F360189

General Info

Members Datasets Scaffolds Average Seq Length
248 195 496 277

Family's Representative Sequence

Representative Sequence 3300047321|Ga0495676_0030368|Ga0495676_0030368_1813_2766
Length 317
Sequence MALSPTLARLKSVKAHLSHSTPTISFIGGGNMAESILAGLFAKGHPGKQLRYIEPFDERRQYMERKYPEFMSVKTNTEIADGADVVVLAIKPQVLRSVVTNSELQTALQKSSSLVVSIAGGIMSKDISKWLNYKNPSVVRCMPNTPALIGEGAVGLFANANVNNEQKKTIEYMMNAIAKEIVWVDKEEKIDTVTAVSGSGPAYYFLMMEAMRMYFCFICWYYLKLIIYIENAGIAAGLTPKDAKALTIQTCLGAARMAQESEDDLATLRKKVTSPKGTTEAALKVMESRNIREIMKDTVFAAEKRAKELADVLSKEQ

Samples

Sample ID Description Type Environment
1 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
8 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
25 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
26 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
27 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
28 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
41 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
46 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
47 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
48 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
50 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
51 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
53 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
54 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
69 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
70 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
71 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
72 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
73 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
74 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
75 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
76 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
77 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
78 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
79 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
80 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
82 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
83 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
84 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
85 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
86 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
87 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
88 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
89 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
90 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
91 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
92 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
93 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
94 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
95 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
96 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
97 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
98 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
99 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
100 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
101 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
102 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
103 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
104 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
105 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
106 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
107 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
108 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
109 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
110 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
111 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
112 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
113 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
114 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
115 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
116 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
117 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
118 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
119 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
120 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
121 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
122 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
123 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
124 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
125 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
126 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
127 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
128 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
129 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
130 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
131 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
132 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
133 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
134 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
135 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
136 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
137 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
138 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
139 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
140 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
141 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
142 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
143 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
144 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
145 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
146 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
147 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
153 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
154 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
156 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
157 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
158 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
159 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
160 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
161 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
162 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
163 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
164 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
165 2511231006 Pseudomonas sp. GM17 Isolate Nodule
166 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
167 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
168 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
169 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
170 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
171 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
172 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
173 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
174 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
175 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
176 2643221626 Ensifer sp. Root31 Isolate Unclassified
177 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
178 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
179 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
180 2857564685 Duganella sp. R-74599 Isolate Unclassified
181 2894510363 Methylomonas sp. Kb3 Isolate Unclassified
182 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
183 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
184 2928963466 Dyella japonica 1073 Isolate Unclassified
185 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
186 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
187 2989392574 Methylomonas rhizoryzae GJ1 Isolate Unclassified
188 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
189 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
190 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
191 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified
192 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere
193 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
194 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
195 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.1
Metatranscriptomes 0.4
Isolates 12.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.69
Nodule 0.4
Rhizoplane 3.63
Rhizosphere 75.81
Stem 0
Stem Tuber 0
Unclassified 1.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495676_0030368 3300047321 Eukaryota 4587
2 JGI25162J39368_1000032 3300002737 Bacteria 195871
3 JGI25154J39366_1001021 3300002738 Bacteria 11254
4 JGI25150J39212_1016626 3300002774 Bacteria 1203
5 JGI25153J46596_10022647 3300003215 Bacteria 2309
6 rootH1_10007337 3300003323 Bacteria 40898
7 Ga0055529_1000027 3300003763 Bacteria 292744
8 Ga0055530_10000266 3300003791 Bacteria 47362
9 Ga0070658_10084572 3300005327 Bacteria 2608
10 Ga0070683_100035207 3300005329 Bacteria 4576
11 Ga0068869_100161397 3300005334 Bacteria 1745
12 Ga0070680_100004498 3300005336 Bacteria 10504
13 Ga0068868_100115333 3300005338 Bacteria 2187
14 Ga0070667_100180645 3300005367 Bacteria 1866
15 Ga0070703_10085148 3300005406 Unclassified 1085
16 Ga0070681_10016068 3300005458 Bacteria 7460
17 Ga0070679_100014936 3300005530 Bacteria 7460
18 Ga0070679_100093629 3300005530 Bacteria 2992
19 Ga0070684_100370557 3300005535 Bacteria 1318
20 Ga0070664_100003250 3300005564 Bacteria 13133
21 Ga0068857_100065959 3300005577 Bacteria 3220
22 Ga0068856_100132497 3300005614 Bacteria 2497
23 Ga0068860_100507865 3300005843 Bacteria 1204
24 Ga0068862_100408926 3300005844 Bacteria 1271
25 Ga0075365_10001370 3300006038 Bacteria 10953
26 Ga0075365_10255362 3300006038 Bacteria 1232
27 Ga0075364_10000115 3300006051 Bacteria 33272
28 Ga0075364_10001204 3300006051 Bacteria 13909
29 Ga0075364_10042459 3300006051 Eukaryota 2955
30 Ga0075367_10003785 3300006178 Bacteria 7288
31 Ga0075367_10134421 3300006178 Bacteria 1530
32 Ga0075369_10000063 3300006186 Bacteria 27877
33 Ga0097621_100116512 3300006237 Bacteria 2262
34 Ga0075370_10000036 3300006353 Bacteria 42166
35 Ga0068871_100024015 3300006358 Bacteria 4724
36 Ga0075431_100059063 3300006847 Bacteria 3958
37 Ga0075429_100039704 3300006880 Bacteria 4096
38 Ga0068865_100003484 3300006881 Bacteria 9432
39 Ga0105240_10130556 3300009093 Bacteria 3014
40 Ga0105241_10023728 3300009174 Bacteria 4550
41 Ga0105241_10095796 3300009174 Bacteria 2350
42 Ga0105242_10004319 3300009176 Bacteria 11068
43 Ga0105248_10052542 3300009177 Bacteria 4572
44 Ga0105238_10046245 3300009551 Bacteria 4393
45 Ga0105239_10010154 3300010375 Bacteria 10550
46 Ga0157373_10090487 3300013100 Bacteria 2155
47 Ga0157371_10053495 3300013102 Bacteria 2867
48 Ga0157370_10148168 3300013104 Bacteria 2185
49 Ga0163162_10048786 3300013306 Bacteria 4242
50 Ga0163163_10000404 3300014325 Bacteria 40714
51 Ga0157379_10332097 3300014968 Bacteria 1389
52 Ga0163161_10058829 3300017792 Bacteria 2794
53 Ga0163161_10521662 3300017792 Bacteria 970
54 Ga0213872_10000137 3300021361 Bacteria 66117
55 Ga0213872_10007649 3300021361 Bacteria 5295
56 Ga0213872_10008830 3300021361 Bacteria 4861
57 Ga0213872_10025735 3300021361 Bacteria 2704
58 Ga0209566_101312 3300025225 Bacteria 8033
59 Ga0207425_1000212 3300025245 Bacteria 46073
60 Ga0209026_1001990 3300025250 Bacteria 8151
61 Ga0209026_1004905 3300025250 Bacteria 3780
62 Ga0209676_1000030 3300025292 Bacteria 506421
63 Ga0209025_1015521 3300025294 Bacteria 4583
64 Ga0209758_1000278 3300025297 Bacteria 102052
65 Ga0209050_1001646 3300025298 Bacteria 22793
66 Ga0209051_1000012 3300025303 Bacteria 595474
67 Ga0207680_10103050 3300025903 Bacteria 1837
68 Ga0207647_10022837 3300025904 Bacteria 4150
69 Ga0207707_10000812 3300025912 Bacteria 30590
70 Ga0207681_10480542 3300025923 Bacteria 1015
71 Ga0207706_10004745 3300025933 Bacteria 12726
72 Ga0207704_10031076 3300025938 Bacteria 3002
73 Ga0207689_10151081 3300025942 Bacteria 1914
74 Ga0207661_10094250 3300025944 Bacteria 2500
75 Ga0207703_10233029 3300026035 Bacteria 1652
76 Ga0207702_10290664 3300026078 Bacteria 1548
77 Ga0207674_10020799 3300026116 Bacteria 7082
78 Ga0209983_1000791 3300027665 Bacteria 6879
79 Ga0209971_1001807 3300027682 Bacteria 5239
80 Ga0314311_1085664 3300030733 Bacteria 8958
81 Ga0316183_1104512 3300030742 Bacteria 6949
82 Ga0265327_10001152 3300031251 Bacteria 36013
83 Ga0265327_10115928 3300031251 Bacteria 1274
84 Ga0307513_10116967 3300031456 Bacteria 2644
85 Ga0316575_10087099 3300031665 Bacteria 1262
86 Ga0265314_10015214 3300031711 Bacteria 6112
87 Ga0316577_10029433 3300031733 Bacteria 3065
88 Ga0307413_10246471 3300031824 Bacteria 1322
89 Ga0307518_10029228 3300031838 Bacteria 3986
90 Ga0307412_10098008 3300031911 Bacteria 2066
91 Ga0307414_10077592 3300032004 Bacteria 2418
92 Ga0316593_10089955 3300032168 Bacteria 1080
93 Ga0316574_0130144 3300035398 Bacteria 1619
94 Ga0316582_0046833 3300036647 Bacteria 2728
95 Ga0316584_0002341 3300036712 Bacteria 11943
96 Ga0316584_0046027 3300036712 Bacteria 3258
97 Ga0395899_0000085 3300037312 Bacteria 159118
98 Ga0400485_01072 3300038735 Bacteria 3396
99 Ga0400483_011190 3300039062 Bacteria 182340
100 Ga0400483_215675 3300039062 Bacteria 181282
101 Ga0400483_219863 3300039062 Bacteria 173210
102 Ga0400489_16599 3300039093 Bacteria 2746
103 Ga0436361_0200833 3300039447 Bacteria 3922
104 Ga0436361_0799736 3300039447 Bacteria 1106
105 Ga0436361_0852784 3300039447 Bacteria 4994
106 Ga0436361_0900144 3300039447 Bacteria 143515
107 Ga0436361_0937550 3300039447 Bacteria 4069
108 Ga0439466_0003738 3300041411 Bacteria 5878
109 Ga0439456_000100 3300042013 Bacteria 29896
110 Ga0439463_001963 3300042016 Bacteria 5347
111 Ga0439446_0000472 3300042156 Bacteria 7970
112 Ga0451577_0000162 3300042876 Bacteria 145994
113 Ga0466972_0000283 3300044658 Bacteria 31634
114 Ga0466961_0033067 3300044693 Bacteria 3324
115 Ga0453684_0000524 3300044712 Bacteria 146655
116 Ga0453684_0106726 3300044712 Bacteria 3412
117 Ga0466970_0065673 3300044765 Bacteria 1947
118 Ga0466957_0362318 3300044842 Bacteria 985
119 Ga0451576_0001019 3300045051 Bacteria 51865
120 Ga0495617_000350 3300046452 Bacteria 25424
121 Ga0495627_000006 3300046453 Bacteria 581750
122 Ga0495638_0000229 3300046460 Bacteria 76824
123 Ga0495638_0012641 3300046460 Bacteria 5776
124 Ga0495638_0040263 3300046460 Bacteria 2961
125 Ga0495653_0002765 3300046463 Eukaryota 13995
126 Ga0495650_0014950 3300046471 Bacteria 4005
127 Ga0495650_0043040 3300046471 Bacteria 1920
128 Ga0495580_0040444 3300046472 Bacteria 3330
129 Ga0495605_0002786 3300046474 Bacteria 10643
130 Ga0495584_0003945 3300046491 Bacteria 8018
131 Ga0495584_0008320 3300046491 Bacteria 5372
132 Ga0495585_0000113 3300046492 Bacteria 86842
133 Ga0495585_0027683 3300046492 Bacteria 3234
134 Ga0495585_0032632 3300046492 Bacteria 2949
135 Ga0495585_0033014 3300046492 Bacteria 2932
136 Ga0495596_0001864 3300046500 Bacteria 11688
137 Ga0495607_0066586 3300046501 Bacteria 2026
138 Ga0495583_0000063 3300046506 Bacteria 194362
139 Ga0495606_0000004 3300046507 Bacteria 406209
140 Ga0495606_0008748 3300046507 Bacteria 8703
141 Ga0495608_0017155 3300046511 Bacteria 5012
142 Ga0495610_0001271 3300046512 Bacteria 22594
143 Ga0495610_0081712 3300046512 Bacteria 1482
144 Ga0495616_0008419 3300046513 Bacteria 6111
145 Ga0495616_0012120 3300046513 Bacteria 4908
146 Ga0495616_0029543 3300046513 Bacteria 2892
147 Ga0495628_0000646 3300046516 Bacteria 31897
148 Ga0495632_0027982 3300046519 Bacteria 2945
149 Ga0495637_0018582 3300046520 Bacteria 3223
150 Ga0495644_0013949 3300046523 Bacteria 3080
151 Ga0495648_0004582 3300046524 Bacteria 11777
152 Ga0495648_0005730 3300046524 Bacteria 10252
153 Ga0495663_0015529 3300046525 Bacteria 2145
154 Ga0495652_0007251 3300046529 Bacteria 10235
155 Ga0495609_0000900 3300046538 Bacteria 21694
156 Ga0495609_0006643 3300046538 Bacteria 5870
157 Ga0495633_0013619 3300046558 Bacteria 4278
158 Ga0495656_0029747 3300046615 Bacteria 2201
159 Ga0495668_0001045 3300046616 Bacteria 29353
160 Ga0495611_0016611 3300046648 Bacteria 3145
161 Ga0495611_0032933 3300046648 Bacteria 2285
162 Ga0495611_0122137 3300046648 Bacteria 1214
163 Ga0495611_0132483 3300046648 Unclassified 1163
164 Ga0495661_0057614 3300046665 Bacteria 2319
165 Ga0495661_0072540 3300046665 Bacteria 2008
166 Ga0495588_0032629 3300046674 Bacteria 2625
167 Ga0495647_0013857 3300046681 Bacteria 2802
168 Ga0495669_0005936 3300046684 Bacteria 5090
169 Ga0495624_0131530 3300046690 Bacteria 1534
170 Ga0495670_0006062 3300046691 Bacteria 5925
171 Ga0495670_0007088 3300046691 Bacteria 5521
172 Ga0495671_0019047 3300046692 Bacteria 3633
173 Ga0495660_0000383 3300046810 Bacteria 38501
174 Ga0495660_0018409 3300046810 Bacteria 4016
175 Ga0495636_0000349 3300047318 Bacteria 17607
176 Ga0495672_0000005 3300047320 Bacteria 593294
177 Ga0495672_0004982 3300047320 Bacteria 10651
178 Ga0495672_0012998 3300047320 Bacteria 5766
179 Ga0495672_0023947 3300047320 Bacteria 3941
180 Ga0495683_0006176 3300047323 Bacteria 6565
181 Ga0495683_0009614 3300047323 Bacteria 5147
182 Ga0495683_0058388 3300047323 Bacteria 1916
183 Ga0495687_001201 3300047443 Bacteria 24818
184 Ga0495677_0011605 3300047445 Bacteria 3221
185 Ga0495677_0016463 3300047445 Bacteria 2683
186 Ga0495685_000337 3300047447 Bacteria 15070
187 Ga0495673_0007167 3300047469 Bacteria 6451
188 Ga0495681_0092889 3300047470 Bacteria 1329
189 Ga0495686_0006794 3300047472 Bacteria 8684
190 Ga0495686_0075045 3300047472 Bacteria 2074
191 Ga0496102_0309124 3300048905 Bacteria 1490
192 Ga0495678_001390 3300049459 Bacteria 19249
193 Ga0495678_001844 3300049459 Bacteria 15508
194 Ga0501033_0112274 3300049570 Bacteria 1983
195 Ga0501034_0000834 3300049571 Bacteria 45735
196 Ga0501034_0208143 3300049571 Bacteria 1912
197 Ga0501038_0282537 3300049574 Bacteria 1306
198 Ga0501043_0030383 3300049579 Bacteria 4246
199 Ga0501043_0112598 3300049579 Bacteria 2137
200 Ga0501047_0009312 3300049581 Bacteria 9275
201 Ga0501070_0000265 3300049586 Bacteria 49246
202 Ga0501070_0013742 3300049586 Bacteria 6819
203 Ga0501074_0219662 3300049590 Bacteria 1353
204 Ga0501035_0010740 3300049822 Bacteria 8478
205 Ga0501044_0548352 3300049823 Bacteria 1053
206 nmdc:mga00v17_1170_c1 3300050491 Bacteria 13791
207 nmdc:mga00v17_261_c1 3300050491 Bacteria 30976
208 nmdc:mga00v17_741_c1 3300050491 Bacteria 17765
209 nmdc:mga0yw44_229406_c1 3300050492 Bacteria 1232
210 nmdc:mga0yw44_962_c1 3300050492 Bacteria 10952
211 nmdc:mga06z11_509_c1 3300050494 Bacteria 14325
212 nmdc:mga07m45_27_c1 3300050496 Bacteria 91154
213 nmdc:mga09592_35945_c1 3300050508 Bacteria 4149
214 nmdc:mga0n895_93619_c1 3300050512 Unclassified 3008
215 nmdc:mga0sz30_18_c2 3300050516 Bacteria 68595
216 Ga0501082_0028450 3300060353 Bacteria 4815
217 Ga0530510_0269481 3300061734 Bacteria 1271
218 2511267731 2511231006 Bacteria 6794709
219 2512326733 2512047018 Bacteria 6663241
220 2554812762 2554235132 Bacteria 6772433
221 2597860791 2597489887 Bacteria 6666321
222 2599485973 2599185185 Bacteria 6652270
223 2599804756 2599185257 Bacteria 6492581
224 2599982982 2599185309 Bacteria 5969593
225 2599988268 2599185310 Bacteria 6014457
226 2599999062 2599185312 Bacteria 5912071
227 2600363637 2600254931 Bacteria 6734225
228 2608383228 2606217733 Bacteria 6360972
229 2644147937 2643221626 Bacteria 8069654
230 2671771763 2671180172 Bacteria 6495783
231 2743740333 2740892503 Bacteria 6855563
232 2776915056 2775507049 Bacteria 6284736
233 2857569381 2857564685 Bacteria 6290584
234 2894513328 2894510363 Bacteria 5121143
235 2912964048 2912963787 Bacteria 5646108
236 2923159426 2923153595 Bacteria 6870622
237 2928965829 2928963466 Bacteria 5165703
238 2939655018 2939651529 Bacteria 5895393
239 2984286695 2984286254 Bacteria 6702062
240 2989393008 2989392574 Bacteria 4554005
241 3007399491 3007395558 Bacteria 6755444
242 640489909 640427133 Bacteria 4567418
243 651177989 651053060 Bacteria 4689946
244 8001526124 8001522603 Bacteria 4726425
245 8002746144 8002745576 Bacteria 4840272
246 8055883499 8055878733 Bacteria 5907058
247 8056163538 8056161164 Bacteria 6106669
248 8057163392 8057160832 Bacteria 3268302
249 Ga0495676_0030368
250 JGI25162J39368_1000032
251 JGI25154J39366_1001021
252 JGI25150J39212_1016626
253 JGI25153J46596_10022647
254 rootH1_10007337
255 Ga0055529_1000027
256 Ga0055530_10000266
257 Ga0070658_10084572
258 Ga0070683_100035207
259 Ga0068869_100161397
260 Ga0070680_100004498
261 Ga0068868_100115333
262 Ga0070667_100180645
263 Ga0070703_10085148
264 Ga0070681_10016068
265 Ga0070679_100014936
266 Ga0070679_100093629
267 Ga0070684_100370557
268 Ga0070664_100003250
269 Ga0068857_100065959
270 Ga0068856_100132497
271 Ga0068860_100507865
272 Ga0068862_100408926
273 Ga0075365_10001370
274 Ga0075365_10255362
275 Ga0075364_10000115
276 Ga0075364_10001204
277 Ga0075364_10042459
278 Ga0075367_10003785
279 Ga0075367_10134421
280 Ga0075369_10000063
281 Ga0097621_100116512
282 Ga0075370_10000036
283 Ga0068871_100024015
284 Ga0075431_100059063
285 Ga0075429_100039704
286 Ga0068865_100003484
287 Ga0105240_10130556
288 Ga0105241_10023728
289 Ga0105241_10095796
290 Ga0105242_10004319
291 Ga0105248_10052542
292 Ga0105238_10046245
293 Ga0105239_10010154
294 Ga0157373_10090487
295 Ga0157371_10053495
296 Ga0157370_10148168
297 Ga0163162_10048786
298 Ga0163163_10000404
299 Ga0157379_10332097
300 Ga0163161_10058829
301 Ga0163161_10521662
302 Ga0213872_10000137
303 Ga0213872_10007649
304 Ga0213872_10008830
305 Ga0213872_10025735
306 Ga0209566_101312
307 Ga0207425_1000212
308 Ga0209026_1001990
309 Ga0209026_1004905
310 Ga0209676_1000030
311 Ga0209025_1015521
312 Ga0209758_1000278
313 Ga0209050_1001646
314 Ga0209051_1000012
315 Ga0207680_10103050
316 Ga0207647_10022837
317 Ga0207707_10000812
318 Ga0207681_10480542
319 Ga0207706_10004745
320 Ga0207704_10031076
321 Ga0207689_10151081
322 Ga0207661_10094250
323 Ga0207703_10233029
324 Ga0207702_10290664
325 Ga0207674_10020799
326 Ga0209983_1000791
327 Ga0209971_1001807
328 Ga0314311_1085664
329 Ga0316183_1104512
330 Ga0265327_10001152
331 Ga0265327_10115928
332 Ga0307513_10116967
333 Ga0316575_10087099
334 Ga0265314_10015214
335 Ga0316577_10029433
336 Ga0307413_10246471
337 Ga0307518_10029228
338 Ga0307412_10098008
339 Ga0307414_10077592
340 Ga0316593_10089955
341 Ga0316574_0130144
342 Ga0316582_0046833
343 Ga0316584_0002341
344 Ga0316584_0046027
345 Ga0395899_0000085
346 Ga0400485_01072
347 Ga0400483_011190
348 Ga0400483_215675
349 Ga0400483_219863
350 Ga0400489_16599
351 Ga0436361_0200833
352 Ga0436361_0799736
353 Ga0436361_0852784
354 Ga0436361_0900144
355 Ga0436361_0937550
356 Ga0439466_0003738
357 Ga0439456_000100
358 Ga0439463_001963
359 Ga0439446_0000472
360 Ga0451577_0000162
361 Ga0466972_0000283
362 Ga0466961_0033067
363 Ga0453684_0000524
364 Ga0453684_0106726
365 Ga0466970_0065673
366 Ga0466957_0362318
367 Ga0451576_0001019
368 Ga0495617_000350
369 Ga0495627_000006
370 Ga0495638_0000229
371 Ga0495638_0012641
372 Ga0495638_0040263
373 Ga0495653_0002765
374 Ga0495650_0014950
375 Ga0495650_0043040
376 Ga0495580_0040444
377 Ga0495605_0002786
378 Ga0495584_0003945
379 Ga0495584_0008320
380 Ga0495585_0000113
381 Ga0495585_0027683
382 Ga0495585_0032632
383 Ga0495585_0033014
384 Ga0495596_0001864
385 Ga0495607_0066586
386 Ga0495583_0000063
387 Ga0495606_0000004
388 Ga0495606_0008748
389 Ga0495608_0017155
390 Ga0495610_0001271
391 Ga0495610_0081712
392 Ga0495616_0008419
393 Ga0495616_0012120
394 Ga0495616_0029543
395 Ga0495628_0000646
396 Ga0495632_0027982
397 Ga0495637_0018582
398 Ga0495644_0013949
399 Ga0495648_0004582
400 Ga0495648_0005730
401 Ga0495663_0015529
402 Ga0495652_0007251
403 Ga0495609_0000900
404 Ga0495609_0006643
405 Ga0495633_0013619
406 Ga0495656_0029747
407 Ga0495668_0001045
408 Ga0495611_0016611
409 Ga0495611_0032933
410 Ga0495611_0122137
411 Ga0495611_0132483
412 Ga0495661_0057614
413 Ga0495661_0072540
414 Ga0495588_0032629
415 Ga0495647_0013857
416 Ga0495669_0005936
417 Ga0495624_0131530
418 Ga0495670_0006062
419 Ga0495670_0007088
420 Ga0495671_0019047
421 Ga0495660_0000383
422 Ga0495660_0018409
423 Ga0495636_0000349
424 Ga0495672_0000005
425 Ga0495672_0004982
426 Ga0495672_0012998
427 Ga0495672_0023947
428 Ga0495683_0006176
429 Ga0495683_0009614
430 Ga0495683_0058388
431 Ga0495687_001201
432 Ga0495677_0011605
433 Ga0495677_0016463
434 Ga0495685_000337
435 Ga0495673_0007167
436 Ga0495681_0092889
437 Ga0495686_0006794
438 Ga0495686_0075045
439 Ga0496102_0309124
440 Ga0495678_001390
441 Ga0495678_001844
442 Ga0501033_0112274
443 Ga0501034_0000834
444 Ga0501034_0208143
445 Ga0501038_0282537
446 Ga0501043_0030383
447 Ga0501043_0112598
448 Ga0501047_0009312
449 Ga0501070_0000265
450 Ga0501070_0013742
451 Ga0501074_0219662
452 Ga0501035_0010740
453 Ga0501044_0548352
454 nmdc:mga00v17_1170_c1
455 nmdc:mga00v17_261_c1
456 nmdc:mga00v17_741_c1
457 nmdc:mga0yw44_229406_c1
458 nmdc:mga0yw44_962_c1
459 nmdc:mga06z11_509_c1
460 nmdc:mga07m45_27_c1
461 nmdc:mga09592_35945_c1
462 nmdc:mga0n895_93619_c1
463 nmdc:mga0sz30_18_c2
464 Ga0501082_0028450
465 Ga0530510_0269481
466 2511267731
467 2512326733
468 2554812762
469 2597860791
470 2599485973
471 2599804756
472 2599982982
473 2599988268
474 2599999062
475 2600363637
476 2608383228
477 2644147937
478 2671771763
479 2743740333
480 2776915056
481 2857569381
482 2894513328
483 2912964048
484 2923159426
485 2928965829
486 2939655018
487 2984286695
488 2989393008
489 3007399491
490 640489909
491 651177989
492 8001526124
493 8002746144
494 8055883499
495 8056163538
496 8057163392

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14748

P5CR_dimer

Pyrroline-5-carboxylate reductase dimerisation

187

215

0.95

PF14748

P5CR_dimer

Pyrroline-5-carboxylate reductase dimerisation

220

309

0.95

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

23

121

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ag8-assembly1.cif.gz_A nadp complex of pyrroline-5-carboxylate reductase from neisseria meningitidis 0.9379 5 271
2ag8-assembly1.cif.gz_A nadp complex of pyrroline-5-carboxylate reductase from neisseria meningitidis 0.931 5 271
3tri-assembly1.cif.gz_B structure of a pyrroline-5-carboxylate reductase (proc) from coxiella burnetii 0.9245 3 267
5bse-assembly1.cif.gz_A crystal structure of medicago truncatula (delta)1-pyrroline-5-carboxylate reductase (mtp5cr) 0.9192 1 267
5bsh-assembly1.cif.gz_D crystal structure of medicago truncatula (delta)1-pyrroline-5-carboxylate reductase (mtp5cr) in complex with l-proline 0.9173 1 267
ID Description Score Start End Superfamily
5uaxC02 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold;ProC C-terminal domain-like 0.9836 170 267 1.10.3730.10
5uaxB02 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold;ProC C-terminal domain-like 0.9834 170 267 1.10.3730.10
5uauC02 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold;ProC C-terminal domain-like 0.9815 170 270 1.10.3730.10
5uauB02 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold;ProC C-terminal domain-like 0.9814 170 270 1.10.3730.10
2izzE02 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold;ProC C-terminal domain-like 0.98 170 270 1.10.3730.10
ID Description Score Start End GO Terms
AF-A0A6U3X2C9-F1-model_v4 Pyrroline-5-carboxylate reductase dimerisation domain-containing protein 0.9866 169 268 GO:0003735
GO:0004735
GO:0005840
GO:0006412
GO:0055129
AF-A0A6L3N908-F1-model_v4 Pyrroline-5-carboxylate reductase 0.9829 5 144 GO:0004735
GO:0055129
AF-A0A3B9BAU3-F1-model_v4 Pyrroline-5-carboxylate reductase 0.9823 160 269 GO:0004735
GO:0055129
AF-A0A8A5VYR7-F1-model_v4 deleted 0.9792 151 274
AF-A0A536SV83-F1-model_v4 Pyrroline-5-carboxylate reductase (P5C reductase) (P5CR) (EC 1.5.1.2) (PCA reductase) 0.979 5 274 GO:0004735
GO:0005737
GO:0055129

Map