F360133
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 248 | 103 | 496 | 86 |
Family's Representative Sequence
| Representative Sequence | 3300046453|Ga0495627_022769|Ga0495627_022769_81_359 |
| Length | 92 |
| Sequence | MVLGDPMKAKKSGFIPFANEADVLRVGNLEIQNRLDRITLAGDVDLTADKQGLELARQLHGLLGEVVAKLEGQELPDALPAPDVKTVDNPFS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 3 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 4 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 5 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 6 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 7 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 8 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 9 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 10 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 11 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 12 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 13 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 14 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 15 | 3300044669 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E | Metagenome | Unclassified |
| 16 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 17 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 18 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 19 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 20 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 21 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 22 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 23 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 24 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 25 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 26 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 27 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 28 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 29 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 30 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 31 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 32 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 33 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 34 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 35 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 36 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 37 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 38 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 39 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 40 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 41 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 42 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 43 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 44 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 45 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 46 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 47 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 48 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 49 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 50 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 51 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 52 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 53 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 54 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 55 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 56 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 57 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 58 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 59 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 60 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 61 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 62 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 63 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 64 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 65 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 66 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 67 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 68 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 69 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 70 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 71 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 72 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 73 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 74 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 75 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 76 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 77 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 78 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 79 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 80 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 81 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 82 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 83 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 84 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 86 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 94 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 95 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 98 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 99 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 100 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 101 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 102 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 103 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.98 |
| Metatranscriptomes | 0 |
| Isolates | 2.02 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.4 |
| Nodule | 0.81 |
| Rhizoplane | 0.81 |
| Rhizosphere | 95.16 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.82 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495627_022769 | 3300046453 | Bacteria | 2058 |
| 2 | JGI25154J39366_1001863 | 3300002738 | Bacteria | 6430 |
| 3 | Ga0079104_1014750 | 3300006946 | Bacteria | 2345 |
| 4 | Ga0182006_1000008 | 3300015261 | Bacteria | 449652 |
| 5 | Ga0182005_1000164 | 3300015265 | Bacteria | 45727 |
| 6 | Ga0213872_10000298 | 3300021361 | Bacteria | 42359 |
| 7 | Ga0209646_1000054 | 3300025246 | Bacteria | 279447 |
| 8 | Ga0209564_1000002 | 3300025295 | Bacteria | 1636803 |
| 9 | Ga0207655_1087780 | 3300025728 | Bacteria | 1102 |
| 10 | Ga0209281_1039202 | 3300027111 | Bacteria | 805 |
| 11 | Ga0316181_1210793 | 3300030744 | Bacteria | 3737 |
| 12 | Ga0265314_10021987 | 3300031711 | Bacteria | 4892 |
| 13 | Ga0436361_0067060 | 3300039447 | Bacteria | 222217 |
| 14 | Ga0436361_0215143 | 3300039447 | Bacteria | 6578 |
| 15 | Ga0436361_0866054 | 3300039447 | Bacteria | 74597 |
| 16 | Ga0450898_008909 | 3300042134 | Bacteria | 1596 |
| 17 | Ga0466981_0132256 | 3300044669 | Bacteria | 1734 |
| 18 | Ga0466982_0027318 | 3300044672 | Bacteria | 3343 |
| 19 | Ga0453684_0006785 | 3300044712 | Bacteria | 21538 |
| 20 | Ga0453684_0088075 | 3300044712 | Bacteria | 3845 |
| 21 | Ga0453684_0961653 | 3300044712 | Unclassified | 911 |
| 22 | Ga0453684_1120721 | 3300044712 | Unclassified | 830 |
| 23 | Ga0453684_1602478 | 3300044712 | Unclassified | 668 |
| 24 | Ga0466970_0180151 | 3300044765 | Bacteria | 1172 |
| 25 | Ga0451576_1264182 | 3300045051 | Archaea | 770 |
| 26 | Ga0495627_000001 | 3300046453 | Bacteria | 1104709 |
| 27 | Ga0495603_0030084 | 3300046455 | Bacteria | 3272 |
| 28 | Ga0495603_0079142 | 3300046455 | Bacteria | 1927 |
| 29 | Ga0495590_0001613 | 3300046457 | Bacteria | 9652 |
| 30 | Ga0495629_0095706 | 3300046459 | Bacteria | 2071 |
| 31 | Ga0495638_0000072 | 3300046460 | Bacteria | 164926 |
| 32 | Ga0495638_0035815 | 3300046460 | Bacteria | 3162 |
| 33 | Ga0495638_0233075 | 3300046460 | Bacteria | 1023 |
| 34 | Ga0495638_0601058 | 3300046460 | Bacteria | 540 |
| 35 | Ga0495653_0024250 | 3300046463 | Bacteria | 4891 |
| 36 | Ga0495653_0027356 | 3300046463 | Bacteria | 4563 |
| 37 | Ga0495653_0256046 | 3300046463 | Bacteria | 1159 |
| 38 | Ga0495650_0000061 | 3300046471 | Bacteria | 283347 |
| 39 | Ga0495650_0161395 | 3300046471 | Bacteria | 799 |
| 40 | Ga0495580_0020288 | 3300046472 | Bacteria | 4921 |
| 41 | Ga0495582_0011088 | 3300046473 | Bacteria | 4963 |
| 42 | Ga0495582_0306476 | 3300046473 | Bacteria | 913 |
| 43 | Ga0495605_0249104 | 3300046474 | Bacteria | 760 |
| 44 | Ga0495584_0000002 | 3300046491 | Bacteria | 512179 |
| 45 | Ga0495584_0000175 | 3300046491 | Bacteria | 45105 |
| 46 | Ga0495584_0002585 | 3300046491 | Bacteria | 10202 |
| 47 | Ga0495584_0032273 | 3300046491 | Bacteria | 2651 |
| 48 | Ga0495584_0158149 | 3300046491 | Bacteria | 1151 |
| 49 | Ga0495584_0190128 | 3300046491 | Bacteria | 1043 |
| 50 | Ga0495584_0444272 | 3300046491 | Bacteria | 659 |
| 51 | Ga0495584_0446865 | 3300046491 | Bacteria | 657 |
| 52 | Ga0495585_0000257 | 3300046492 | Bacteria | 54605 |
| 53 | Ga0495585_0000438 | 3300046492 | Bacteria | 39870 |
| 54 | Ga0495585_0003267 | 3300046492 | Bacteria | 11042 |
| 55 | Ga0495585_0005570 | 3300046492 | Bacteria | 7912 |
| 56 | Ga0495585_0041999 | 3300046492 | Bacteria | 2563 |
| 57 | Ga0495585_0049599 | 3300046492 | Bacteria | 2330 |
| 58 | Ga0495585_0075921 | 3300046492 | Bacteria | 1826 |
| 59 | Ga0495585_0080122 | 3300046492 | Bacteria | 1770 |
| 60 | Ga0495585_0144751 | 3300046492 | Bacteria | 1242 |
| 61 | Ga0495585_0439180 | 3300046492 | Bacteria | 625 |
| 62 | Ga0495585_0539941 | 3300046492 | Bacteria | 551 |
| 63 | Ga0495594_0006329 | 3300046499 | Bacteria | 6089 |
| 64 | Ga0495594_0006686 | 3300046499 | Bacteria | 5932 |
| 65 | Ga0495594_0055340 | 3300046499 | Bacteria | 2187 |
| 66 | Ga0495594_0197827 | 3300046499 | Bacteria | 1145 |
| 67 | Ga0495596_0000044 | 3300046500 | Bacteria | 90299 |
| 68 | Ga0495596_0040724 | 3300046500 | Bacteria | 1833 |
| 69 | Ga0495596_0196727 | 3300046500 | Bacteria | 783 |
| 70 | Ga0495607_0004526 | 3300046501 | Bacteria | 10205 |
| 71 | Ga0495607_0061478 | 3300046501 | Bacteria | 2134 |
| 72 | Ga0495607_0086333 | 3300046501 | Bacteria | 1711 |
| 73 | Ga0495607_0298959 | 3300046501 | Bacteria | 758 |
| 74 | Ga0495583_0000243 | 3300046506 | Bacteria | 89875 |
| 75 | Ga0495583_0024928 | 3300046506 | Bacteria | 2996 |
| 76 | Ga0495583_0042032 | 3300046506 | Bacteria | 2137 |
| 77 | Ga0495583_0312296 | 3300046506 | Unclassified | 623 |
| 78 | Ga0495583_0415994 | 3300046506 | Unclassified | 527 |
| 79 | Ga0495606_0000460 | 3300046507 | Bacteria | 66820 |
| 80 | Ga0495606_0000590 | 3300046507 | Bacteria | 57441 |
| 81 | Ga0495606_0005979 | 3300046507 | Bacteria | 11408 |
| 82 | Ga0495606_0197189 | 3300046507 | Bacteria | 1150 |
| 83 | Ga0495606_0233522 | 3300046507 | Bacteria | 1029 |
| 84 | Ga0495606_0409202 | 3300046507 | Unclassified | 704 |
| 85 | Ga0495610_0006813 | 3300046512 | Bacteria | 7751 |
| 86 | Ga0495610_0036545 | 3300046512 | Bacteria | 2508 |
| 87 | Ga0495616_0000448 | 3300046513 | Bacteria | 31436 |
| 88 | Ga0495616_0009465 | 3300046513 | Bacteria | 5697 |
| 89 | Ga0495616_0049756 | 3300046513 | Bacteria | 2099 |
| 90 | Ga0495616_0120184 | 3300046513 | Bacteria | 1214 |
| 91 | Ga0495616_0227524 | 3300046513 | Bacteria | 809 |
| 92 | Ga0495620_0172011 | 3300046515 | Bacteria | 839 |
| 93 | Ga0495630_0015859 | 3300046517 | Bacteria | 5506 |
| 94 | Ga0495631_0001307 | 3300046518 | Bacteria | 15264 |
| 95 | Ga0495631_0025269 | 3300046518 | Bacteria | 2737 |
| 96 | Ga0495631_0174980 | 3300046518 | Bacteria | 920 |
| 97 | Ga0495631_0407801 | 3300046518 | Unclassified | 579 |
| 98 | Ga0495632_0015686 | 3300046519 | Bacteria | 4236 |
| 99 | Ga0495643_0000135 | 3300046522 | Bacteria | 118587 |
| 100 | Ga0495643_0000521 | 3300046522 | Bacteria | 47921 |
| 101 | Ga0495643_0082467 | 3300046522 | Bacteria | 1670 |
| 102 | Ga0495643_0159741 | 3300046522 | Bacteria | 1109 |
| 103 | Ga0495643_0181577 | 3300046522 | Bacteria | 1022 |
| 104 | Ga0495644_0004287 | 3300046523 | Bacteria | 5604 |
| 105 | Ga0495644_0009395 | 3300046523 | Bacteria | 3771 |
| 106 | Ga0495644_0022026 | 3300046523 | Bacteria | 2429 |
| 107 | Ga0495644_0053120 | 3300046523 | Bacteria | 1522 |
| 108 | Ga0495644_0139541 | 3300046523 | Bacteria | 925 |
| 109 | Ga0495648_0010344 | 3300046524 | Bacteria | 7111 |
| 110 | Ga0495648_0066565 | 3300046524 | Bacteria | 2112 |
| 111 | Ga0495663_0002118 | 3300046525 | Bacteria | 6074 |
| 112 | Ga0495666_0004661 | 3300046526 | Bacteria | 6939 |
| 113 | Ga0495666_0037614 | 3300046526 | Bacteria | 2354 |
| 114 | Ga0495666_0073667 | 3300046526 | Bacteria | 1620 |
| 115 | Ga0495642_0001775 | 3300046528 | Bacteria | 9306 |
| 116 | Ga0495642_0003656 | 3300046528 | Bacteria | 6043 |
| 117 | Ga0495642_0133744 | 3300046528 | Bacteria | 1068 |
| 118 | Ga0495642_0155308 | 3300046528 | Bacteria | 991 |
| 119 | Ga0495652_0003096 | 3300046529 | Bacteria | 16621 |
| 120 | Ga0495654_0193612 | 3300046530 | Bacteria | 874 |
| 121 | Ga0495665_0001948 | 3300046531 | Bacteria | 11142 |
| 122 | Ga0495665_0020742 | 3300046531 | Bacteria | 3529 |
| 123 | Ga0495665_0023447 | 3300046531 | Bacteria | 3315 |
| 124 | Ga0495586_0009108 | 3300046535 | Bacteria | 5280 |
| 125 | Ga0495586_0027907 | 3300046535 | Bacteria | 3020 |
| 126 | Ga0495586_0050243 | 3300046535 | Bacteria | 2256 |
| 127 | Ga0495587_0026605 | 3300046536 | Bacteria | 3527 |
| 128 | Ga0495587_0042015 | 3300046536 | Bacteria | 2727 |
| 129 | Ga0495587_0044958 | 3300046536 | Bacteria | 2625 |
| 130 | Ga0495609_0000667 | 3300046538 | Bacteria | 26626 |
| 131 | Ga0495609_0014164 | 3300046538 | Bacteria | 3754 |
| 132 | Ga0495609_0015221 | 3300046538 | Bacteria | 3602 |
| 133 | Ga0495609_0035636 | 3300046538 | Bacteria | 2251 |
| 134 | Ga0495609_0229917 | 3300046538 | Bacteria | 768 |
| 135 | Ga0495597_0000156 | 3300046542 | Bacteria | 60520 |
| 136 | Ga0495597_0006412 | 3300046542 | Bacteria | 6089 |
| 137 | Ga0495622_0000010 | 3300046557 | Bacteria | 212375 |
| 138 | Ga0495622_0015750 | 3300046557 | Bacteria | 3516 |
| 139 | Ga0495622_0037888 | 3300046557 | Bacteria | 2245 |
| 140 | Ga0495622_0082670 | 3300046557 | Bacteria | 1477 |
| 141 | Ga0495633_0002808 | 3300046558 | Bacteria | 12041 |
| 142 | Ga0495633_0005313 | 3300046558 | Bacteria | 7911 |
| 143 | Ga0495633_0034626 | 3300046558 | Bacteria | 2427 |
| 144 | Ga0495633_0092024 | 3300046558 | Bacteria | 1409 |
| 145 | Ga0495633_0098051 | 3300046558 | Bacteria | 1361 |
| 146 | Ga0495633_0145510 | 3300046558 | Bacteria | 1095 |
| 147 | Ga0495633_0165507 | 3300046558 | Bacteria | 1020 |
| 148 | Ga0495633_0532360 | 3300046558 | Bacteria | 529 |
| 149 | Ga0495656_0005059 | 3300046615 | Bacteria | 4544 |
| 150 | Ga0495656_0077850 | 3300046615 | Bacteria | 1489 |
| 151 | Ga0495656_0081074 | 3300046615 | Bacteria | 1464 |
| 152 | Ga0495656_0169237 | 3300046615 | Bacteria | 1067 |
| 153 | Ga0495668_0000404 | 3300046616 | Bacteria | 56317 |
| 154 | Ga0495668_0047227 | 3300046616 | Bacteria | 2390 |
| 155 | Ga0495668_0065178 | 3300046616 | Bacteria | 2005 |
| 156 | Ga0495668_0240775 | 3300046616 | Bacteria | 990 |
| 157 | Ga0495668_0867019 | 3300046616 | Bacteria | 500 |
| 158 | Ga0495634_0028836 | 3300046642 | Bacteria | 3848 |
| 159 | Ga0495611_0002468 | 3300046648 | Bacteria | 8445 |
| 160 | Ga0495611_0039898 | 3300046648 | Bacteria | 2091 |
| 161 | Ga0495611_0042670 | 3300046648 | Bacteria | 2025 |
| 162 | Ga0495611_0045690 | 3300046648 | Bacteria | 1962 |
| 163 | Ga0495625_0031037 | 3300046660 | Bacteria | 3978 |
| 164 | Ga0495625_0034511 | 3300046660 | Bacteria | 3732 |
| 165 | Ga0495635_0220849 | 3300046663 | Bacteria | 1281 |
| 166 | Ga0495661_0015625 | 3300046665 | Bacteria | 5063 |
| 167 | Ga0495661_0047766 | 3300046665 | Bacteria | 2604 |
| 168 | Ga0495661_0053190 | 3300046665 | Bacteria | 2436 |
| 169 | Ga0495588_0017492 | 3300046674 | Bacteria | 3483 |
| 170 | Ga0495588_0041824 | 3300046674 | Bacteria | 2341 |
| 171 | Ga0495588_0084316 | 3300046674 | Bacteria | 1660 |
| 172 | Ga0495588_0401543 | 3300046674 | Bacteria | 719 |
| 173 | Ga0495599_0145177 | 3300046678 | Bacteria | 1471 |
| 174 | Ga0495623_0006301 | 3300046679 | Bacteria | 7714 |
| 175 | Ga0495623_0189724 | 3300046679 | Bacteria | 1188 |
| 176 | Ga0495646_0065673 | 3300046680 | Bacteria | 2148 |
| 177 | Ga0495669_0000812 | 3300046684 | Bacteria | 13318 |
| 178 | Ga0495669_0387778 | 3300046684 | Bacteria | 676 |
| 179 | Ga0495670_0000207 | 3300046691 | Bacteria | 26631 |
| 180 | Ga0495670_0003686 | 3300046691 | Bacteria | 7530 |
| 181 | Ga0495670_0006460 | 3300046691 | Bacteria | 5759 |
| 182 | Ga0495670_0026168 | 3300046691 | Bacteria | 2888 |
| 183 | Ga0495670_0028070 | 3300046691 | Bacteria | 2789 |
| 184 | Ga0495670_0051321 | 3300046691 | Bacteria | 2064 |
| 185 | Ga0495670_0067615 | 3300046691 | Bacteria | 1804 |
| 186 | Ga0495670_0661503 | 3300046691 | Bacteria | 569 |
| 187 | Ga0495671_0025063 | 3300046692 | Bacteria | 3103 |
| 188 | Ga0495649_0230063 | 3300046694 | Bacteria | 957 |
| 189 | Ga0495649_0400741 | 3300046694 | Bacteria | 689 |
| 190 | Ga0495589_0086300 | 3300046794 | Bacteria | 1524 |
| 191 | Ga0495589_0129750 | 3300046794 | Bacteria | 1211 |
| 192 | Ga0495589_0221227 | 3300046794 | Bacteria | 889 |
| 193 | Ga0495600_0070422 | 3300046809 | Bacteria | 2285 |
| 194 | Ga0495660_0000400 | 3300046810 | Bacteria | 37396 |
| 195 | Ga0495660_0012826 | 3300046810 | Bacteria | 4860 |
| 196 | Ga0495660_0014750 | 3300046810 | Bacteria | 4520 |
| 197 | Ga0495660_0058271 | 3300046810 | Bacteria | 2081 |
| 198 | Ga0495581_0019259 | 3300047315 | Bacteria | 3961 |
| 199 | Ga0495604_0007035 | 3300047317 | Bacteria | 8920 |
| 200 | Ga0495636_0078731 | 3300047318 | Bacteria | 1416 |
| 201 | Ga0495674_0016774 | 3300047319 | Bacteria | 6832 |
| 202 | Ga0495672_0000036 | 3300047320 | Bacteria | 279648 |
| 203 | Ga0495672_0248904 | 3300047320 | Bacteria | 863 |
| 204 | Ga0495676_0020271 | 3300047321 | Bacteria | 5838 |
| 205 | Ga0495676_0032481 | 3300047321 | Bacteria | 4405 |
| 206 | Ga0495676_0081771 | 3300047321 | Bacteria | 2447 |
| 207 | Ga0495676_0155167 | 3300047321 | Bacteria | 1625 |
| 208 | Ga0495676_0345872 | 3300047321 | Bacteria | 995 |
| 209 | Ga0495680_0012360 | 3300047322 | Bacteria | 7516 |
| 210 | Ga0495680_0067913 | 3300047322 | Bacteria | 2725 |
| 211 | Ga0495683_0000007 | 3300047323 | Bacteria | 268546 |
| 212 | Ga0495683_0056909 | 3300047323 | Bacteria | 1944 |
| 213 | Ga0495687_002609 | 3300047443 | Bacteria | 14166 |
| 214 | Ga0495687_005796 | 3300047443 | Bacteria | 7753 |
| 215 | Ga0495687_040291 | 3300047443 | Bacteria | 2059 |
| 216 | Ga0495675_0020828 | 3300047444 | Bacteria | 4173 |
| 217 | Ga0495675_0033238 | 3300047444 | Bacteria | 3292 |
| 218 | Ga0495675_0069229 | 3300047444 | Bacteria | 2228 |
| 219 | Ga0495677_0007751 | 3300047445 | Bacteria | 4001 |
| 220 | Ga0495677_0076730 | 3300047445 | Bacteria | 1249 |
| 221 | Ga0495673_0003823 | 3300047469 | Bacteria | 9723 |
| 222 | Ga0495681_0001349 | 3300047470 | Bacteria | 18551 |
| 223 | Ga0495681_0009894 | 3300047470 | Bacteria | 5825 |
| 224 | Ga0495681_0155201 | 3300047470 | Bacteria | 957 |
| 225 | Ga0495686_0157153 | 3300047472 | Bacteria | 1331 |
| 226 | Ga0495593_0001842 | 3300047673 | Bacteria | 12614 |
| 227 | Ga0495593_0234141 | 3300047673 | Bacteria | 921 |
| 228 | Ga0495602_0157737 | 3300048088 | Bacteria | 1775 |
| 229 | Ga0495614_0023250 | 3300048089 | Bacteria | 2674 |
| 230 | Ga0495626_0000018 | 3300048091 | Bacteria | 230153 |
| 231 | Ga0495626_0001918 | 3300048091 | Bacteria | 15464 |
| 232 | Ga0495626_0025774 | 3300048091 | Bacteria | 2872 |
| 233 | Ga0495626_0031895 | 3300048091 | Bacteria | 2533 |
| 234 | Ga0495626_0046426 | 3300048091 | Bacteria | 2023 |
| 235 | Ga0496115_0123072 | 3300048918 | Bacteria | 2135 |
| 236 | Ga0496115_0278578 | 3300048918 | Bacteria | 1373 |
| 237 | Ga0496116_0016777 | 3300048919 | Bacteria | 5715 |
| 238 | Ga0495678_000002 | 3300049459 | Bacteria | 999613 |
| 239 | Ga0495678_009496 | 3300049459 | Bacteria | 4809 |
| 240 | Ga0495678_144142 | 3300049459 | Bacteria | 776 |
| 241 | Ga0495682_0006025 | 3300049460 | Bacteria | 4949 |
| 242 | Ga0501249_036572 | 3300049679 | Bacteria | 1106 |
| 243 | Ga0501269_000230 | 3300049766 | Bacteria | 16425 |
| 244 | 2857555190 | 2857553236 | Bacteria | 6166726 |
| 245 | 2885080830 | 2885080285 | Bacteria | 6355622 |
| 246 | 2919477538 | 2919476304 | Bacteria | 5888696 |
| 247 | 2932412123 | 2932410948 | Bacteria | 6312192 |
| 248 | 2932418311 | 2932416698 | Bacteria | 6315112 |
| 249 | Ga0495627_022769 | |||
| 250 | JGI25154J39366_1001863 | |||
| 251 | Ga0079104_1014750 | |||
| 252 | Ga0182006_1000008 | |||
| 253 | Ga0182005_1000164 | |||
| 254 | Ga0213872_10000298 | |||
| 255 | Ga0209646_1000054 | |||
| 256 | Ga0209564_1000002 | |||
| 257 | Ga0207655_1087780 | |||
| 258 | Ga0209281_1039202 | |||
| 259 | Ga0316181_1210793 | |||
| 260 | Ga0265314_10021987 | |||
| 261 | Ga0436361_0067060 | |||
| 262 | Ga0436361_0215143 | |||
| 263 | Ga0436361_0866054 | |||
| 264 | Ga0450898_008909 | |||
| 265 | Ga0466981_0132256 | |||
| 266 | Ga0466982_0027318 | |||
| 267 | Ga0453684_0006785 | |||
| 268 | Ga0453684_0088075 | |||
| 269 | Ga0453684_0961653 | |||
| 270 | Ga0453684_1120721 | |||
| 271 | Ga0453684_1602478 | |||
| 272 | Ga0466970_0180151 | |||
| 273 | Ga0451576_1264182 | |||
| 274 | Ga0495627_000001 | |||
| 275 | Ga0495603_0030084 | |||
| 276 | Ga0495603_0079142 | |||
| 277 | Ga0495590_0001613 | |||
| 278 | Ga0495629_0095706 | |||
| 279 | Ga0495638_0000072 | |||
| 280 | Ga0495638_0035815 | |||
| 281 | Ga0495638_0233075 | |||
| 282 | Ga0495638_0601058 | |||
| 283 | Ga0495653_0024250 | |||
| 284 | Ga0495653_0027356 | |||
| 285 | Ga0495653_0256046 | |||
| 286 | Ga0495650_0000061 | |||
| 287 | Ga0495650_0161395 | |||
| 288 | Ga0495580_0020288 | |||
| 289 | Ga0495582_0011088 | |||
| 290 | Ga0495582_0306476 | |||
| 291 | Ga0495605_0249104 | |||
| 292 | Ga0495584_0000002 | |||
| 293 | Ga0495584_0000175 | |||
| 294 | Ga0495584_0002585 | |||
| 295 | Ga0495584_0032273 | |||
| 296 | Ga0495584_0158149 | |||
| 297 | Ga0495584_0190128 | |||
| 298 | Ga0495584_0444272 | |||
| 299 | Ga0495584_0446865 | |||
| 300 | Ga0495585_0000257 | |||
| 301 | Ga0495585_0000438 | |||
| 302 | Ga0495585_0003267 | |||
| 303 | Ga0495585_0005570 | |||
| 304 | Ga0495585_0041999 | |||
| 305 | Ga0495585_0049599 | |||
| 306 | Ga0495585_0075921 | |||
| 307 | Ga0495585_0080122 | |||
| 308 | Ga0495585_0144751 | |||
| 309 | Ga0495585_0439180 | |||
| 310 | Ga0495585_0539941 | |||
| 311 | Ga0495594_0006329 | |||
| 312 | Ga0495594_0006686 | |||
| 313 | Ga0495594_0055340 | |||
| 314 | Ga0495594_0197827 | |||
| 315 | Ga0495596_0000044 | |||
| 316 | Ga0495596_0040724 | |||
| 317 | Ga0495596_0196727 | |||
| 318 | Ga0495607_0004526 | |||
| 319 | Ga0495607_0061478 | |||
| 320 | Ga0495607_0086333 | |||
| 321 | Ga0495607_0298959 | |||
| 322 | Ga0495583_0000243 | |||
| 323 | Ga0495583_0024928 | |||
| 324 | Ga0495583_0042032 | |||
| 325 | Ga0495583_0312296 | |||
| 326 | Ga0495583_0415994 | |||
| 327 | Ga0495606_0000460 | |||
| 328 | Ga0495606_0000590 | |||
| 329 | Ga0495606_0005979 | |||
| 330 | Ga0495606_0197189 | |||
| 331 | Ga0495606_0233522 | |||
| 332 | Ga0495606_0409202 | |||
| 333 | Ga0495610_0006813 | |||
| 334 | Ga0495610_0036545 | |||
| 335 | Ga0495616_0000448 | |||
| 336 | Ga0495616_0009465 | |||
| 337 | Ga0495616_0049756 | |||
| 338 | Ga0495616_0120184 | |||
| 339 | Ga0495616_0227524 | |||
| 340 | Ga0495620_0172011 | |||
| 341 | Ga0495630_0015859 | |||
| 342 | Ga0495631_0001307 | |||
| 343 | Ga0495631_0025269 | |||
| 344 | Ga0495631_0174980 | |||
| 345 | Ga0495631_0407801 | |||
| 346 | Ga0495632_0015686 | |||
| 347 | Ga0495643_0000135 | |||
| 348 | Ga0495643_0000521 | |||
| 349 | Ga0495643_0082467 | |||
| 350 | Ga0495643_0159741 | |||
| 351 | Ga0495643_0181577 | |||
| 352 | Ga0495644_0004287 | |||
| 353 | Ga0495644_0009395 | |||
| 354 | Ga0495644_0022026 | |||
| 355 | Ga0495644_0053120 | |||
| 356 | Ga0495644_0139541 | |||
| 357 | Ga0495648_0010344 | |||
| 358 | Ga0495648_0066565 | |||
| 359 | Ga0495663_0002118 | |||
| 360 | Ga0495666_0004661 | |||
| 361 | Ga0495666_0037614 | |||
| 362 | Ga0495666_0073667 | |||
| 363 | Ga0495642_0001775 | |||
| 364 | Ga0495642_0003656 | |||
| 365 | Ga0495642_0133744 | |||
| 366 | Ga0495642_0155308 | |||
| 367 | Ga0495652_0003096 | |||
| 368 | Ga0495654_0193612 | |||
| 369 | Ga0495665_0001948 | |||
| 370 | Ga0495665_0020742 | |||
| 371 | Ga0495665_0023447 | |||
| 372 | Ga0495586_0009108 | |||
| 373 | Ga0495586_0027907 | |||
| 374 | Ga0495586_0050243 | |||
| 375 | Ga0495587_0026605 | |||
| 376 | Ga0495587_0042015 | |||
| 377 | Ga0495587_0044958 | |||
| 378 | Ga0495609_0000667 | |||
| 379 | Ga0495609_0014164 | |||
| 380 | Ga0495609_0015221 | |||
| 381 | Ga0495609_0035636 | |||
| 382 | Ga0495609_0229917 | |||
| 383 | Ga0495597_0000156 | |||
| 384 | Ga0495597_0006412 | |||
| 385 | Ga0495622_0000010 | |||
| 386 | Ga0495622_0015750 | |||
| 387 | Ga0495622_0037888 | |||
| 388 | Ga0495622_0082670 | |||
| 389 | Ga0495633_0002808 | |||
| 390 | Ga0495633_0005313 | |||
| 391 | Ga0495633_0034626 | |||
| 392 | Ga0495633_0092024 | |||
| 393 | Ga0495633_0098051 | |||
| 394 | Ga0495633_0145510 | |||
| 395 | Ga0495633_0165507 | |||
| 396 | Ga0495633_0532360 | |||
| 397 | Ga0495656_0005059 | |||
| 398 | Ga0495656_0077850 | |||
| 399 | Ga0495656_0081074 | |||
| 400 | Ga0495656_0169237 | |||
| 401 | Ga0495668_0000404 | |||
| 402 | Ga0495668_0047227 | |||
| 403 | Ga0495668_0065178 | |||
| 404 | Ga0495668_0240775 | |||
| 405 | Ga0495668_0867019 | |||
| 406 | Ga0495634_0028836 | |||
| 407 | Ga0495611_0002468 | |||
| 408 | Ga0495611_0039898 | |||
| 409 | Ga0495611_0042670 | |||
| 410 | Ga0495611_0045690 | |||
| 411 | Ga0495625_0031037 | |||
| 412 | Ga0495625_0034511 | |||
| 413 | Ga0495635_0220849 | |||
| 414 | Ga0495661_0015625 | |||
| 415 | Ga0495661_0047766 | |||
| 416 | Ga0495661_0053190 | |||
| 417 | Ga0495588_0017492 | |||
| 418 | Ga0495588_0041824 | |||
| 419 | Ga0495588_0084316 | |||
| 420 | Ga0495588_0401543 | |||
| 421 | Ga0495599_0145177 | |||
| 422 | Ga0495623_0006301 | |||
| 423 | Ga0495623_0189724 | |||
| 424 | Ga0495646_0065673 | |||
| 425 | Ga0495669_0000812 | |||
| 426 | Ga0495669_0387778 | |||
| 427 | Ga0495670_0000207 | |||
| 428 | Ga0495670_0003686 | |||
| 429 | Ga0495670_0006460 | |||
| 430 | Ga0495670_0026168 | |||
| 431 | Ga0495670_0028070 | |||
| 432 | Ga0495670_0051321 | |||
| 433 | Ga0495670_0067615 | |||
| 434 | Ga0495670_0661503 | |||
| 435 | Ga0495671_0025063 | |||
| 436 | Ga0495649_0230063 | |||
| 437 | Ga0495649_0400741 | |||
| 438 | Ga0495589_0086300 | |||
| 439 | Ga0495589_0129750 | |||
| 440 | Ga0495589_0221227 | |||
| 441 | Ga0495600_0070422 | |||
| 442 | Ga0495660_0000400 | |||
| 443 | Ga0495660_0012826 | |||
| 444 | Ga0495660_0014750 | |||
| 445 | Ga0495660_0058271 | |||
| 446 | Ga0495581_0019259 | |||
| 447 | Ga0495604_0007035 | |||
| 448 | Ga0495636_0078731 | |||
| 449 | Ga0495674_0016774 | |||
| 450 | Ga0495672_0000036 | |||
| 451 | Ga0495672_0248904 | |||
| 452 | Ga0495676_0020271 | |||
| 453 | Ga0495676_0032481 | |||
| 454 | Ga0495676_0081771 | |||
| 455 | Ga0495676_0155167 | |||
| 456 | Ga0495676_0345872 | |||
| 457 | Ga0495680_0012360 | |||
| 458 | Ga0495680_0067913 | |||
| 459 | Ga0495683_0000007 | |||
| 460 | Ga0495683_0056909 | |||
| 461 | Ga0495687_002609 | |||
| 462 | Ga0495687_005796 | |||
| 463 | Ga0495687_040291 | |||
| 464 | Ga0495675_0020828 | |||
| 465 | Ga0495675_0033238 | |||
| 466 | Ga0495675_0069229 | |||
| 467 | Ga0495677_0007751 | |||
| 468 | Ga0495677_0076730 | |||
| 469 | Ga0495673_0003823 | |||
| 470 | Ga0495681_0001349 | |||
| 471 | Ga0495681_0009894 | |||
| 472 | Ga0495681_0155201 | |||
| 473 | Ga0495686_0157153 | |||
| 474 | Ga0495593_0001842 | |||
| 475 | Ga0495593_0234141 | |||
| 476 | Ga0495602_0157737 | |||
| 477 | Ga0495614_0023250 | |||
| 478 | Ga0495626_0000018 | |||
| 479 | Ga0495626_0001918 | |||
| 480 | Ga0495626_0025774 | |||
| 481 | Ga0495626_0031895 | |||
| 482 | Ga0495626_0046426 | |||
| 483 | Ga0496115_0123072 | |||
| 484 | Ga0496115_0278578 | |||
| 485 | Ga0496116_0016777 | |||
| 486 | Ga0495678_000002 | |||
| 487 | Ga0495678_009496 | |||
| 488 | Ga0495678_144142 | |||
| 489 | Ga0495682_0006025 | |||
| 490 | Ga0501249_036572 | |||
| 491 | Ga0501269_000230 | |||
| 492 | 2857555190 | |||
| 493 | 2885080830 | |||
| 494 | 2919477538 | |||
| 495 | 2932412123 | |||
| 496 | 2932418311 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4uzr-assembly1.cif.gz_B | crystal structure of pyrococcus horikoshii ph1500 | 0.7256 | 9 | 33 |
| 5nb8-assembly2.cif.gz_B | structure of vwc domain from ccn3 | 0.5651 | 10 | 39 |
| 3bk3-assembly1.cif.gz_C | crystal structure of the complex of bmp-2 and the first von willebrand domain type c of crossveinless-2 | 0.4836 | 1 | 40 |
| 6sjl-assembly1.cif.gz_C | structure of the tle1 effector bound to the vgrg spike from the type 6 secretion system | 0.4821 | 2 | 38 |
| 4djz-assembly1.cif.gz_H | catalytic fragment of masp-1 in complex with its specific inhibitor developed by directed evolution on sgci scaffold | 0.4755 | 9 | 35 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G041_6_109_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.6461 | 11 | 31 | 3.50.50.60 |
| af_A5WUN5_50_310_1.10.555.10 | Mainly Alpha;Orthogonal Bundle;Phosphatidylinositol 3-kinase; Chain A;Rho GTPase activation protein | 0.6173 | 10 | 43 | 1.10.555.10 |
| af_Q54DE4_367_529_2.40.128.630 | Mainly Beta;Beta Barrel;Lipocalin; | 0.617 | 2 | 31 | 2.40.128.630 |
| af_Q55BZ5_169_338_3.60.60.10 | Alpha Beta;4-Layer Sandwich;Penicillin V Acylase; Chain A;Penicillin V Acylase; Chain A | 0.5765 | 19 | 33 | 3.60.60.10 |
| af_Q6AU68_18_165_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.5227 | 13 | 51 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A378R6U4-F1-model_v4 | Uncharacterized protein | 0.9647 | 4 | 64 |
|
| AF-A0A840MND4-F1-model_v4 | Ribosomal protein L19 | 0.9397 | 1 | 70 |
GO:0005840
|
| AF-A0A259CK72-F1-model_v4 | Uncharacterized protein | 0.9283 | 1 | 70 |
|
| AF-A0A1E7WP32-F1-model_v4 | Uncharacterized protein | 0.9279 | 3 | 82 |
|
| AF-A0A0Q4P0M3-F1-model_v4 | deleted | 0.9276 | 3 | 82 |
|