755
234 nmdc:mga09592_933323_c1 3300050508 Unclassified 728
235 nmdc:mga06r32_552067_c1 3300050510 Bacteria 1126
236 nmdc:mga08y16_101314_c1 3300050511 Unclassified 2998
237 nmdc:mga08y16_143382_c1 3300050511 Bacteria 2483
238 nmdc:mga08y16_62181_c1 3300050511 Bacteria 3898
239 nmdc:mga08y16_741362_c1 3300050511 Bacteria 979
240 nmdc:mga08y16_79423_c1 3300050511 Bacteria 3419
241 nmdc:mga08y16_79896_c2 3300050511 Bacteria 2091
242 nmdc:mga08y16_807004_c1 3300050511 Bacteria 931
243 nmdc:mga0n895_1045118_c1 3300050512 Bacteria 796
244 nmdc:mga0n895_600217_c1 3300050512 Unclassified 1103
245 nmdc:mga08x19_296862_c1 3300050514 Bacteria 1122
246 nmdc:mga08x19_716504_c1 3300050514 Unclassified 710
247 Ga0495601_0053754 3300053077 Bacteria 2546
248 Ga0495595_0119313 3300053084 Bacteria 1284

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045051 Ga0451576_0446140 Ga0451576_0446140_66_566 166
2 3300046536 Ga0495587_0687197 Ga0495587_0687197_36_542 168
3 3300025924 Ga0207694_10012116 Ga0207694_100121166 174
4 3300025949 Ga0207667_10268953 Ga0207667_102689532 174
5 3300048912 Ga0496109_0674646 Ga0496109_0674646_405_932 175
6 3300045051 Ga0451576_0319786 Ga0451576_0319786_857_1429 183
7 3300005468 Ga0070707_100757813 Ga0070707_1007578131 188
8 3300029957 Ga0265324_10128539 Ga0265324_101285391 188
9 3300032005 Ga0307411_11454414 Ga0307411_114544141 188
10 3300005335 Ga0070666_10082327 Ga0070666_100823272 190
11 3300005339 Ga0070660_100429152 Ga0070660_1004291521 190
12 3300005340 Ga0070689_100200406 Ga0070689_1002004062 190
13 3300005340 Ga0070689_100372920 Ga0070689_1003729202 190
14 3300005340 Ga0070689_100591744 Ga0070689_1005917442 190
15 3300005340 Ga0070689_101267213 Ga0070689_1012672131 190
16 3300005353 Ga0070669_100674425 Ga0070669_1006744251 190
17 3300005365 Ga0070688_100600777 Ga0070688_1006007772 190
18 3300005367 Ga0070667_100233630 Ga0070667_1002336302 190
19 3300005434 Ga0070709_10468133 Ga0070709_104681332 190
20 3300005435 Ga0070714_100029547 Ga0070714_1000295475 190
21 3300005436 Ga0070713_100399284 Ga0070713_1003992842 190
22 3300005438 Ga0070701_10000701 Ga0070701_100007018 190
23 3300005439 Ga0070711_100354518 Ga0070711_1003545182 190
24 3300005444 Ga0070694_100019085 Ga0070694_1000190856 190
25 3300005444 Ga0070694_100727647 Ga0070694_1007276471 190
26 3300005457 Ga0070662_100141630 Ga0070662_1001416303 190
27 3300005458 Ga0070681_10043866 Ga0070681_100438663 190
28 3300005458 Ga0070681_10981992 Ga0070681_109819921 190
29 3300005459 Ga0068867_100223878 Ga0068867_1002238782 190
30 3300005468 Ga0070707_100387062 Ga0070707_1003870621 190
31 3300005530 Ga0070679_100420396 Ga0070679_1004203962 190
32 3300005530 Ga0070679_100536378 Ga0070679_1005363782 190
33 3300005530 Ga0070679_100551586 Ga0070679_1005515861 190
34 3300005535 Ga0070684_100597411 Ga0070684_1005974111 190
35 3300005536 Ga0070697_100542614 Ga0070697_1005426142 190
36 3300005544 Ga0070686_100010624 Ga0070686_1000106242 190
37 3300005548 Ga0070665_100683549 Ga0070665_1006835492 190
38 3300005549 Ga0070704_100065315 Ga0070704_1000653153 190
39 3300005549 Ga0070704_100206422 Ga0070704_1002064222 190
40 3300005549 Ga0070704_100266169 Ga0070704_1002661692 190
41 3300005563 Ga0068855_100019401 Ga0068855_1000194016 190
42 3300005563 Ga0068855_100110612 Ga0068855_1001106123 190
43 3300005563 Ga0068855_101014350 Ga0068855_1010143502 190
44 3300005563 Ga0068855_101133573 Ga0068855_1011335731 190
45 3300005563 Ga0068855_101406397 Ga0068855_1014063971 190
46 3300005563 Ga0068855_101457606 Ga0068855_1014576062 190
47 3300005577 Ga0068857_100009468 Ga0068857_1000094684 190
48 3300005577 Ga0068857_100054229 Ga0068857_1000542294 190
49 3300005614 Ga0068856_100194258 Ga0068856_1001942581 190
50 3300005614 Ga0068856_100479163 Ga0068856_1004791632 190
51 3300005614 Ga0068856_100662665 Ga0068856_1006626652 190
52 3300005617 Ga0068859_100156071 Ga0068859_1001560712 190
53 3300005617 Ga0068859_100325378 Ga0068859_1003253782 190
54 3300005618 Ga0068864_100554473 Ga0068864_1005544732 190
55 3300005841 Ga0068863_100089455 Ga0068863_1000894552 190
56 3300005841 Ga0068863_100423120 Ga0068863_1004231202 190
57 3300005841 Ga0068863_100833689 Ga0068863_1008336892 190
58 3300005841 Ga0068863_101078646 Ga0068863_1010786462 190
59 3300005842 Ga0068858_100132257 Ga0068858_1001322572 190
60 3300005842 Ga0068858_100237674 Ga0068858_1002376742 190
61 3300005842 Ga0068858_101237172 Ga0068858_1012371721 190
62 3300005843 Ga0068860_100730341 Ga0068860_1007303412 190
63 3300006237 Ga0097621_100187746 Ga0097621_1001877462 190
64 3300006358 Ga0068871_100189804 Ga0068871_1001898041 190
65 3300006358 Ga0068871_100803292 Ga0068871_1008032921 190
66 3300006358 Ga0068871_100903910 Ga0068871_1009039101 190
67 3300006358 Ga0068871_101119383 Ga0068871_1011193831 190
68 3300006358 Ga0068871_101453475 Ga0068871_1014534751 190
69 3300006844 Ga0075428_100328422 Ga0075428_1003284221 190
70 3300006847 Ga0075431_100038834 Ga0075431_1000388342 190
71 3300006847 Ga0075431_101284745 Ga0075431_1012847451 190
72 3300006871 Ga0075434_100411698 Ga0075434_1004116982 190
73 3300006880 Ga0075429_100147705 Ga0075429_1001477053 190
74 3300006914 Ga0075436_100127942 Ga0075436_1001279422 190
75 3300006914 Ga0075436_100185810 Ga0075436_1001858101 190
76 3300006931 Ga0097620_100156071 Ga0097620_1001560712 190
77 3300006931 Ga0097620_100325404 Ga0097620_1003254042 190
78 3300007076 Ga0075435_100261050 Ga0075435_1002610502 190
79 3300009093 Ga0105240_10011804 Ga0105240_100118047 190
80 3300009093 Ga0105240_10014799 Ga0105240_100147995 190
81 3300009093 Ga0105240_10340491 Ga0105240_103404912 190
82 3300009093 Ga0105240_10999019 Ga0105240_109990192 190
83 3300009094 Ga0111539_10069344 Ga0111539_100693441 190
84 3300009094 Ga0111539_10073017 Ga0111539_100730173 190
85 3300009094 Ga0111539_10131769 Ga0111539_101317691 190
86 3300009094 Ga0111539_10142691 Ga0111539_101426912 190
87 3300009098 Ga0105245_10338428 Ga0105245_103384282 190
88 3300009176 Ga0105242_10038497 Ga0105242_100384972 190
89 3300009176 Ga0105242_10786877 Ga0105242_107868771 190
90 3300009177 Ga0105248_10191365 Ga0105248_101913652 190
91 3300009177 Ga0105248_10444565 Ga0105248_104445653 190
92 3300009545 Ga0105237_10003096 Ga0105237_100030963 190
93 3300009551 Ga0105238_10066439 Ga0105238_100664395 190
94 3300010159 Ga0099796_10350249 Ga0099796_103502491 190
95 3300013104 Ga0157370_10145332 Ga0157370_101453323 190
96 3300013104 Ga0157370_10354529 Ga0157370_103545292 190
97 3300013296 Ga0157374_10057388 Ga0157374_100573885 190
98 3300013297 Ga0157378_10304624 Ga0157378_103046242 190
99 3300013297 Ga0157378_10924450 Ga0157378_109244502 190
100 3300013306 Ga0163162_11322287 Ga0163162_113222871 190
101 3300013308 Ga0157375_10000006 Ga0157375_10000006288 190
102 3300013308 Ga0157375_10069506 Ga0157375_100695065 190
103 3300014325 Ga0163163_10000138 Ga0163163_1000013826 190
104 3300014325 Ga0163163_10058472 Ga0163163_100584725 190
105 3300014325 Ga0163163_10794520 Ga0163163_107945202 190
106 3300014969 Ga0157376_10309529 Ga0157376_103095293 190
107 3300014969 Ga0157376_10334152 Ga0157376_103341522 190
108 3300014969 Ga0157376_11124329 Ga0157376_111243292 190
109 3300025909 Ga0207705_10233602 Ga0207705_102336021 190
110 3300025912 Ga0207707_10033514 Ga0207707_100335145 190
111 3300025912 Ga0207707_10381117 Ga0207707_103811171 190
112 3300025913 Ga0207695_10051420 Ga0207695_100514202 190
113 3300025913 Ga0207695_10690134 Ga0207695_106901342 190
114 3300025914 Ga0207671_10009276 Ga0207671_100092762 190
115 3300025916 Ga0207663_10297299 Ga0207663_102972991 190
116 3300025919 Ga0207657_10429542 Ga0207657_104295421 190
117 3300025921 Ga0207652_11080454 Ga0207652_110804541 190
118 3300025924 Ga0207694_10361546 Ga0207694_103615461 190
119 3300025924 Ga0207694_10569195 Ga0207694_105691951 190
120 3300025926 Ga0207659_10305486 Ga0207659_103054861 190
121 3300025928 Ga0207700_10239589 Ga0207700_102395892 190
122 3300025929 Ga0207664_10078728 Ga0207664_100787284 190
123 3300025933 Ga0207706_10134661 Ga0207706_101346612 190
124 3300025934 Ga0207686_10037862 Ga0207686_100378622 190
125 3300025936 Ga0207670_10067329 Ga0207670_100673291 190
126 3300025936 Ga0207670_10101181 Ga0207670_101011812 190
127 3300025936 Ga0207670_10312621 Ga0207670_103126212 190
128 3300025936 Ga0207670_10844279 Ga0207670_108442791 190
129 3300025941 Ga0207711_10272735 Ga0207711_102727352 190
130 3300025941 Ga0207711_10279311 Ga0207711_102793112 190
131 3300025944 Ga0207661_10195647 Ga0207661_101956472 190
132 3300025949 Ga0207667_10048863 Ga0207667_100488632 190
133 3300025949 Ga0207667_10439721 Ga0207667_104397212 190
134 3300025949 Ga0207667_10458630 Ga0207667_104586302 190
135 3300025949 Ga0207667_10687433 Ga0207667_106874332 190
136 3300025949 Ga0207667_10910780 Ga0207667_109107802 190
137 3300025961 Ga0207712_10442719 Ga0207712_104427192 190
138 3300025972 Ga0207668_10456496 Ga0207668_104564962 190
139 3300026035 Ga0207703_10131905 Ga0207703_101319052 190
140 3300026035 Ga0207703_10650543 Ga0207703_106505432 190
141 3300026075 Ga0207708_10159619 Ga0207708_101596191 190
142 3300026075 Ga0207708_10329839 Ga0207708_103298392 190
143 3300026078 Ga0207702_10287379 Ga0207702_102873792 190
144 3300026078 Ga0207702_11113743 Ga0207702_111137431 190
145 3300026088 Ga0207641_10364777 Ga0207641_103647772 190
146 3300026088 Ga0207641_10457668 Ga0207641_104576682 190
147 3300026088 Ga0207641_10516985 Ga0207641_105169852 190
148 3300026089 Ga0207648_10504785 Ga0207648_105047852 190
149 3300026116 Ga0207674_10017666 Ga0207674_100176664 190
150 3300026116 Ga0207674_10049705 Ga0207674_100497054 190
151 3300026118 Ga0207675_100259662 Ga0207675_1002596622 190
152 3300027907 Ga0207428_10080355 Ga0207428_100803552 190
153 3300027907 Ga0207428_10526535 Ga0207428_105265351 190
154 3300028381 Ga0268264_10701477 Ga0268264_107014772 190
155 3300028800 Ga0265338_10035585 Ga0265338_100355853 190
156 3300028800 Ga0265338_10036139 Ga0265338_100361395 190
157 3300028800 Ga0265338_10050871 Ga0265338_100508713 190
158 3300028800 Ga0265338_10109705 Ga0265338_101097052 190
159 3300028800 Ga0265338_10632812 Ga0265338_106328121 190
160 3300028800 Ga0265338_10683948 Ga0265338_106839481 190
161 3300031242 Ga0265329_10004018 Ga0265329_100040184 190
162 3300031251 Ga0265327_10020133 Ga0265327_100201333 190
163 3300031344 Ga0265316_10189946 Ga0265316_101899462 190
164 3300031548 Ga0307408_100022877 Ga0307408_1000228774 190
165 3300031711 Ga0265314_10001177 Ga0265314_100011777 190
166 3300031712 Ga0265342_10280993 Ga0265342_102809931 190
167 3300032005 Ga0307411_10062900 Ga0307411_100629003 190
168 3300035089 Ga0373944_0077418 Ga0373944_0077418_21_593 190
169 3300035118 Ga0373954_0100964 Ga0373954_0100964_591_1163 190
170 3300035171 Ga0373946_0029996 Ga0373946_0029996_550_1122 190
171 3300035691 Ga0373931_0163464 Ga0373931_0163464_430_1002 190
172 3300035692 Ga0373935_0090408 Ga0373935_0090408_113_685 190
173 3300035695 Ga0373927_0057845 Ga0373927_0057845_169_741 190
174 3300035725 Ga0373947_0002964 Ga0373947_0002964_2470_3042 190
175 3300037068 Ga0373925_0001908 Ga0373925_0001908_7008_7580 190
176 3300042876 Ga0451577_0013700 Ga0451577_0013700_6453_7025 190
177 3300042876 Ga0451577_0144807 Ga0451577_0144807_297_869 190
178 3300044673 Ga0453683_0179178 Ga0453683_0179178_136_708 190
179 3300044712 Ga0453684_0016301 Ga0453684_0016301_6767_7339 190
180 3300044712 Ga0453684_0028852 Ga0453684_0028852_2330_2902 190
181 3300045051 Ga0451576_0086794 Ga0451576_0086794_929_1501 190
182 3300045051 Ga0451576_0171948 Ga0451576_0171948_1428_2000 190
183 3300045051 Ga0451576_0555494 Ga0451576_0555494_243_815 190
184 3300045051 Ga0451576_0666491 Ga0451576_0666491_304_876 190
185 3300045051 Ga0451576_1014926 Ga0451576_1014926_121_693 190
186 3300045051 Ga0451576_1054804 Ga0451576_1054804_117_689 190
187 3300045051 Ga0451576_1303300 Ga0451576_1303300_99_671 190
188 3300046454 Ga0495592_0000087 Ga0495592_0000087_80406_80978 190
189 3300046454 Ga0495592_0044472 Ga0495592_0044472_2679_3251 190
190 3300046454 Ga0495592_0217018 Ga0495592_0217018_190_762 190
191 3300046462 Ga0495651_0097241 Ga0495651_0097241_1075_1647 190
192 3300046473 Ga0495582_0096756 Ga0495582_0096756_35_607 190
193 3300046476 Ga0495662_0026711 Ga0495662_0026711_1742_2314 190
194 3300046476 Ga0495662_0039131 Ga0495662_0039131_870_1442 190
195 3300046477 Ga0495664_0246379 Ga0495664_0246379_104_676 190
196 3300046514 Ga0495618_0009956 Ga0495618_0009956_4337_4909 190
197 3300046514 Ga0495618_0218391 Ga0495618_0218391_564_1136 190
198 3300046516 Ga0495628_0000056 Ga0495628_0000056_6801_7373 190
199 3300046516 Ga0495628_0089069 Ga0495628_0089069_726_1298 190
200 3300046516 Ga0495628_0110476 Ga0495628_0110476_1453_2025 190
201 3300046516 Ga0495628_0329794 Ga0495628_0329794_497_1069 190
202 3300046517 Ga0495630_0000024 Ga0495630_0000024_147082_147654 190
203 3300046517 Ga0495630_0003631 Ga0495630_0003631_2588_3160 190
204 3300046517 Ga0495630_0786386 Ga0495630_0786386_70_642 190
205 3300046526 Ga0495666_0006812 Ga0495666_0006812_3509_4081 190
206 3300046533 Ga0495640_0008846 Ga0495640_0008846_1323_1895 190
207 3300046533 Ga0495640_0016078 Ga0495640_0016078_1338_1910 190
208 3300046535 Ga0495586_0000006 Ga0495586_0000006_7486_8058 190
209 3300046535 Ga0495586_0005578 Ga0495586_0005578_580_1152 190
210 3300046543 Ga0495645_0566109 Ga0495645_0566109_94_666 190
211 3300046675 Ga0495657_0228131 Ga0495657_0228131_506_1078 190
212 3300046678 Ga0495599_0089817 Ga0495599_0089817_578_1150 190
213 3300046678 Ga0495599_0180761 Ga0495599_0180761_595_1167 190
214 3300046683 Ga0495658_0046214 Ga0495658_0046214_1313_1885 190
215 3300046684 Ga0495669_0070586 Ga0495669_0070586_404_976 190
216 3300046689 Ga0495613_0085794 Ga0495613_0085794_951_1523 190
217 3300046689 Ga0495613_0503125 Ga0495613_0503125_76_678 190
218 3300046690 Ga0495624_0223889 Ga0495624_0223889_155_727 190
219 3300046690 Ga0495624_0316833 Ga0495624_0316833_114_686 190
220 3300046809 Ga0495600_0659159 Ga0495600_0659159_37_609 190
221 3300047319 Ga0495674_0001327 Ga0495674_0001327_18421_18993 190
222 3300047319 Ga0495674_0088903 Ga0495674_0088903_1599_2171 190
223 3300047321 Ga0495676_0011987 Ga0495676_0011987_4621_5193 190
224 3300047323 Ga0495683_0181742 Ga0495683_0181742_290_862 190
225 3300047471 Ga0495684_0445433 Ga0495684_0445433_293_865 190
226 3300047471 Ga0495684_0542290 Ga0495684_0542290_160_732 190
227 3300048917 Ga0496114_0405457 Ga0496114_0405457_331_903 190
228 3300048918 Ga0496115_0009462 Ga0496115_0009462_965_1537 190
229 3300049520 Ga0501297_013517 Ga0501297_013517_199_771 190
230 3300049571 Ga0501034_1000745 Ga0501034_1000745_42_614 190
231 3300049575 Ga0501039_0108768 Ga0501039_0108768_1582_2154 190
232 3300049823 Ga0501044_0610957 Ga0501044_0610957_146_718 190
233 3300050508 nmdc:mga09592_194543_c1 nmdc:mga09592_194543_c1_647_1219 190
234 3300050508 nmdc:mga09592_933323_c1 nmdc:mga09592_933323_c1_14_586 190
235 3300050510 nmdc:mga06r32_552067_c1 nmdc:mga06r32_552067_c1_69_641 190
236 3300050511 nmdc:mga08y16_101314_c1 nmdc:mga08y16_101314_c1_1805_2377 190
237 3300050511 nmdc:mga08y16_143382_c1 nmdc:mga08y16_143382_c1_240_812 190
238 3300050511 nmdc:mga08y16_62181_c1 nmdc:mga08y16_62181_c1_2925_3497 190
239 3300050511 nmdc:mga08y16_741362_c1 nmdc:mga08y16_741362_c1_90_662 190
240 3300050511 nmdc:mga08y16_79423_c1 nmdc:mga08y16_79423_c1_530_1102 190
241 3300050511 nmdc:mga08y16_79896_c2 nmdc:mga08y16_79896_c2_1357_2016 190
242 3300050511 nmdc:mga08y16_807004_c1 nmdc:mga08y16_807004_c1_333_905 190
243 3300050512 nmdc:mga0n895_1045118_c1 nmdc:mga0n895_1045118_c1_18_590 190
244 3300050512 nmdc:mga0n895_600217_c1 nmdc:mga0n895_600217_c1_94_666 190
245 3300050514 nmdc:mga08x19_296862_c1 nmdc:mga08x19_296862_c1_443_1015 190
246 3300050514 nmdc:mga08x19_716504_c1 nmdc:mga08x19_716504_c1_110_682 190
247 3300053077 Ga0495601_0053754 Ga0495601_0053754_162_734 190
248 3300053084 Ga0495595_0119313 Ga0495595_0119313_460_1032 190

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06175

MiaE

tRNA-(MS[2]IO[6]A)-hydroxylase (MiaE)

2

183

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
8fhc-assembly1.cif.gz_A protein 41 with aldehyde deformylating oxidase activity from gamma proteobacterium 0.95 4 189
8afj-assembly1.cif.gz_A trna modifying enzyme miae soaked in na-dithionite in a glovebox and flash-cooled using a miniature-airlock 0.9314 4 189
2itb-assembly1.cif.gz_B crystal structure of a putative trna-(ms(2)io(6)a)-hydroxylase (pp_2188) from pseudomonas putida kt2440 at 2.05 a resolution 0.93 4 190
8fhc-assembly1.cif.gz_A protein 41 with aldehyde deformylating oxidase activity from gamma proteobacterium 0.926 4 189
5ux1-assembly1.cif.gz_A protein 43 with aldehyde deformylating oxygenase activity from synechococcus 0.909 1 190
ID Description Score Start End Superfamily
5ux1A00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.909 1 190 1.20.1260.10
2itbB00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9069 4 190 1.20.1260.10
5ux1A00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9045 1 190 1.20.1260.10
5da5I00 Special;Helix non-globular;Helix Hairpins; 0.8929 97 167 6.10.140.1960
2itbB00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8659 4 190 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A2E4N8Q3-F1-model_v4 tRNA hydroxylase 0.9958 1 190 GO:0006400
GO:0045301
AF-A0A2V5XCM3-F1-model_v4 tRNA hydroxylase 0.9958 106 190 GO:0006400
GO:0045301
AF-A0A382V2X9-F1-model_v4 tRNA-(Ms[2]io[6]A)-hydroxylase 0.9956 1 155 GO:0006400
GO:0045301
AF-A0A382LKF8-F1-model_v4 tRNA-(Ms[2]io[6]A)-hydroxylase 0.995 2 190 GO:0006400
GO:0045301
AF-A0A4P5YKC6-F1-model_v4 tRNA-(Ms[2]io[6]A)-hydroxylase 0.9945 1 190 GO:0006400
GO:0045301

Feature Viewer

pLDDT pTM Quality
95.4 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map