F360176

General Info

Members Datasets Scaffolds Average Seq Length
248 190 496 310

Family's Representative Sequence

Representative Sequence 3300046660|Ga0495625_0030768|Ga0495625_0030768_1471_2532
Length 344
Sequence LSRAGEVADPAIRRSGKALRMKAFIVDRYQKKGALRFGDMPEPIFGQDDVLVEIHAAGLNPLDSKIRDGAFKALIPYRPPFILGHDLAGIVVRVGANVGHFKPGDEVYARPRDGRIGTFAEHIAIDQADVALKPRTISMVEAASIPLAGLTAWQALVEQAGLKEGQKVLIHAGSGGVGTIAIQLAKHLGATVATTTSTANDIVIDYRKQDFQKLLSGYDVVLNSLDGATLRKSLDVLKPGGRLISISGPPDADFARDQGLNWLLRQVMRLLSFRIRRKAAALGVRYSFLFMRANGSQLGEITALVEKGFIRPVVDRIFPFDATNEALAYVETGRVKGKVVVNLR

Samples

Sample ID Description Type Environment
1 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
7 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
8 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
9 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
10 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
36 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
37 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
55 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
56 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
84 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
85 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
86 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
87 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
88 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
89 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
90 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
91 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
92 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
93 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
94 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
95 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
96 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
97 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
98 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
99 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
100 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
101 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
102 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
103 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
104 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
105 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
106 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
107 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
108 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
109 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
110 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
111 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
112 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
113 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
114 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
115 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
116 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
117 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
118 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
119 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
120 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
121 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
122 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
123 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
124 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
125 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
126 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
127 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
128 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
129 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
130 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
131 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
132 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
133 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
134 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
135 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
136 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
137 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
138 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
139 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
140 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
141 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
142 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
143 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
144 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
145 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
155 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
156 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
157 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
160 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
161 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
162 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
163 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
164 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
165 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
166 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
167 2643221714 Streptomyces sp. Root264 Isolate Unclassified
168 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
169 2738541358 Bacillus sp. OV752 Isolate Unclassified
170 2738543006 Bacillus sp. OK077 Isolate Unclassified
171 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
172 2837183177 Egibacter rhizosphaerae EGI 80759 Isolate Unclassified
173 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
174 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
175 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
176 2891562705 Microbispora tritici MT50 Isolate Unclassified
177 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
178 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
179 2965761152 Bacillus sp. COPE52 Isolate Unclassified
180 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
181 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
182 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
183 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
184 8023444577 Bacillus sp. BH32 Isolate Unclassified
185 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
186 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
187 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
188 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
189 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
190 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.11
Metatranscriptomes 0
Isolates 10.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.1
Nodule 0
Rhizoplane 5.65
Rhizosphere 65.32
Stem 0
Stem Tuber 0
Unclassified 2.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495625_0030768 3300046660 Bacteria 4000
2 JGI25159J45721_1000926 3300002987 Bacteria 12771
3 JGI25159J45721_1015858 3300002987 Bacteria 1632
4 JGI25151J46595_10006416 3300003187 Bacteria 5914
5 JGI25151J46595_10009302 3300003187 Bacteria 4660
6 JGI25151J46595_10010754 3300003187 Bacteria 4235
7 JGI25151J46595_10055982 3300003187 Bacteria 1296
8 rootL2_10069414 3300003322 Bacteria 7788
9 rootH1_10239843 3300003323 Bacteria 3094
10 Ga0055525_1000030 3300003759 Bacteria 318094
11 Ga0055527_1000033 3300003760 Bacteria 140664
12 Ga0055535_1001782 3300003761 Bacteria 9466
13 Ga0055542_1000075 3300003762 Bacteria 140936
14 Ga0055529_1001244 3300003763 Bacteria 9468
15 Ga0065715_10188005 3300005293 Bacteria 1419
16 Ga0070676_10174567 3300005328 Bacteria 1393
17 Ga0070689_100082992 3300005340 Bacteria 2518
18 Ga0070687_100112311 3300005343 Bacteria 1544
19 Ga0070668_100000404 3300005347 Bacteria 28624
20 Ga0070668_100182417 3300005347 Bacteria 1715
21 Ga0070669_100005283 3300005353 Bacteria 9325
22 Ga0070671_100030410 3300005355 Bacteria 4456
23 Ga0070667_100000022 3300005367 Bacteria 204861
24 Ga0070681_10496556 3300005458 Bacteria 1133
25 Ga0070699_100354901 3300005518 Bacteria 1321
26 Ga0070679_100057788 3300005530 Bacteria 3866
27 Ga0068853_100238971 3300005539 Bacteria 1664
28 Ga0070665_100002997 3300005548 Bacteria 18231
29 Ga0070665_100019097 3300005548 Bacteria 6877
30 Ga0068855_100156319 3300005563 Bacteria 2590
31 Ga0068855_100376472 3300005563 Bacteria 1559
32 Ga0068854_100000935 3300005578 Bacteria 17548
33 Ga0068859_100002659 3300005617 Bacteria 18141
34 Ga0068863_100000141 3300005841 Bacteria 75574
35 Ga0068863_100001550 3300005841 Bacteria 22696
36 Ga0068860_100000038 3300005843 Bacteria 232936
37 Ga0068860_100007882 3300005843 Bacteria 10634
38 Ga0068862_100000064 3300005844 Bacteria 124473
39 Ga0081538_10007232 3300005981 Bacteria 9632
40 Ga0081539_10000988 3300005985 Bacteria 52904
41 Ga0070717_10387145 3300006028 Bacteria 1254
42 Ga0075430_100027322 3300006846 Bacteria 4849
43 Ga0097620_100002659 3300006931 Bacteria 18141
44 Ga0105251_10053182 3300009011 Bacteria 1926
45 Ga0105244_10014792 3300009036 Bacteria 4497
46 Ga0105244_10103622 3300009036 Bacteria 1390
47 Ga0105250_10002454 3300009092 Bacteria 9309
48 Ga0105240_10000001 3300009093 Bacteria 2887840
49 Ga0105247_10000021 3300009101 Bacteria 229443
50 Ga0114129_10120311 3300009147 Bacteria 3616
51 Ga0114129_10182489 3300009147 Bacteria 2855
52 Ga0105241_10008773 3300009174 Bacteria 7429
53 Ga0105248_10000141 3300009177 Bacteria 82929
54 Ga0105238_10167046 3300009551 Bacteria 2176
55 Ga0105249_10000060 3300009553 Bacteria 153462
56 Ga0105029_101189 3300009984 Bacteria 1576
57 Ga0157369_10000343 3300013105 Bacteria 61648
58 Ga0157369_10108005 3300013105 Bacteria 2960
59 Ga0157369_10216735 3300013105 Bacteria 2005
60 Ga0157375_10551779 3300013308 Bacteria 1314
61 Ga0157379_10009617 3300014968 Bacteria 8418
62 Ga0209672_100004 3300025228 Bacteria 1467504
63 Ga0209563_100028 3300025230 Bacteria 509539
64 Ga0209258_100003 3300025242 Bacteria 1467504
65 Ga0209148_1000016 3300025254 Bacteria 804369
66 Ga0209455_1000004 3300025272 Bacteria 1467504
67 Ga0209130_1000213 3300025284 Bacteria 76301
68 Ga0209130_1000875 3300025284 Bacteria 24644
69 Ga0209025_1000143 3300025294 Bacteria 181917
70 Ga0209025_1002120 3300025294 Bacteria 22339
71 Ga0209025_1005388 3300025294 Bacteria 10469
72 Ga0209025_1005783 3300025294 Bacteria 9919
73 Ga0209025_1007234 3300025294 Bacteria 8351
74 Ga0209025_1014375 3300025294 Bacteria 4872
75 Ga0209025_1027970 3300025294 Bacteria 2777
76 Ga0209025_1037668 3300025294 Bacteria 2141
77 Ga0207696_1002454 3300025711 Bacteria 9072
78 Ga0207696_1033164 3300025711 Bacteria 1549
79 Ga0207655_1009559 3300025728 Bacteria 6006
80 Ga0207655_1085163 3300025728 Bacteria 1128
81 Ga0207692_10171333 3300025898 Bacteria 1258
82 Ga0207710_10000027 3300025900 Bacteria 307001
83 Ga0207647_10000849 3300025904 Bacteria 23718
84 Ga0207699_10027730 3300025906 Bacteria 3140
85 Ga0207643_10055201 3300025908 Bacteria 2259
86 Ga0207707_10052787 3300025912 Bacteria 3538
87 Ga0207695_10000001 3300025913 Bacteria 2888630
88 Ga0207695_10013047 3300025913 Bacteria 9925
89 Ga0207671_10000654 3300025914 Bacteria 45328
90 Ga0207681_10196178 3300025923 Bacteria 1548
91 Ga0207664_10199050 3300025929 Bacteria 1728
92 Ga0207644_10032305 3300025931 Bacteria 3651
93 Ga0207690_10084797 3300025932 Bacteria 2222
94 Ga0207711_10000311 3300025941 Bacteria 52029
95 Ga0207689_10203402 3300025942 Bacteria 1635
96 Ga0207651_10106154 3300025960 Bacteria 2097
97 Ga0207712_10000051 3300025961 Bacteria 153466
98 Ga0207668_10037924 3300025972 Bacteria 3230
99 Ga0207668_10059112 3300025972 Bacteria 2684
100 Ga0207658_10000716 3300025986 Bacteria 28697
101 Ga0207703_10099801 3300026035 Bacteria 2458
102 Ga0207678_10188317 3300026067 Bacteria 1763
103 Ga0207641_10000162 3300026088 Bacteria 94111
104 Ga0207641_10005300 3300026088 Bacteria 11017
105 Ga0207675_100006487 3300026118 Bacteria 11069
106 Ga0268266_10011762 3300028379 Bacteria 7591
107 Ga0268266_10019236 3300028379 Bacteria 5816
108 Ga0268266_10368624 3300028379 Unclassified 1352
109 Ga0268265_10000028 3300028380 Bacteria 236467
110 Ga0268264_10000092 3300028381 Bacteria 232950
111 Ga0268264_10085679 3300028381 Bacteria 2705
112 Ga0265324_10018772 3300029957 Unclassified 2495
113 Ga0307512_10077267 3300030522 Bacteria 2421
114 Ga0307513_10000002 3300031456 Bacteria 842612
115 Ga0307509_10185911 3300031507 Bacteria 1936
116 Ga0307508_10033541 3300031616 Bacteria 4634
117 Ga0307508_10093660 3300031616 Bacteria 2594
118 Ga0307416_100347489 3300032002 Bacteria 1499
119 Ga0307411_10029270 3300032005 Bacteria 3360
120 Ga0307415_100000994 3300032126 Bacteria 13080
121 Ga0373953_0007349 3300035117 Bacteria 3685
122 Ga0373956_0057945 3300035119 Bacteria 1751
123 Ga0373946_0000148 3300035171 Bacteria 21418
124 Ga0373937_0166515 3300036401 Bacteria 2067
125 Ga0237819_00107 3300038705 Bacteria 30668
126 Ga0237819_01242 3300038705 Bacteria 7045
127 Ga0439460_0009005 3300042461 Bacteria 2526
128 Ga0466969_0002255 3300044656 Bacteria 10305
129 Ga0466969_0008754 3300044656 Bacteria 5364
130 Ga0466969_0103245 3300044656 Bacteria 1340
131 Ga0466969_0148643 3300044656 Bacteria 1080
132 Ga0466972_0096864 3300044658 Bacteria 1397
133 Ga0453683_0000287 3300044673 Bacteria 65266
134 Ga0466965_0020729 3300044683 Bacteria 3162
135 Ga0466966_0099348 3300044684 Bacteria 1801
136 Ga0466966_0122503 3300044684 Bacteria 1596
137 Ga0466961_0034628 3300044693 Bacteria 3242
138 Ga0466961_0056214 3300044693 Bacteria 2507
139 Ga0466963_0011350 3300044694 Bacteria 5422
140 Ga0453684_0173542 3300044712 Bacteria 2538
141 Ga0466970_0097638 3300044765 Bacteria 1598
142 Ga0466970_0141787 3300044765 Bacteria 1324
143 Ga0466957_0176336 3300044842 Bacteria 1394
144 Ga0466960_0001649 3300044901 Bacteria 8175
145 Ga0466960_0082041 3300044901 Unclassified 1627
146 Ga0466959_0001411 3300045049 Bacteria 14688
147 Ga0466959_0141582 3300045049 Bacteria 1699
148 Ga0466959_0159017 3300045049 Bacteria 1589
149 Ga0451576_0775572 3300045051 Unclassified 1007
150 Ga0466958_0127870 3300045836 Bacteria 1594
151 Ga0466967_0124524 3300045976 Bacteria 2386
152 Ga0466967_0230985 3300045976 Bacteria 1761
153 Ga0495592_0158768 3300046454 Bacteria 1558
154 Ga0495651_0060520 3300046462 Bacteria 2900
155 Ga0495653_0053900 3300046463 Bacteria 3075
156 Ga0495583_0006119 3300046506 Bacteria 7939
157 Ga0495630_0276942 3300046517 Bacteria 1282
158 Ga0495667_0049729 3300046559 Bacteria 2767
159 Ga0495668_0007010 3300046616 Bacteria 7277
160 Ga0495657_0121420 3300046675 Bacteria 1645
161 Ga0495623_0164402 3300046679 Bacteria 1302
162 Ga0495604_0004272 3300047317 Bacteria 11314
163 Ga0495680_0011038 3300047322 Bacteria 8025
164 Ga0495677_0013976 3300047445 Bacteria 2923
165 Ga0495684_0003425 3300047471 Bacteria 12434
166 Ga0496100_0011859 3300048903 Bacteria 4975
167 Ga0496101_0001183 3300048904 Bacteria 15603
168 Ga0496102_0000363 3300048905 Bacteria 54674
169 Ga0496102_0000458 3300048905 Bacteria 45701
170 Ga0496102_0335517 3300048905 Bacteria 1424
171 Ga0496103_0000196 3300048906 Bacteria 60369
172 Ga0496103_0000466 3300048906 Bacteria 34185
173 Ga0496104_0530040 3300048907 Bacteria 1089
174 Ga0496106_0015855 3300048909 Bacteria 5573
175 Ga0496107_0344763 3300048910 Bacteria 1108
176 Ga0496108_0171524 3300048911 Bacteria 1877
177 Ga0496109_0439675 3300048912 Bacteria 1232
178 Ga0496114_0177960 3300048917 Bacteria 1856
179 Ga0496116_0000269 3300048919 Bacteria 90518
180 Ga0496116_0027360 3300048919 Bacteria 4153
181 Ga0496117_0000568 3300048920 Bacteria 60692
182 Ga0496117_0010358 3300048920 Bacteria 8515
183 Ga0496118_0000136 3300048921 Bacteria 130016
184 Ga0496118_0004365 3300048921 Bacteria 16817
185 Ga0496119_0004758 3300048922 Bacteria 13337
186 Ga0496119_0172414 3300048922 Unclassified 1141
187 Ga0496120_0092723 3300048923 Bacteria 1610
188 Ga0496121_0003515 3300048924 Bacteria 22263
189 Ga0496121_0005922 3300048924 Bacteria 15464
190 Ga0496122_0002464 3300048925 Bacteria 26185
191 Ga0496124_0140494 3300048927 Bacteria 1906
192 Ga0496125_0010158 3300048928 Bacteria 9540
193 Ga0496125_0021201 3300048928 Bacteria 6069
194 Ga0496126_0000799 3300048929 Bacteria 56430
195 Ga0496126_0009328 3300048929 Bacteria 10442
196 Ga0501032_0006076 3300049569 Bacteria 8897
197 Ga0501032_0271669 3300049569 Bacteria 1098
198 Ga0501033_0025229 3300049570 Bacteria 4478
199 Ga0501033_0116068 3300049570 Bacteria 1945
200 Ga0501034_0046338 3300049571 Bacteria 4393
201 Ga0501034_0091127 3300049571 Bacteria 3046
202 Ga0501036_0074541 3300049572 Bacteria 2870
203 Ga0501037_0094523 3300049573 Bacteria 2161
204 Ga0501037_0241578 3300049573 Bacteria 1266
205 Ga0501038_0071800 3300049574 Bacteria 2935
206 Ga0501039_0056211 3300049575 Bacteria 3048
207 Ga0501043_0034023 3300049579 Bacteria 4008
208 Ga0501047_0057783 3300049581 Bacteria 3750
209 Ga0501047_0308433 3300049581 Bacteria 1424
210 Ga0501070_0195280 3300049586 Bacteria 1662
211 Ga0501080_0575310 3300049742 Bacteria 1002
212 Ga0501083_0044143 3300049744 Bacteria 3018
213 Ga0501035_0036421 3300049822 Bacteria 4458
214 Ga0501044_0019406 3300049823 Bacteria 7274
215 Ga0501044_0063122 3300049823 Bacteria 3785
216 Ga0501045_0080935 3300049824 Bacteria 2395
217 nmdc:mga08y16_593078_c1 3300050511 Bacteria 1117
218 Ga0500566_0004805 3300053094 Bacteria 8050
219 Ga0500568_0000054 3300053139 Bacteria 111105
220 Ga0500585_107131 3300053144 Bacteria 1004
221 Ga0500603_000867 3300053150 Bacteria 7205
222 2558908191 2558860112 Bacteria 9931328
223 2644181516 2643221632 Bacteria 3406696
224 2644626068 2643221714 Bacteria 9015452
225 2705994555 2703719227 Bacteria 5631989
226 2739155946 2738541358 Bacteria 5932299
227 2739208725 2738543006 Bacteria 5904091
228 2793976022 2791355406 Bacteria 11364898
229 2837185521 2837183177 Bacteria 4637169
230 2856744564 2856741275 Bacteria 8096094
231 2870789476 2870782633 Bacteria 9624083
232 2870790323 2870782633 Bacteria 9624083
233 2873316115 2873314349 Bacteria 8512634
234 2891566000 2891562705 Bacteria 8039471
235 2912758511 2912757875 Bacteria 7940295
236 2915362986 2915358134 Bacteria 6050864
237 2965763929 2965761152 Bacteria 5806513
238 2979086353 2979083700 Bacteria 5894929
239 2997601827 2997600082 Bacteria 9896405
240 3006489065 3006486233 Bacteria 8157040
241 8022625076 8022621104 Bacteria 5241040
242 8023446336 8023444577 Bacteria 5661597
243 8047900870 8047893842 Bacteria 11723082
244 8048358032 8048356638 Bacteria 11044339
245 8048377811 8048369669 Bacteria 11666822
246 8048386908 8048379754 Bacteria 11877923
247 8054472805 8054472261 Bacteria 7464355
248 8056671643 8056667051 Bacteria 6953971
249 Ga0495625_0030768
250 JGI25159J45721_1000926
251 JGI25159J45721_1015858
252 JGI25151J46595_10006416
253 JGI25151J46595_10009302
254 JGI25151J46595_10010754
255 JGI25151J46595_10055982
256 rootL2_10069414
257 rootH1_10239843
258 Ga0055525_1000030
259 Ga0055527_1000033
260 Ga0055535_1001782
261 Ga0055542_1000075
262 Ga0055529_1001244
263 Ga0065715_10188005
264 Ga0070676_10174567
265 Ga0070689_100082992
266 Ga0070687_100112311
267 Ga0070668_100000404
268 Ga0070668_100182417
269 Ga0070669_100005283
270 Ga0070671_100030410
271 Ga0070667_100000022
272 Ga0070681_10496556
273 Ga0070699_100354901
274 Ga0070679_100057788
275 Ga0068853_100238971
276 Ga0070665_100002997
277 Ga0070665_100019097
278 Ga0068855_100156319
279 Ga0068855_100376472
280 Ga0068854_100000935
281 Ga0068859_100002659
282 Ga0068863_100000141
283 Ga0068863_100001550
284 Ga0068860_100000038
285 Ga0068860_100007882
286 Ga0068862_100000064
287 Ga0081538_10007232
288 Ga0081539_10000988
289 Ga0070717_10387145
290 Ga0075430_100027322
291 Ga0097620_100002659
292 Ga0105251_10053182
293 Ga0105244_10014792
294 Ga0105244_10103622
295 Ga0105250_10002454
296 Ga0105240_10000001
297 Ga0105247_10000021
298 Ga0114129_10120311
299 Ga0114129_10182489
300 Ga0105241_10008773
301 Ga0105248_10000141
302 Ga0105238_10167046
303 Ga0105249_10000060
304 Ga0105029_101189
305 Ga0157369_10000343
306 Ga0157369_10108005
307 Ga0157369_10216735
308 Ga0157375_10551779
309 Ga0157379_10009617
310 Ga0209672_100004
311 Ga0209563_100028
312 Ga0209258_100003
313 Ga0209148_1000016
314 Ga0209455_1000004
315 Ga0209130_1000213
316 Ga0209130_1000875
317 Ga0209025_1000143
318 Ga0209025_1002120
319 Ga0209025_1005388
320 Ga0209025_1005783
321 Ga0209025_1007234
322 Ga0209025_1014375
323 Ga0209025_1027970
324 Ga0209025_1037668
325 Ga0207696_1002454
326 Ga0207696_1033164
327 Ga0207655_1009559
328 Ga0207655_1085163
329 Ga0207692_10171333
330 Ga0207710_10000027
331 Ga0207647_10000849
332 Ga0207699_10027730
333 Ga0207643_10055201
334 Ga0207707_10052787
335 Ga0207695_10000001
336 Ga0207695_10013047
337 Ga0207671_10000654
338 Ga0207681_10196178
339 Ga0207664_10199050
340 Ga0207644_10032305
341 Ga0207690_10084797
342 Ga0207711_10000311
343 Ga0207689_10203402
344 Ga0207651_10106154
345 Ga0207712_10000051
346 Ga0207668_10037924
347 Ga0207668_10059112
348 Ga0207658_10000716
349 Ga0207703_10099801
350 Ga0207678_10188317
351 Ga0207641_10000162
352 Ga0207641_10005300
353 Ga0207675_100006487
354 Ga0268266_10011762
355 Ga0268266_10019236
356 Ga0268266_10368624
357 Ga0268265_10000028
358 Ga0268264_10000092
359 Ga0268264_10085679
360 Ga0265324_10018772
361 Ga0307512_10077267
362 Ga0307513_10000002
363 Ga0307509_10185911
364 Ga0307508_10033541
365 Ga0307508_10093660
366 Ga0307416_100347489
367 Ga0307411_10029270
368 Ga0307415_100000994
369 Ga0373953_0007349
370 Ga0373956_0057945
371 Ga0373946_0000148
372 Ga0373937_0166515
373 Ga0237819_00107
374 Ga0237819_01242
375 Ga0439460_0009005
376 Ga0466969_0002255
377 Ga0466969_0008754
378 Ga0466969_0103245
379 Ga0466969_0148643
380 Ga0466972_0096864
381 Ga0453683_0000287
382 Ga0466965_0020729
383 Ga0466966_0099348
384 Ga0466966_0122503
385 Ga0466961_0034628
386 Ga0466961_0056214
387 Ga0466963_0011350
388 Ga0453684_0173542
389 Ga0466970_0097638
390 Ga0466970_0141787
391 Ga0466957_0176336
392 Ga0466960_0001649
393 Ga0466960_0082041
394 Ga0466959_0001411
395 Ga0466959_0141582
396 Ga0466959_0159017
397 Ga0451576_0775572
398 Ga0466958_0127870
399 Ga0466967_0124524
400 Ga0466967_0230985
401 Ga0495592_0158768
402 Ga0495651_0060520
403 Ga0495653_0053900
404 Ga0495583_0006119
405 Ga0495630_0276942
406 Ga0495667_0049729
407 Ga0495668_0007010
408 Ga0495657_0121420
409 Ga0495623_0164402
410 Ga0495604_0004272
411 Ga0495680_0011038
412 Ga0495677_0013976
413 Ga0495684_0003425
414 Ga0496100_0011859
415 Ga0496101_0001183
416 Ga0496102_0000363
417 Ga0496102_0000458
418 Ga0496102_0335517
419 Ga0496103_0000196
420 Ga0496103_0000466
421 Ga0496104_0530040
422 Ga0496106_0015855
423 Ga0496107_0344763
424 Ga0496108_0171524
425 Ga0496109_0439675
426 Ga0496114_0177960
427 Ga0496116_0000269
428 Ga0496116_0027360
429 Ga0496117_0000568
430 Ga0496117_0010358
431 Ga0496118_0000136
432 Ga0496118_0004365
433 Ga0496119_0004758
434 Ga0496119_0172414
435 Ga0496120_0092723
436 Ga0496121_0003515
437 Ga0496121_0005922
438 Ga0496122_0002464
439 Ga0496124_0140494
440 Ga0496125_0010158
441 Ga0496125_0021201
442 Ga0496126_0000799
443 Ga0496126_0009328
444 Ga0501032_0006076
445 Ga0501032_0271669
446 Ga0501033_0025229
447 Ga0501033_0116068
448 Ga0501034_0046338
449 Ga0501034_0091127
450 Ga0501036_0074541
451 Ga0501037_0094523
452 Ga0501037_0241578
453 Ga0501038_0071800
454 Ga0501039_0056211
455 Ga0501043_0034023
456 Ga0501047_0057783
457 Ga0501047_0308433
458 Ga0501070_0195280
459 Ga0501080_0575310
460 Ga0501083_0044143
461 Ga0501035_0036421
462 Ga0501044_0019406
463 Ga0501044_0063122
464 Ga0501045_0080935
465 nmdc:mga08y16_593078_c1
466 Ga0500566_0004805
467 Ga0500568_0000054
468 Ga0500585_107131
469 Ga0500603_000867
470 2558908191
471 2644181516
472 2644626068
473 2705994555
474 2739155946
475 2739208725
476 2793976022
477 2837185521
478 2856744564
479 2870789476
480 2870790323
481 2873316115
482 2891566000
483 2912758511
484 2915362986
485 2965763929
486 2979086353
487 2997601827
488 3006489065
489 8022625076
490 8023446336
491 8047900870
492 8048358032
493 8048377811
494 8048386908
495 8054472805
496 8056671643

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

199

341

0.94

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

176

278

0.9

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

46

135

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5a3j-assembly8.cif.gz_H crystal structure of the chloroplastic gamma-ketol reductase from arabidopsis thaliana bound to 13-oxo-9(z),11(e),15(z)- octadecatrienoic acid. 0.939 1 306
5a3j-assembly8.cif.gz_H crystal structure of the chloroplastic gamma-ketol reductase from arabidopsis thaliana bound to 13-oxo-9(z),11(e),15(z)- octadecatrienoic acid. 0.9302 1 306
3tqh-assembly1.cif.gz_A structure of the quinone oxidoreductase from coxiella burnetii 0.9201 1 308
3tqh-assembly1.cif.gz_A structure of the quinone oxidoreductase from coxiella burnetii 0.9173 1 308
2vn8-assembly2.cif.gz_B crystal structure of human reticulon 4 interacting protein 1 in complex with nadph 0.9148 2 306
ID Description Score Start End Superfamily
af_M0R3N4_1_117_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9583 1 119 3.90.180.10
af_Q9LK96_31_155_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9483 2 119 3.90.180.10
af_I1LVH0_49_172_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9452 2 124 3.90.180.10
af_O45496_9_126_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9435 1 124 3.90.180.10
af_O94564_145_291_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.943 126 235 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2A8BL52-F1-model_v4 NADPH:quinone reductase 1 1 308 GO:0016491
AF-A0A1S9XML4-F1-model_v4 deleted 0.9995 1 308
AF-A0A1G7PUL5-F1-model_v4 Alcohol dehydrogenase GroES-like domain-containing protein 0.9863 1 131
AF-A0A0R1STS2-F1-model_v4 Alcohol dehydrogenase-like N-terminal domain-containing protein 0.9784 1 145
AF-A0A254NLG6-F1-model_v4 NADPH:quinone reductase 0.9768 1 308 GO:0008270
GO:0016491

Map