F360182

General Info

Members Datasets Scaffolds Average Seq Length
248 181 227 119

Family's Representative Sequence

Representative Sequence 3300046691|Ga0495670_0149190|Ga0495670_0149190_493_873
Length 126
Sequence VKKVLDLNSDKSIYIQIAEAIENDILLENLKEGEQAPSTNQFAKVYQINPATAGKGLNIMVEEEILYKKRGVGMFVAEGARGKILKKRQAAFFKERVPELLREAERLELSMKEIIEVIKKYDGGVE

Samples

Sample ID Description Type Environment
1 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
2 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
3 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
4 2643221549 Agromyces sp. Root1464 Isolate Unclassified
5 2643221572 Leifsonia sp. Root60 Isolate Unclassified
6 2643221619 Agromyces sp. Root81 Isolate Unclassified
7 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
8 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
9 2738541295 Bacillus sp. OK085 Isolate Unclassified
10 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
11 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
12 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
13 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
14 2916971899 Alkalihalobacillus miscanthi AK13 Isolate Rhizosphere
15 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
16 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
17 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
18 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
19 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
20 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
21 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
22 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
107 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
108 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
109 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
110 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
111 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
112 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
113 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
114 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
115 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
116 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
117 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
118 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
119 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
120 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
121 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
122 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
123 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
124 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
125 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
126 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
127 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
128 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
129 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
130 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
131 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
132 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
133 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
134 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
135 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
136 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
137 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
138 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
139 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
140 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
141 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
142 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
153 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
154 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
155 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
156 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
157 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
158 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
159 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
160 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
161 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
162 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
163 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
165 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
166 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
167 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
168 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
169 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
170 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
171 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
172 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
173 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
174 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
175 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
176 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
177 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
178 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
179 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
180 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
181 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.53
Metatranscriptomes 0
Isolates 8.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.13
Nodule 0
Rhizoplane 5.24
Rhizosphere 65.73
Stem 0
Stem Tuber 0.4
Unclassified 12.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10295007 3300003322 Bacteria 1548
2 Ga0055542_1045821 3300003762 Bacteria 501
3 Ga0070658_10084829 3300005327 Bacteria 2604
4 Ga0068868_100004063 3300005338 Bacteria 10207
5 Ga0070660_100074627 3300005339 Bacteria 2654
6 Ga0070661_100042648 3300005344 Bacteria 3312
7 Ga0070675_100152348 3300005354 Bacteria 1983
8 Ga0070671_100503298 3300005355 Bacteria 1042
9 Ga0070671_100972266 3300005355 Bacteria 743
10 Ga0070688_100816854 3300005365 Bacteria 730
11 Ga0070659_100000680 3300005366 Bacteria 24766
12 Ga0070667_102172774 3300005367 Bacteria 523
13 Ga0070714_101141690 3300005435 Bacteria 760
14 Ga0070663_100867820 3300005455 Bacteria 778
15 Ga0070663_101512953 3300005455 Bacteria 597
16 Ga0070678_100460684 3300005456 Bacteria 1115
17 Ga0070685_11516931 3300005466 Bacteria 517
18 Ga0070684_101150977 3300005535 Bacteria 729
19 Ga0068853_101285690 3300005539 Bacteria 707
20 Ga0068856_100357716 3300005614 Bacteria 1479
21 Ga0068856_100405179 3300005614 Bacteria 1383
22 Ga0070702_100635640 3300005615 Bacteria 805
23 Ga0068852_100005500 3300005616 Bacteria 9074
24 Ga0068861_100117775 3300005719 Bacteria 2138
25 Ga0068870_10244879 3300005840 Bacteria 1109
26 Ga0068863_100327485 3300005841 Bacteria 1489
27 Ga0068858_100000058 3300005842 Bacteria 117238
28 Ga0068862_100403008 3300005844 Bacteria 1280
29 Ga0075365_10007551 3300006038 Bacteria 6102
30 Ga0075365_10082737 3300006038 Bacteria 2177
31 Ga0075364_10004152 3300006051 Bacteria 8302
32 Ga0075364_10192902 3300006051 Bacteria 1380
33 Ga0075364_10520948 3300006051 Bacteria 813
34 Ga0075364_11193627 3300006051 Bacteria 516
35 Ga0075369_10082329 3300006186 Bacteria 1429
36 Ga0075370_10075851 3300006353 Bacteria 1928
37 Ga0075370_10990131 3300006353 Bacteria 515
38 Ga0105244_10077600 3300009036 Bacteria 1648
39 Ga0105240_10005269 3300009093 Bacteria 19311
40 Ga0105240_10034667 3300009093 Bacteria 6508
41 Ga0111539_10448577 3300009094 Bacteria 1502
42 Ga0105245_10007858 3300009098 Bacteria 9331
43 Ga0105245_10023015 3300009098 Bacteria 5467
44 Ga0105247_10106372 3300009101 Bacteria 1800
45 Ga0105243_10191026 3300009148 Bacteria 1789
46 Ga0105241_10007427 3300009174 Bacteria 8068
47 Ga0105248_10131011 3300009177 Bacteria 2829
48 Ga0105248_10429816 3300009177 Bacteria 1487
49 Ga0105237_10135273 3300009545 Bacteria 2459
50 Ga0105237_12767347 3300009545 Bacteria 502
51 Ga0105238_10265383 3300009551 Bacteria 1697
52 Ga0105238_12579937 3300009551 Bacteria 544
53 Ga0105249_10245184 3300009553 Bacteria 1773
54 Ga0105239_10124164 3300010375 Bacteria 2868
55 Ga0105246_10041214 3300011119 Bacteria 3120
56 Ga0105246_10129413 3300011119 Bacteria 1883
57 Ga0105246_11862460 3300011119 Bacteria 576
58 Ga0157370_10821948 3300013104 Bacteria 845
59 Ga0157369_10117614 3300013105 Bacteria 2821
60 Ga0157374_10464032 3300013296 Bacteria 1268
61 Ga0163162_10209640 3300013306 Bacteria 2078
62 Ga0157375_10380716 3300013308 Bacteria 1578
63 Ga0157375_11504322 3300013308 Bacteria 795
64 Ga0163163_11645288 3300014325 Bacteria 703
65 Ga0157380_10010708 3300014326 Bacteria 6608
66 Ga0157380_11724943 3300014326 Bacteria 684
67 Ga0157379_10000995 3300014968 Bacteria 22979
68 Ga0157376_10302289 3300014969 Bacteria 1515
69 Ga0163161_10420776 3300017792 Bacteria 1075
70 Ga0163161_11136565 3300017792 Bacteria 673
71 Ga0209784_103288 3300025224 Bacteria 1401
72 Ga0209672_112519 3300025228 Bacteria 1053
73 Ga0209148_1000401 3300025254 Bacteria 50504
74 Ga0209455_1003813 3300025272 Bacteria 5169
75 Ga0207688_10171006 3300025901 Bacteria 1292
76 Ga0207705_10073898 3300025909 Bacteria 2474
77 Ga0207654_10000003 3300025911 Bacteria 1030378
78 Ga0207695_10005147 3300025913 Bacteria 17513
79 Ga0207695_10011318 3300025913 Bacteria 10815
80 Ga0207662_10767468 3300025918 Bacteria 678
81 Ga0207657_10031014 3300025919 Bacteria 4846
82 Ga0207649_10276034 3300025920 Bacteria 1220
83 Ga0207681_10578426 3300025923 Bacteria 926
84 Ga0207694_10211062 3300025924 Bacteria 1581
85 Ga0207659_10151460 3300025926 Bacteria 1812
86 Ga0207687_11455777 3300025927 Bacteria 589
87 Ga0207644_10318197 3300025931 Bacteria 1258
88 Ga0207690_10001717 3300025932 Bacteria 13454
89 Ga0207709_10119211 3300025935 Bacteria 1779
90 Ga0207711_10078278 3300025941 Bacteria 2884
91 Ga0207711_11717546 3300025941 Bacteria 571
92 Ga0207689_10130614 3300025942 Bacteria 2067
93 Ga0207667_10030034 3300025949 Bacteria 5885
94 Ga0207712_10139530 3300025961 Bacteria 1858
95 Ga0207640_10876539 3300025981 Bacteria 783
96 Ga0207658_11692427 3300025986 Bacteria 578
97 Ga0207677_10003858 3300026023 Bacteria 7983
98 Ga0207703_10000026 3300026035 Bacteria 211591
99 Ga0207639_10345797 3300026041 Bacteria 1327
100 Ga0207678_10832775 3300026067 Bacteria 815
101 Ga0207702_10393805 3300026078 Bacteria 1334
102 Ga0207702_10430504 3300026078 Bacteria 1277
103 Ga0207641_11831155 3300026088 Bacteria 609
104 Ga0207676_10795295 3300026095 Bacteria 922
105 Ga0207674_10080124 3300026116 Bacteria 3269
106 Ga0207674_10138519 3300026116 Bacteria 2394
107 Ga0207683_10607071 3300026121 Bacteria 1013
108 Ga0307511_10376963 3300030521 Bacteria 595
109 Ga0307405_10500594 3300031731 Bacteria 974
110 Ga0307405_11547593 3300031731 Bacteria 584
111 Ga0307413_10571406 3300031824 Bacteria 921
112 Ga0307406_10348393 3300031901 Bacteria 1156
113 Ga0307407_11410909 3300031903 Bacteria 549
114 Ga0307416_100097942 3300032002 Bacteria 2542
115 Ga0307415_100469145 3300032126 Bacteria 1093
116 Ga0439465_0090116 3300041413 Bacteria 1048
117 Ga0451791_0526658 3300041451 Bacteria 1140
118 Ga0451793_0531311 3300041452 Bacteria 630
119 Ga0451795_0428190 3300041456 Bacteria 776
120 Ga0451800_1216727 3300041459 Bacteria 733
121 Ga0451806_024648 3300041462 Bacteria 589
122 Ga0451833_1165886 3300041491 Bacteria 730
123 Ga0451841_0565666 3300041498 Bacteria 863
124 Ga0466965_0000012 3300044683 Bacteria 100611
125 Ga0466961_0086035 3300044693 Bacteria 1987
126 Ga0495650_0002194 3300046471 Bacteria 16500
127 Ga0495654_0366286 3300046530 Unclassified 577
128 Ga0495625_0310413 3300046660 Bacteria 1007
129 Ga0495670_0077341 3300046691 Bacteria 1692
130 Ga0495670_0149190 3300046691 Bacteria 1226
131 Ga0495636_0271753 3300047318 Bacteria 788
132 Ga0496101_0312644 3300048904 Bacteria 1232
133 Ga0496104_1034454 3300048907 Bacteria 725
134 Ga0496105_1205931 3300048908 Bacteria 557
135 Ga0496107_0463093 3300048910 Bacteria 941
136 Ga0496109_0995123 3300048912 Bacteria 776
137 Ga0496113_0050938 3300048916 Bacteria 3089
138 Ga0496114_0913658 3300048917 Bacteria 759
139 Ga0496114_1172352 3300048917 Bacteria 654
140 Ga0496117_0019992 3300048920 Bacteria 5477
141 Ga0496118_0111648 3300048921 Bacteria 1812
142 Ga0496118_0149782 3300048921 Bacteria 1462
143 Ga0496119_0001228 3300048922 Bacteria 31914
144 Ga0496119_0001492 3300048922 Bacteria 28020
145 Ga0496119_0421839 3300048922 Bacteria 633
146 Ga0496120_0000617 3300048923 Bacteria 53694
147 Ga0496120_0025272 3300048923 Bacteria 3689
148 Ga0496120_0039694 3300048923 Bacteria 2774
149 Ga0496120_0113067 3300048923 Bacteria 1415
150 Ga0496121_0000040 3300048924 Bacteria 348494
151 Ga0496121_0091862 3300048924 Bacteria 2368
152 Ga0496122_0270221 3300048925 Bacteria 937
153 Ga0496125_0432807 3300048928 Bacteria 759
154 Ga0496125_0557511 3300048928 Bacteria 634
155 Ga0496125_0564706 3300048928 Bacteria 628
156 Ga0501031_0130759 3300049568 Bacteria 1640
157 Ga0501031_0699307 3300049568 Bacteria 651
158 Ga0501032_0007436 3300049569 Bacteria 8002
159 Ga0501032_0012534 3300049569 Bacteria 6053
160 Ga0501032_0360361 3300049569 Bacteria 936
161 Ga0501032_0675457 3300049569 Bacteria 655
162 Ga0501034_0028848 3300049571 Bacteria 5645
163 Ga0501034_0112882 3300049571 Bacteria 2707
164 Ga0501034_0477939 3300049571 Bacteria 1161
165 Ga0501037_0021650 3300049573 Bacteria 4753
166 Ga0501038_0234219 3300049574 Bacteria 1460
167 Ga0501042_0165089 3300049578 Bacteria 1598
168 Ga0501042_0810836 3300049578 Bacteria 681
169 Ga0501043_0007658 3300049579 Bacteria 8557
170 Ga0501043_0063324 3300049579 Bacteria 2904
171 Ga0501046_0109241 3300049580 Bacteria 2114
172 Ga0501047_0004379 3300049581 Bacteria 13288
173 Ga0501047_0007294 3300049581 Bacteria 10393
174 Ga0501047_0082144 3300049581 Bacteria 3097
175 Ga0501048_0004091 3300049582 Bacteria 11106
176 Ga0501067_0072116 3300049583 Bacteria 1913
177 Ga0501067_0253993 3300049583 Bacteria 979
178 Ga0501069_0031808 3300049585 Bacteria 2904
179 Ga0501069_0212794 3300049585 Bacteria 1122
180 Ga0501070_0002359 3300049586 Bacteria 16556
181 Ga0501070_0003427 3300049586 Bacteria 13748
182 Ga0501070_0224370 3300049586 Bacteria 1540
183 Ga0501070_0866197 3300049586 Bacteria 706
184 Ga0501072_0011796 3300049588 Bacteria 6675
185 Ga0501073_0008585 3300049589 Bacteria 7573
186 Ga0501073_0033218 3300049589 Bacteria 3675
187 Ga0501073_0119222 3300049589 Bacteria 1829
188 Ga0501074_0033516 3300049590 Bacteria 3722
189 Ga0501075_0311389 3300049591 Bacteria 1200
190 Ga0501076_1437787 3300049592 Bacteria 566
191 Ga0501079_0515420 3300049741 Bacteria 940
192 Ga0501080_0000057 3300049742 Bacteria 72729
193 Ga0501080_0075247 3300049742 Bacteria 3141
194 Ga0501080_0157992 3300049742 Bacteria 2094
195 Ga0501083_0093205 3300049744 Bacteria 1988
196 Ga0501035_0001935 3300049822 Bacteria 20740
197 Ga0501044_0001143 3300049823 Bacteria 31426
198 Ga0501044_0133281 3300049823 Bacteria 2477
199 Ga0501044_0691592 3300049823 Bacteria 906
200 nmdc:mga00v17_1085090_c1 3300050491 Bacteria 502
201 nmdc:mga00v17_123384_c1 3300050491 Bacteria 1651
202 nmdc:mga00v17_209416_c1 3300050491 Bacteria 1261
203 nmdc:mga00v17_479129_c1 3300050491 Bacteria 807
204 nmdc:mga00v17_7653_c1 3300050491 Bacteria 5779
205 nmdc:mga0yw44_14154_c1 3300050492 Bacteria 4224
206 nmdc:mga0yw44_78525_c1 3300050492 Bacteria 2064
207 nmdc:mga07m45_136662_c1 3300050496 Bacteria 1419
208 nmdc:mga07m45_438625_c1 3300050496 Bacteria 757
209 nmdc:mga08y16_1096505_c1 3300050511 Bacteria 771
210 nmdc:mga0sz30_105121_c1 3300050516 Bacteria 1235
211 Ga0500651_0000161 3300053093 Bacteria 43186
212 Ga0500554_042166 3300053102 Bacteria 1405
213 Ga0500556_0000559 3300053104 Bacteria 24852
214 Ga0500556_0213899 3300053104 Bacteria 761
215 Ga0500652_118738 3300053131 Bacteria 1105
216 Ga0500652_158062 3300053131 Bacteria 938
217 Ga0500655_000788 3300053133 Bacteria 6237
218 Ga0500559_0002727 3300053136 Bacteria 8975
219 Ga0500559_0117665 3300053136 Bacteria 1234
220 Ga0500559_0204259 3300053136 Bacteria 932
221 Ga0500568_0000605 3300053139 Bacteria 25994
222 Ga0500573_0000007 3300053140 Bacteria 272970
223 Ga0500573_0033568 3300053140 Bacteria 2960
224 Ga0500573_0040583 3300053140 Bacteria 2688
225 Ga0500577_0008938 3300053142 Bacteria 2884
226 Ga0500590_028277 3300053148 Bacteria 2909
227 Ga0501084_0032943 3300054114 Bacteria 4335

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2579778775 2580933386 114
2 iso_pu_bacteria 2619619294 2621274272 114
3 iso_pu_bacteria 2857737099 2857740284 114
4 iso_pu_bacteria 2939657138 2939657374 114
5 iso_pu_bacteria 2971410472 2971414306 114
6 iso_pu_bacteria 2643221549 2643769115 115
7 iso_pu_bacteria 2643221572 2643876959 115
8 iso_pu_bacteria 2643221619 2644112587 115
9 iso_pu_bacteria 2643221669 2644384014 115
10 iso_pu_bacteria 2884763398 2884764528 115
11 iso_pu_bacteria 2895660088 2895662261 115
12 iso_pu_bacteria 2919443155 2919445013 115
13 iso_pu_bacteria 2935409751 2935413336 115
14 3300009093 Ga0105240_10005269 Ga0105240_1000526915 116
15 3300009174 Ga0105241_10007427 Ga0105241_1000742710 116
16 3300013104 Ga0157370_10821948 Ga0157370_108219482 116
17 3300025911 Ga0207654_10000003 Ga0207654_10000003576 116
18 3300025913 Ga0207695_10005147 Ga0207695_100051476 116
19 3300048928 Ga0496125_0432807 Ga0496125_0432807_127_480 116
20 3300049568 Ga0501031_0130759 Ga0501031_0130759_336_695 116
21 3300049569 Ga0501032_0007436 Ga0501032_0007436_5011_5370 116
22 3300049573 Ga0501037_0021650 Ga0501037_0021650_739_1098 116
23 3300049574 Ga0501038_0234219 Ga0501038_0234219_714_1073 116
24 3300049578 Ga0501042_0810836 Ga0501042_0810836_132_491 116
25 3300049581 Ga0501047_0004379 Ga0501047_0004379_8638_8997 116
26 3300049822 Ga0501035_0001935 Ga0501035_0001935_14052_14411 116
27 3300049823 Ga0501044_0001143 Ga0501044_0001143_3404_3763 116
28 3300003762 Ga0055542_1045821 Ga0055542_10458211 117
29 3300005539 Ga0068853_101285690 Ga0068853_1012856901 117
30 3300005614 Ga0068856_100405179 Ga0068856_1004051792 117
31 3300009098 Ga0105245_10007858 Ga0105245_100078587 117
32 3300009177 Ga0105248_10131011 Ga0105248_101310113 117
33 3300009545 Ga0105237_10135273 Ga0105237_101352733 117
34 3300013296 Ga0157374_10464032 Ga0157374_104640322 117
35 3300025254 Ga0209148_1000401 Ga0209148_100040138 117
36 3300025941 Ga0207711_10078278 Ga0207711_100782783 117
37 3300026041 Ga0207639_10345797 Ga0207639_103457972 117
38 3300026078 Ga0207702_10393805 Ga0207702_103938052 117
39 3300041456 Ga0451795_0428190 Ga0451795_0428190_104_457 117
40 3300044683 Ga0466965_0000012 Ga0466965_0000012_61849_62202 117
41 3300048920 Ga0496117_0019992 Ga0496117_0019992_381_734 117
42 3300048921 Ga0496118_0149782 Ga0496118_0149782_551_904 117
43 3300048922 Ga0496119_0001492 Ga0496119_0001492_11916_12269 117
44 3300048923 Ga0496120_0000617 Ga0496120_0000617_8894_9247 117
45 3300048923 Ga0496120_0025272 Ga0496120_0025272_89_442 117
46 3300048923 Ga0496120_0039694 Ga0496120_0039694_2155_2508 117
47 3300053104 Ga0500556_0213899 Ga0500556_0213899_106_459 117
48 3300053131 Ga0500652_158062 Ga0500652_158062_20_373 117
49 3300053139 Ga0500568_0000605 Ga0500568_0000605_15018_15389 117
50 3300053148 Ga0500590_028277 Ga0500590_028277_1142_1495 117
51 3300005327 Ga0070658_10084829 Ga0070658_100848292 118
52 3300005338 Ga0068868_100004063 Ga0068868_1000040635 118
53 3300005339 Ga0070660_100074627 Ga0070660_1000746274 118
54 3300005344 Ga0070661_100042648 Ga0070661_1000426482 118
55 3300005355 Ga0070671_100503298 Ga0070671_1005032982 118
56 3300005365 Ga0070688_100816854 Ga0070688_1008168542 118
57 3300005366 Ga0070659_100000680 Ga0070659_10000068016 118
58 3300005367 Ga0070667_102172774 Ga0070667_1021727741 118
59 3300005435 Ga0070714_101141690 Ga0070714_1011416901 118
60 3300005455 Ga0070663_101512953 Ga0070663_1015129531 118
61 3300005466 Ga0070685_11516931 Ga0070685_115169312 118
62 3300005614 Ga0068856_100357716 Ga0068856_1003577162 118
63 3300005616 Ga0068852_100005500 Ga0068852_1000055006 118
64 3300005841 Ga0068863_100327485 Ga0068863_1003274852 118
65 3300005842 Ga0068858_100000058 Ga0068858_1000000583 118
66 3300006038 Ga0075365_10007551 Ga0075365_100075518 118
67 3300006038 Ga0075365_10082737 Ga0075365_100827373 118
68 3300006051 Ga0075364_10004152 Ga0075364_100041523 118
69 3300006051 Ga0075364_10192902 Ga0075364_101929022 118
70 3300006051 Ga0075364_10520948 Ga0075364_105209481 118
71 3300006051 Ga0075364_11193627 Ga0075364_111936271 118
72 3300006186 Ga0075369_10082329 Ga0075369_100823292 118
73 3300006353 Ga0075370_10075851 Ga0075370_100758513 118
74 3300009093 Ga0105240_10034667 Ga0105240_100346676 118
75 3300009098 Ga0105245_10023015 Ga0105245_100230154 118
76 3300009101 Ga0105247_10106372 Ga0105247_101063722 118
77 3300009177 Ga0105248_10429816 Ga0105248_104298161 118
78 3300009545 Ga0105237_12767347 Ga0105237_127673471 118
79 3300009551 Ga0105238_10265383 Ga0105238_102653833 118
80 3300010375 Ga0105239_10124164 Ga0105239_101241642 118
81 3300011119 Ga0105246_10041214 Ga0105246_100412142 118
82 3300011119 Ga0105246_11862460 Ga0105246_118624601 118
83 3300013105 Ga0157369_10117614 Ga0157369_101176143 118
84 3300013306 Ga0163162_10209640 Ga0163162_102096401 118
85 3300013308 Ga0157375_10380716 Ga0157375_103807163 118
86 3300014326 Ga0157380_11724943 Ga0157380_117249431 118
87 3300014968 Ga0157379_10000995 Ga0157379_1000099512 118
88 3300014969 Ga0157376_10302289 Ga0157376_103022892 118
89 3300025228 Ga0209672_112519 Ga0209672_1125191 118
90 3300025272 Ga0209455_1003813 Ga0209455_10038134 118
91 3300025909 Ga0207705_10073898 Ga0207705_100738982 118
92 3300025913 Ga0207695_10011318 Ga0207695_100113189 118
93 3300025919 Ga0207657_10031014 Ga0207657_100310143 118
94 3300025920 Ga0207649_10276034 Ga0207649_102760342 118
95 3300025924 Ga0207694_10211062 Ga0207694_102110622 118
96 3300025927 Ga0207687_11455777 Ga0207687_114557772 118
97 3300025931 Ga0207644_10318197 Ga0207644_103181972 118
98 3300025932 Ga0207690_10001717 Ga0207690_100017174 118
99 3300025941 Ga0207711_11717546 Ga0207711_117175461 118
100 3300025949 Ga0207667_10030034 Ga0207667_100300342 118
101 3300025981 Ga0207640_10876539 Ga0207640_108765392 118
102 3300025986 Ga0207658_11692427 Ga0207658_116924271 118
103 3300026023 Ga0207677_10003858 Ga0207677_100038586 118
104 3300026035 Ga0207703_10000026 Ga0207703_1000002688 118
105 3300026078 Ga0207702_10430504 Ga0207702_104305042 118
106 3300026088 Ga0207641_11831155 Ga0207641_118311551 118
107 3300026116 Ga0207674_10080124 Ga0207674_100801243 118
108 3300030521 Ga0307511_10376963 Ga0307511_103769632 118
109 3300031731 Ga0307405_11547593 Ga0307405_115475932 118
110 3300032126 Ga0307415_100469145 Ga0307415_1004691452 118
111 3300041451 Ga0451791_0526658 Ga0451791_0526658_27_383 118
112 3300041452 Ga0451793_0531311 Ga0451793_0531311_67_423 118
113 3300041459 Ga0451800_1216727 Ga0451800_1216727_267_623 118
114 3300041462 Ga0451806_024648 Ga0451806_024648_91_474 118
115 3300041491 Ga0451833_1165886 Ga0451833_1165886_339_695 118
116 3300044693 Ga0466961_0086035 Ga0466961_0086035_719_1105 118
117 3300046471 Ga0495650_0002194 Ga0495650_0002194_1756_2184 118
118 3300046530 Ga0495654_0366286 Ga0495654_0366286_182_565 118
119 3300046660 Ga0495625_0310413 Ga0495625_0310413_199_555 118
120 3300046691 Ga0495670_0149190 Ga0495670_0149190_493_873 118
121 3300047318 Ga0495636_0271753 Ga0495636_0271753_289_648 118
122 3300048910 Ga0496107_0463093 Ga0496107_0463093_156_518 118
123 3300048917 Ga0496114_1172352 Ga0496114_1172352_34_411 118
124 3300048921 Ga0496118_0111648 Ga0496118_0111648_713_1069 118
125 3300048922 Ga0496119_0001228 Ga0496119_0001228_4184_4555 118
126 3300048923 Ga0496120_0113067 Ga0496120_0113067_381_752 118
127 3300048924 Ga0496121_0000040 Ga0496121_0000040_271132_271494 118
128 3300048924 Ga0496121_0091862 Ga0496121_0091862_1132_1503 118
129 3300048928 Ga0496125_0557511 Ga0496125_0557511_155_511 118
130 3300049569 Ga0501032_0012534 Ga0501032_0012534_4352_4714 118
131 3300049569 Ga0501032_0360361 Ga0501032_0360361_342_746 118
132 3300049569 Ga0501032_0675457 Ga0501032_0675457_41_412 118
133 3300049571 Ga0501034_0028848 Ga0501034_0028848_1288_1650 118
134 3300049571 Ga0501034_0112882 Ga0501034_0112882_325_696 118
135 3300049571 Ga0501034_0477939 Ga0501034_0477939_621_977 118
136 3300049578 Ga0501042_0165089 Ga0501042_0165089_1106_1510 118
137 3300049579 Ga0501043_0007658 Ga0501043_0007658_859_1230 118
138 3300049579 Ga0501043_0063324 Ga0501043_0063324_184_546 118
139 3300049580 Ga0501046_0109241 Ga0501046_0109241_706_1068 118
140 3300049581 Ga0501047_0007294 Ga0501047_0007294_7647_8018 118
141 3300049581 Ga0501047_0082144 Ga0501047_0082144_354_716 118
142 3300049582 Ga0501048_0004091 Ga0501048_0004091_10489_10851 118
143 3300049583 Ga0501067_0072116 Ga0501067_0072116_813_1169 118
144 3300049583 Ga0501067_0253993 Ga0501067_0253993_231_593 118
145 3300049585 Ga0501069_0031808 Ga0501069_0031808_2062_2433 118
146 3300049585 Ga0501069_0212794 Ga0501069_0212794_744_1106 118
147 3300049586 Ga0501070_0002359 Ga0501070_0002359_3057_3428 118
148 3300049586 Ga0501070_0003427 Ga0501070_0003427_10388_10750 118
149 3300049586 Ga0501070_0224370 Ga0501070_0224370_666_1028 118
150 3300049586 Ga0501070_0866197 Ga0501070_0866197_173_529 118
151 3300049588 Ga0501072_0011796 Ga0501072_0011796_3999_4355 118
152 3300049589 Ga0501073_0008585 Ga0501073_0008585_5500_5856 118
153 3300049589 Ga0501073_0033218 Ga0501073_0033218_3182_3553 118
154 3300049589 Ga0501073_0119222 Ga0501073_0119222_1388_1744 118
155 3300049590 Ga0501074_0033516 Ga0501074_0033516_367_729 118
156 3300049591 Ga0501075_0311389 Ga0501075_0311389_723_1094 118
157 3300049592 Ga0501076_1437787 Ga0501076_1437787_91_462 118
158 3300049741 Ga0501079_0515420 Ga0501079_0515420_35_391 118
159 3300049742 Ga0501080_0000057 Ga0501080_0000057_36682_37053 118
160 3300049742 Ga0501080_0075247 Ga0501080_0075247_2567_2929 118
161 3300049742 Ga0501080_0157992 Ga0501080_0157992_579_941 118
162 3300049744 Ga0501083_0093205 Ga0501083_0093205_1480_1851 118
163 3300049823 Ga0501044_0133281 Ga0501044_0133281_1762_2124 118
164 3300049823 Ga0501044_0691592 Ga0501044_0691592_194_550 118
165 3300050491 nmdc:mga00v17_1085090_c1 nmdc:mga00v17_1085090_c1_99_455 118
166 3300050491 nmdc:mga00v17_123384_c1 nmdc:mga00v17_123384_c1_889_1260 118
167 3300050491 nmdc:mga00v17_209416_c1 nmdc:mga00v17_209416_c1_217_597 118
168 3300050491 nmdc:mga00v17_479129_c1 nmdc:mga00v17_479129_c1_416_772 118
169 3300050491 nmdc:mga00v17_7653_c1 nmdc:mga00v17_7653_c1_1773_2138 118
170 3300050492 nmdc:mga0yw44_14154_c1 nmdc:mga0yw44_14154_c1_3101_3466 118
171 3300050492 nmdc:mga0yw44_78525_c1 nmdc:mga0yw44_78525_c1_584_940 118
172 3300050496 nmdc:mga07m45_136662_c1 nmdc:mga07m45_136662_c1_542_898 118
173 3300050496 nmdc:mga07m45_438625_c1 nmdc:mga07m45_438625_c1_321_677 118
174 3300050516 nmdc:mga0sz30_105121_c1 nmdc:mga0sz30_105121_c1_567_926 118
175 3300053093 Ga0500651_0000161 Ga0500651_0000161_731_1087 118
176 3300053102 Ga0500554_042166 Ga0500554_042166_565_936 118
177 3300053104 Ga0500556_0000559 Ga0500556_0000559_17065_17445 118
178 3300053131 Ga0500652_118738 Ga0500652_118738_644_1024 118
179 3300053133 Ga0500655_000788 Ga0500655_000788_5305_5685 118
180 3300053136 Ga0500559_0002727 Ga0500559_0002727_1760_2140 118
181 3300053136 Ga0500559_0117665 Ga0500559_0117665_791_1147 118
182 3300053136 Ga0500559_0204259 Ga0500559_0204259_108_464 118
183 3300053140 Ga0500573_0000007 Ga0500573_0000007_18581_18937 118
184 3300053140 Ga0500573_0033568 Ga0500573_0033568_182_562 118
185 3300053140 Ga0500573_0040583 Ga0500573_0040583_1693_2049 118
186 3300053142 Ga0500577_0008938 Ga0500577_0008938_1970_2332 118
187 3300054114 Ga0501084_0032943 Ga0501084_0032943_3187_3558 118
188 iso_pu_bacteria 2585428059 2587741772 118
189 iso_pu_bacteria 2643221676 2644423801 118
190 iso_pu_bacteria 2881644220 2881646174 118
191 iso_pu_bacteria 2916971899 2916975855 118
192 iso_pu_bacteria 3006988479 3006991720 118
193 iso_pu_bacteria 8056533031 8056535475 118
194 3300003322 rootL2_10295007 rootL2_102950072 119
195 3300005354 Ga0070675_100152348 Ga0070675_1001523481 119
196 3300005355 Ga0070671_100972266 Ga0070671_1009722662 119
197 3300005455 Ga0070663_100867820 Ga0070663_1008678201 119
198 3300005456 Ga0070678_100460684 Ga0070678_1004606841 119
199 3300005535 Ga0070684_101150977 Ga0070684_1011509771 119
200 3300005615 Ga0070702_100635640 Ga0070702_1006356402 119
201 3300005719 Ga0068861_100117775 Ga0068861_1001177753 119
202 3300005840 Ga0068870_10244879 Ga0068870_102448792 119
203 3300005844 Ga0068862_100403008 Ga0068862_1004030082 119
204 3300006353 Ga0075370_10990131 Ga0075370_109901311 119
205 3300009036 Ga0105244_10077600 Ga0105244_100776002 119
206 3300009094 Ga0111539_10448577 Ga0111539_104485771 119
207 3300009148 Ga0105243_10191026 Ga0105243_101910261 119
208 3300009551 Ga0105238_12579937 Ga0105238_125799371 119
209 3300009553 Ga0105249_10245184 Ga0105249_102451842 119
210 3300011119 Ga0105246_10129413 Ga0105246_101294133 119
211 3300013308 Ga0157375_11504322 Ga0157375_115043222 119
212 3300014325 Ga0163163_11645288 Ga0163163_116452881 119
213 3300014326 Ga0157380_10010708 Ga0157380_1001070810 119
214 3300017792 Ga0163161_10420776 Ga0163161_104207762 119
215 3300017792 Ga0163161_11136565 Ga0163161_111365651 119
216 3300025224 Ga0209784_103288 Ga0209784_1032882 119
217 3300025901 Ga0207688_10171006 Ga0207688_101710062 119
218 3300025918 Ga0207662_10767468 Ga0207662_107674681 119
219 3300025923 Ga0207681_10578426 Ga0207681_105784262 119
220 3300025926 Ga0207659_10151460 Ga0207659_101514603 119
221 3300025935 Ga0207709_10119211 Ga0207709_101192111 119
222 3300025942 Ga0207689_10130614 Ga0207689_101306142 119
223 3300025961 Ga0207712_10139530 Ga0207712_101395303 119
224 3300026067 Ga0207678_10832775 Ga0207678_108327752 119
225 3300026095 Ga0207676_10795295 Ga0207676_107952952 119
226 3300026116 Ga0207674_10138519 Ga0207674_101385193 119
227 3300026121 Ga0207683_10607071 Ga0207683_106070712 119
228 3300031731 Ga0307405_10500594 Ga0307405_105005942 119
229 3300031824 Ga0307413_10571406 Ga0307413_105714062 119
230 3300031901 Ga0307406_10348393 Ga0307406_103483932 119
231 3300031903 Ga0307407_11410909 Ga0307407_114109091 119
232 3300032002 Ga0307416_100097942 Ga0307416_1000979422 119
233 3300041413 Ga0439465_0090116 Ga0439465_0090116_271_630 119
234 3300041498 Ga0451841_0565666 Ga0451841_0565666_192_569 119
235 3300046691 Ga0495670_0077341 Ga0495670_0077341_68_427 119
236 3300048904 Ga0496101_0312644 Ga0496101_0312644_669_1031 119
237 3300048907 Ga0496104_1034454 Ga0496104_1034454_262_624 119
238 3300048908 Ga0496105_1205931 Ga0496105_1205931_90_452 119
239 3300048912 Ga0496109_0995123 Ga0496109_0995123_289_648 119
240 3300048916 Ga0496113_0050938 Ga0496113_0050938_1110_1469 119
241 3300048917 Ga0496114_0913658 Ga0496114_0913658_297_656 119
242 3300048922 Ga0496119_0421839 Ga0496119_0421839_254_613 119
243 3300048925 Ga0496122_0270221 Ga0496122_0270221_540_911 119
244 3300048928 Ga0496125_0564706 Ga0496125_0564706_167_526 119
245 3300049568 Ga0501031_0699307 Ga0501031_0699307_16_375 119
246 3300050511 nmdc:mga08y16_1096505_c1 nmdc:mga08y16_1096505_c1_235_594 119
247 iso_pu_bacteria 2738541295 2738817401 119
248 iso_pu_bacteria 2964375228 2964379596 119

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00392

GntR

Bacterial regulatory proteins, gntR family

13

76

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3eet-assembly1.cif.gz_A-2 crystal structure of putative gntr-family transcriptional regulator 0.9594 4 71
2wv0-assembly6.cif.gz_J-3 crystal structure of the gntr-hutc family member yvoa from bacillus subtilis 0.9485 5 71
3eet-assembly2.cif.gz_B-3 crystal structure of putative gntr-family transcriptional regulator 0.9447 8 71
2du9-assembly1.cif.gz_A crystal structure of the transcriptional factor from c.glutamicum 0.9431 5 118
2wv0-assembly5.cif.gz_I crystal structure of the gntr-hutc family member yvoa from bacillus subtilis 0.9424 1 71
ID Description Score Start End Superfamily
2wv0I01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9744 5 71 1.10.10.10
af_P13669_2_75_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9655 5 71 1.10.10.10
2wv0G01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9642 5 71 1.10.10.10
2wv0D01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.963 5 71 1.10.10.10
2wv0F01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9626 5 71 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A839J3Y9-F1-model_v4 GntR family transcriptional regulator 0.9975 5 116 GO:0003677
GO:0003700
AF-A0A846RUT7-F1-model_v4 DNA-binding transcriptional regulator YhcF (GntR family) 0.9942 1 118 GO:0003677
GO:0003700
AF-A0A1H1S871-F1-model_v4 DNA-binding transcriptional regulator YhcF, GntR family 0.9917 3 116 GO:0003677
GO:0003700
AF-A0A117NCZ2-F1-model_v4 GntR family transcriptional regulator 0.9916 1 116 GO:0003677
GO:0003700
AF-W4AU67-F1-model_v4 deleted 0.9899 1 114

Feature Viewer

pLDDT pTM Quality
94.39 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map