F360263

General Info

Members Datasets Scaffolds Average Seq Length
248 186 496 167

Family's Representative Sequence

Representative Sequence 3300049703|Ga0501219_008636|Ga0501219_008636_99_632
Length 177
Sequence MTTTDFSTTIIVDKTPKEVFDAINNVRGWWSEEVEGNTTSVKDVFDYPFEDIHRCKIEVTESIPGEKVAWLVKENYFKPGIFNDGAENENAFAGHTAEWVDTKIIFEISEKDGKTQMRFTHLGLVPDYECFEACSTGWTHYIGSSLRNLITTGKGQPNATGKPQTTEEKKLKAGDTA

Samples

Sample ID Description Type Environment
1 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
40 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
68 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
91 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
92 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
97 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
98 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
99 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
100 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
101 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
102 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
103 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
104 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
105 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
106 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
107 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
108 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
109 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
110 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
111 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
115 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
116 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
117 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
118 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
119 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
120 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
121 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
122 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
123 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
124 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
125 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
126 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
127 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
128 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
129 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
130 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
131 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
132 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
133 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
134 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
135 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
136 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
137 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
138 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
139 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
140 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
141 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
142 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
143 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
144 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
145 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
146 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
147 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
148 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
149 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
150 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
151 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
152 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
153 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
154 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
155 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
156 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
157 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
158 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
159 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
160 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
161 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
162 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
163 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
164 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
165 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
166 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
167 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
168 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
169 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
170 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
171 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
172 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
173 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
174 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
175 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
176 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
177 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
178 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
179 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
180 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
181 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
182 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
183 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
184 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
185 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
186 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.56
Metatranscriptomes 0
Isolates 4.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.06
Nodule 1.21
Rhizoplane 0.4
Rhizosphere 81.05
Stem 0
Stem Tuber 0
Unclassified 8.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501219_008636 3300049703 Bacteria 747
2 MBSR1b_contig_5905352 2162886012 Bacteria 942
3 JGI24736J21556_1013178 3300001904 Bacteria 1335
4 JGI24741J21665_1047071 3300001915 Bacteria 634
5 JGI24737J22298_10004525 3300001990 Unclassified 4837
6 JGI24735J21928_10005761 3300002067 Unclassified 4098
7 rootL2_10015274 3300003322 Bacteria 1577
8 rootL2_10097014 3300003322 Bacteria 4474
9 rootH1_10127425 3300003323 Bacteria 1439
10 rootH1_10379909 3300003323 Bacteria 2562
11 Ga0065165_1002139 3300005262 Bacteria 17921
12 Ga0068868_100061460 3300005338 Bacteria 2976
13 Ga0070660_100172555 3300005339 Bacteria 1747
14 Ga0070689_100096998 3300005340 Bacteria 2331
15 Ga0070669_100305178 3300005353 Unclassified 1281
16 Ga0070673_100064637 3300005364 Bacteria 2916
17 Ga0070688_100759788 3300005365 Unclassified 755
18 Ga0070659_100004697 3300005366 Bacteria 9753
19 Ga0070659_100019047 3300005366 Bacteria 5190
20 Ga0070667_100007006 3300005367 Bacteria 9371
21 Ga0070667_100136971 3300005367 Bacteria 2141
22 Ga0070663_101383152 3300005455 Unclassified 623
23 Ga0070662_100000098 3300005457 Bacteria 48044
24 Ga0070685_10187836 3300005466 Bacteria 1335
25 Ga0070685_11053089 3300005466 Bacteria 613
26 Ga0070698_100028406 3300005471 Bacteria 5809
27 Ga0070698_100322550 3300005471 Bacteria 1475
28 Ga0068853_100030061 3300005539 Bacteria 4586
29 Ga0068853_100338837 3300005539 Unclassified 1397
30 Ga0068853_101034278 3300005539 Bacteria 791
31 Ga0070665_100000104 3300005548 Bacteria 158048
32 Ga0068855_100313976 3300005563 Bacteria 1733
33 Ga0068855_100472290 3300005563 Bacteria 1366
34 Ga0068857_100057555 3300005577 Bacteria 3450
35 Ga0068859_100001069 3300005617 Bacteria 28045
36 Ga0068859_100012276 3300005617 Bacteria 8616
37 Ga0068859_100036286 3300005617 Bacteria 4949
38 Ga0068859_100925279 3300005617 Unclassified 956
39 Ga0068859_101134004 3300005617 Bacteria 860
40 Ga0068861_100002853 3300005719 Bacteria 11371
41 Ga0068870_10245260 3300005840 Bacteria 1108
42 Ga0068870_10535696 3300005840 Unclassified 786
43 Ga0068860_100002954 3300005843 Bacteria 17570
44 Ga0068860_100023756 3300005843 Bacteria 5926
45 Ga0068862_100283114 3300005844 Bacteria 1520
46 Ga0075366_10018099 3300006195 Bacteria 4068
47 Ga0097621_100073822 3300006237 Bacteria 2825
48 Ga0075370_10100777 3300006353 Unclassified 1671
49 Ga0075428_100446010 3300006844 Bacteria 1386
50 Ga0075431_100003373 3300006847 Bacteria 15485
51 Ga0075433_10165834 3300006852 Bacteria 1966
52 Ga0075434_100212614 3300006871 Bacteria 1954
53 Ga0097620_100001069 3300006931 Bacteria 28045
54 Ga0097620_100012276 3300006931 Bacteria 8616
55 Ga0097620_100036286 3300006931 Bacteria 4949
56 Ga0097620_100925136 3300006931 Unclassified 956
57 Ga0097620_101134052 3300006931 Bacteria 860
58 Ga0099826_10011055 3300006948 Bacteria 6786
59 Ga0099794_10253685 3300007265 Bacteria 907
60 Ga0105240_10002097 3300009093 Bacteria 32623
61 Ga0105240_10032239 3300009093 Bacteria 6786
62 Ga0105240_10036432 3300009093 Bacteria 6328
63 Ga0105247_10024043 3300009101 Bacteria 3669
64 Ga0114129_10068455 3300009147 Bacteria 4950
65 Ga0105241_10198845 3300009174 Bacteria 1673
66 Ga0105242_11627986 3300009176 Bacteria 680
67 Ga0105237_10100354 3300009545 Unclassified 2886
68 Ga0105237_10227975 3300009545 Bacteria 1864
69 Ga0105237_10404470 3300009545 Bacteria 1370
70 Ga0105238_10737770 3300009551 Bacteria 998
71 Ga0105249_10002248 3300009553 Bacteria 16764
72 Ga0105249_10003003 3300009553 Bacteria 14553
73 Ga0105249_10023569 3300009553 Bacteria 5524
74 Ga0105249_10636569 3300009553 Bacteria 1123
75 Ga0099796_10066550 3300010159 Bacteria 1291
76 Ga0105239_10019224 3300010375 Bacteria 7547
77 Ga0105239_10283977 3300010375 Bacteria 1864
78 Ga0105246_10067344 3300011119 Bacteria 2509
79 Ga0105246_10118162 3300011119 Bacteria 1960
80 Ga0157373_10000464 3300013100 Bacteria 32220
81 Ga0157373_10014812 3300013100 Bacteria 5713
82 Ga0157371_10000749 3300013102 Bacteria 37566
83 Ga0157370_10043381 3300013104 Bacteria 4329
84 Ga0157370_10050865 3300013104 Bacteria 3959
85 Ga0157370_10749719 3300013104 Bacteria 890
86 Ga0157369_10054816 3300013105 Bacteria 4304
87 Ga0157369_10136256 3300013105 Bacteria 2599
88 Ga0157374_10000103 3300013296 Bacteria 78532
89 Ga0157374_10424525 3300013296 Bacteria 1328
90 Ga0157378_10021296 3300013297 Bacteria 5700
91 Ga0163162_10000034 3300013306 Bacteria 149611
92 Ga0163162_10021216 3300013306 Bacteria 6392
93 Ga0163162_10185271 3300013306 Bacteria 2209
94 Ga0157372_10001047 3300013307 Bacteria 30262
95 Ga0157372_10031373 3300013307 Bacteria 5819
96 Ga0157375_10058496 3300013308 Bacteria 3814
97 Ga0157375_10173058 3300013308 Bacteria 2308
98 Ga0163163_10222044 3300014325 Bacteria 1938
99 Ga0157380_10331351 3300014326 Bacteria 1416
100 Ga0157380_10630300 3300014326 Bacteria 1066
101 Ga0157380_11635855 3300014326 Bacteria 700
102 Ga0157377_10078857 3300014745 Bacteria 1920
103 Ga0157376_10087097 3300014969 Bacteria 2694
104 Ga0157376_11169877 3300014969 Bacteria 797
105 Ga0182007_10160412 3300015262 Bacteria 769
106 Ga0163161_10000043 3300017792 Bacteria 135014
107 Ga0209233_1003943 3300025261 Bacteria 5145
108 Ga0209676_1001343 3300025292 Bacteria 24617
109 Ga0207710_10042627 3300025900 Bacteria 2016
110 Ga0207647_10000043 3300025904 Bacteria 91109
111 Ga0207647_10000143 3300025904 Bacteria 57163
112 Ga0207705_10745612 3300025909 Archaea 761
113 Ga0207654_10009835 3300025911 Bacteria 4863
114 Ga0207654_10028859 3300025911 Bacteria 3029
115 Ga0207695_10003033 3300025913 Bacteria 24099
116 Ga0207695_10004995 3300025913 Bacteria 17830
117 Ga0207671_10415412 3300025914 Bacteria 1070
118 Ga0207671_10641631 3300025914 Bacteria 846
119 Ga0207662_10207394 3300025918 Unclassified 1271
120 Ga0207657_10172725 3300025919 Bacteria 1750
121 Ga0207650_11319365 3300025925 Bacteria 614
122 Ga0207690_10014429 3300025932 Bacteria 4773
123 Ga0207690_10015678 3300025932 Bacteria 4598
124 Ga0207706_10000376 3300025933 Bacteria 48542
125 Ga0207670_10032903 3300025936 Bacteria 3338
126 Ga0207667_10003172 3300025949 Bacteria 20335
127 Ga0207667_10829134 3300025949 Bacteria 920
128 Ga0207712_10006020 3300025961 Bacteria 7653
129 Ga0207712_10006518 3300025961 Bacteria 7364
130 Ga0207712_10015521 3300025961 Bacteria 4916
131 Ga0207658_10021506 3300025986 Bacteria 4480
132 Ga0207658_10113692 3300025986 Bacteria 2145
133 Ga0207658_10733969 3300025986 Bacteria 894
134 Ga0207677_10052319 3300026023 Unclassified 2774
135 Ga0207677_10060020 3300026023 Bacteria 2627
136 Ga0207639_10015016 3300026041 Bacteria 5455
137 Ga0207639_10178285 3300026041 Bacteria 1805
138 Ga0207674_10070099 3300026116 Bacteria 3524
139 Ga0207675_100004349 3300026118 Bacteria 13692
140 Ga0207683_11308073 3300026121 Bacteria 671
141 Ga0207698_10979903 3300026142 Bacteria 855
142 Ga0207698_12299702 3300026142 Bacteria 551
143 Ga0209489_114058 3300027361 Bacteria 5929
144 Ga0209282_1011751 3300027666 Bacteria 5561
145 Ga0209588_1067518 3300027671 Bacteria 1155
146 Ga0268266_10000108 3300028379 Bacteria 171915
147 Ga0268265_10248846 3300028380 Bacteria 1573
148 Ga0268264_10004612 3300028381 Bacteria 11712
149 Ga0268264_10021434 3300028381 Bacteria 5276
150 Ga0307515_10409439 3300028794 Bacteria 979
151 Ga0307513_10070980 3300031456 Bacteria 3637
152 Ga0307509_10047575 3300031507 Bacteria 4613
153 Ga0307509_10060190 3300031507 Bacteria 4015
154 Ga0307509_10601775 3300031507 Bacteria 772
155 Ga0307408_100001733 3300031548 Bacteria 15956
156 Ga0307408_100047545 3300031548 Unclassified 3073
157 Ga0307508_10241723 3300031616 Bacteria 1403
158 Ga0307405_10150915 3300031731 Bacteria 1634
159 Ga0307413_10000188 3300031824 Bacteria 17709
160 Ga0307410_10000018 3300031852 Bacteria 69156
161 Ga0307406_10000422 3300031901 Bacteria 24633
162 Ga0307414_10217388 3300032004 Bacteria 1566
163 Ga0307414_10415477 3300032004 Bacteria 1172
164 Ga0307414_10916894 3300032004 Bacteria 804
165 Ga0307411_10823153 3300032005 Bacteria 819
166 Ga0307507_10000152 3300033179 Bacteria 122095
167 Ga0373935_1147934 3300035692 Bacteria 579
168 Ga0373927_0441995 3300035695 Bacteria 859
169 Ga0373933_0328763 3300035724 Bacteria 992
170 Ga0373925_0193247 3300037068 Bacteria 1616
171 Ga0395899_0009889 3300037312 Bacteria 7313
172 Ga0395900_0509589 3300037418 Bacteria 1152
173 Ga0395905_0021856 3300037471 Bacteria 6051
174 Ga0395901_0000271 3300038443 Bacteria 64591
175 Ga0439439_0018849 3300041406 Bacteria 1708
176 Ga0451793_1885655 3300041452 Bacteria 686
177 Ga0451837_0576820 3300041494 Bacteria 678
178 Ga0451843_0682662 3300041509 Bacteria 957
179 Ga0451843_1281317 3300041509 Bacteria 1156
180 Ga0439431_0122334 3300041997 Bacteria 726
181 Ga0439432_033799 3300042006 Bacteria 1644
182 Ga0439457_020867 3300042014 Bacteria 1453
183 Ga0450923_075769 3300042125 Bacteria 751
184 Ga0450897_016753 3300042128 Unclassified 758
185 Ga0450899_003751 3300042135 Bacteria 1634
186 Ga0450893_0042742 3300042532 Unclassified 834
187 Ga0495638_0000121 3300046460 Bacteria 126440
188 Ga0495651_0073731 3300046462 Bacteria 2591
189 Ga0495650_0025568 3300046471 Bacteria 2764
190 Ga0495580_0080480 3300046472 Bacteria 2271
191 Ga0495662_0168322 3300046476 Bacteria 1080
192 Ga0495585_0004805 3300046492 Bacteria 8682
193 Ga0495583_0239845 3300046506 Bacteria 729
194 Ga0495631_0292672 3300046518 Bacteria 693
195 Ga0495652_0528870 3300046529 Bacteria 814
196 Ga0495654_0050799 3300046530 Bacteria 2025
197 Ga0495665_0034373 3300046531 Bacteria 2711
198 Ga0495587_0098798 3300046536 Bacteria 1683
199 Ga0495609_0005261 3300046538 Bacteria 6867
200 Ga0495668_0001354 3300046616 Bacteria 24058
201 Ga0495625_0002738 3300046660 Bacteria 18671
202 Ga0495625_0037512 3300046660 Bacteria 3556
203 Ga0495661_0078407 3300046665 Bacteria 1911
204 Ga0495588_0489054 3300046674 Bacteria 645
205 Ga0495647_0044622 3300046681 Bacteria 1701
206 Ga0495658_0426839 3300046683 Bacteria 846
207 Ga0495600_0519292 3300046809 Bacteria 730
208 Ga0495660_0100590 3300046810 Bacteria 1489
209 Ga0495660_0368097 3300046810 Bacteria 636
210 Ga0495636_0529250 3300047318 Bacteria 572
211 Ga0495614_0003726 3300048089 Bacteria 6846
212 Ga0496121_0110719 3300048924 Bacteria 2095
213 Ga0496124_0017767 3300048927 Bacteria 6688
214 Ga0501207_062644 3300049654 Bacteria 685
215 Ga0501257_005393 3300049686 Unclassified 2817
216 Ga0501241_011512 3300049758 Bacteria 1606
217 Ga0501264_000876 3300049761 Bacteria 3853
218 Ga0501280_000847 3300049776 Bacteria 6611
219 nmdc:mga03683_262021_c1 3300050489 Bacteria 805
220 nmdc:mga0k408_474_c1 3300050493 Bacteria 21998
221 nmdc:mga05p37_1640516_c1 3300050507 Unclassified 631
222 nmdc:mga06r32_1050_c1 3300050510 Bacteria 24930
223 nmdc:mga0n895_139506_c1 3300050512 Bacteria 2452
224 nmdc:mga0a205_83501_c1 3300050515 Bacteria 3085
225 Ga0500646_0002409 3300053090 Bacteria 4857
226 Ga0500583_0000293 3300053092 Bacteria 17297
227 Ga0500651_0530104 3300053093 Unclassified 646
228 Ga0500562_000006 3300053108 Bacteria 249231
229 Ga0500569_000067 3300053109 Bacteria 17251
230 Ga0500594_0011696 3300053118 Unclassified 2053
231 Ga0500607_110662 3300053121 Bacteria 1347
232 Ga0500658_0002431 3300053134 Bacteria 7198
233 Ga0500577_0000667 3300053142 Bacteria 8787
234 Ga0500616_0005551 3300053153 Bacteria 8539
235 Ga0500633_0069078 3300053160 Bacteria 1258
236 Ga0500636_0074824 3300053177 Bacteria 1960
237 Ga0500645_170550 3300053730 Bacteria 594
238 2513234276 2513020052 Bacteria 5120511
239 2644640390 2643221716 Bacteria 4986332
240 2738733499 2738541279 Bacteria 6149495
241 2738766037 2738541285 Bacteria 6150075
242 2739215080 2738543007 Bacteria 6149845
243 2857616067 2857613821 Bacteria 4917088
244 2857620172 2857618242 Bacteria 5635925
245 2903898104 2903895155 Bacteria 5258610
246 2904422257 2904419702 Bacteria 5166287
247 2929154467 2929150217 Bacteria 5462483
248 8056441060 8056440228 Bacteria 4946504
249 Ga0501219_008636
250 MBSR1b_contig_5905352
251 JGI24736J21556_1013178
252 JGI24741J21665_1047071
253 JGI24737J22298_10004525
254 JGI24735J21928_10005761
255 rootL2_10015274
256 rootL2_10097014
257 rootH1_10127425
258 rootH1_10379909
259 Ga0065165_1002139
260 Ga0068868_100061460
261 Ga0070660_100172555
262 Ga0070689_100096998
263 Ga0070669_100305178
264 Ga0070673_100064637
265 Ga0070688_100759788
266 Ga0070659_100004697
267 Ga0070659_100019047
268 Ga0070667_100007006
269 Ga0070667_100136971
270 Ga0070663_101383152
271 Ga0070662_100000098
272 Ga0070685_10187836
273 Ga0070685_11053089
274 Ga0070698_100028406
275 Ga0070698_100322550
276 Ga0068853_100030061
277 Ga0068853_100338837
278 Ga0068853_101034278
279 Ga0070665_100000104
280 Ga0068855_100313976
281 Ga0068855_100472290
282 Ga0068857_100057555
283 Ga0068859_100001069
284 Ga0068859_100012276
285 Ga0068859_100036286
286 Ga0068859_100925279
287 Ga0068859_101134004
288 Ga0068861_100002853
289 Ga0068870_10245260
290 Ga0068870_10535696
291 Ga0068860_100002954
292 Ga0068860_100023756
293 Ga0068862_100283114
294 Ga0075366_10018099
295 Ga0097621_100073822
296 Ga0075370_10100777
297 Ga0075428_100446010
298 Ga0075431_100003373
299 Ga0075433_10165834
300 Ga0075434_100212614
301 Ga0097620_100001069
302 Ga0097620_100012276
303 Ga0097620_100036286
304 Ga0097620_100925136
305 Ga0097620_101134052
306 Ga0099826_10011055
307 Ga0099794_10253685
308 Ga0105240_10002097
309 Ga0105240_10032239
310 Ga0105240_10036432
311 Ga0105247_10024043
312 Ga0114129_10068455
313 Ga0105241_10198845
314 Ga0105242_11627986
315 Ga0105237_10100354
316 Ga0105237_10227975
317 Ga0105237_10404470
318 Ga0105238_10737770
319 Ga0105249_10002248
320 Ga0105249_10003003
321 Ga0105249_10023569
322 Ga0105249_10636569
323 Ga0099796_10066550
324 Ga0105239_10019224
325 Ga0105239_10283977
326 Ga0105246_10067344
327 Ga0105246_10118162
328 Ga0157373_10000464
329 Ga0157373_10014812
330 Ga0157371_10000749
331 Ga0157370_10043381
332 Ga0157370_10050865
333 Ga0157370_10749719
334 Ga0157369_10054816
335 Ga0157369_10136256
336 Ga0157374_10000103
337 Ga0157374_10424525
338 Ga0157378_10021296
339 Ga0163162_10000034
340 Ga0163162_10021216
341 Ga0163162_10185271
342 Ga0157372_10001047
343 Ga0157372_10031373
344 Ga0157375_10058496
345 Ga0157375_10173058
346 Ga0163163_10222044
347 Ga0157380_10331351
348 Ga0157380_10630300
349 Ga0157380_11635855
350 Ga0157377_10078857
351 Ga0157376_10087097
352 Ga0157376_11169877
353 Ga0182007_10160412
354 Ga0163161_10000043
355 Ga0209233_1003943
356 Ga0209676_1001343
357 Ga0207710_10042627
358 Ga0207647_10000043
359 Ga0207647_10000143
360 Ga0207705_10745612
361 Ga0207654_10009835
362 Ga0207654_10028859
363 Ga0207695_10003033
364 Ga0207695_10004995
365 Ga0207671_10415412
366 Ga0207671_10641631
367 Ga0207662_10207394
368 Ga0207657_10172725
369 Ga0207650_11319365
370 Ga0207690_10014429
371 Ga0207690_10015678
372 Ga0207706_10000376
373 Ga0207670_10032903
374 Ga0207667_10003172
375 Ga0207667_10829134
376 Ga0207712_10006020
377 Ga0207712_10006518
378 Ga0207712_10015521
379 Ga0207658_10021506
380 Ga0207658_10113692
381 Ga0207658_10733969
382 Ga0207677_10052319
383 Ga0207677_10060020
384 Ga0207639_10015016
385 Ga0207639_10178285
386 Ga0207674_10070099
387 Ga0207675_100004349
388 Ga0207683_11308073
389 Ga0207698_10979903
390 Ga0207698_12299702
391 Ga0209489_114058
392 Ga0209282_1011751
393 Ga0209588_1067518
394 Ga0268266_10000108
395 Ga0268265_10248846
396 Ga0268264_10004612
397 Ga0268264_10021434
398 Ga0307515_10409439
399 Ga0307513_10070980
400 Ga0307509_10047575
401 Ga0307509_10060190
402 Ga0307509_10601775
403 Ga0307408_100001733
404 Ga0307408_100047545
405 Ga0307508_10241723
406 Ga0307405_10150915
407 Ga0307413_10000188
408 Ga0307410_10000018
409 Ga0307406_10000422
410 Ga0307414_10217388
411 Ga0307414_10415477
412 Ga0307414_10916894
413 Ga0307411_10823153
414 Ga0307507_10000152
415 Ga0373935_1147934
416 Ga0373927_0441995
417 Ga0373933_0328763
418 Ga0373925_0193247
419 Ga0395899_0009889
420 Ga0395900_0509589
421 Ga0395905_0021856
422 Ga0395901_0000271
423 Ga0439439_0018849
424 Ga0451793_1885655
425 Ga0451837_0576820
426 Ga0451843_0682662
427 Ga0451843_1281317
428 Ga0439431_0122334
429 Ga0439432_033799
430 Ga0439457_020867
431 Ga0450923_075769
432 Ga0450897_016753
433 Ga0450899_003751
434 Ga0450893_0042742
435 Ga0495638_0000121
436 Ga0495651_0073731
437 Ga0495650_0025568
438 Ga0495580_0080480
439 Ga0495662_0168322
440 Ga0495585_0004805
441 Ga0495583_0239845
442 Ga0495631_0292672
443 Ga0495652_0528870
444 Ga0495654_0050799
445 Ga0495665_0034373
446 Ga0495587_0098798
447 Ga0495609_0005261
448 Ga0495668_0001354
449 Ga0495625_0002738
450 Ga0495625_0037512
451 Ga0495661_0078407
452 Ga0495588_0489054
453 Ga0495647_0044622
454 Ga0495658_0426839
455 Ga0495600_0519292
456 Ga0495660_0100590
457 Ga0495660_0368097
458 Ga0495636_0529250
459 Ga0495614_0003726
460 Ga0496121_0110719
461 Ga0496124_0017767
462 Ga0501207_062644
463 Ga0501257_005393
464 Ga0501241_011512
465 Ga0501264_000876
466 Ga0501280_000847
467 nmdc:mga03683_262021_c1
468 nmdc:mga0k408_474_c1
469 nmdc:mga05p37_1640516_c1
470 nmdc:mga06r32_1050_c1
471 nmdc:mga0n895_139506_c1
472 nmdc:mga0a205_83501_c1
473 Ga0500646_0002409
474 Ga0500583_0000293
475 Ga0500651_0530104
476 Ga0500562_000006
477 Ga0500569_000067
478 Ga0500594_0011696
479 Ga0500607_110662
480 Ga0500658_0002431
481 Ga0500577_0000667
482 Ga0500616_0005551
483 Ga0500633_0069078
484 Ga0500636_0074824
485 Ga0500645_170550
486 2513234276
487 2644640390
488 2738733499
489 2738766037
490 2739215080
491 2857616067
492 2857620172
493 2903898104
494 2904422257
495 2929154467
496 8056441060

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2m89-assembly1.cif.gz_B solution structure of the aha1 dimer from colwellia psychrerythraea 0.8244 6 143
6pu2-assembly2.cif.gz_B dark, mutant h275t , 100k, pcm myxobacterial phytochrome, p2 0.8241 91 107
6ptx-assembly1.cif.gz_A dark, 100k, pcm myxobacterial phytochrome, p2, wild type, 0.8162 91 107
2m89-assembly1.cif.gz_B solution structure of the aha1 dimer from colwellia psychrerythraea 0.8077 6 143
3q63-assembly2.cif.gz_D x-ray crystal structure of protein mll2253 from mesorhizobium loti, northeast structural genomics consortium target mlr404. 0.7961 6 131
ID Description Score Start End Superfamily
2m89B00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8244 6 143 3.30.530.20
2m89B00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8077 6 143 3.30.530.20
af_O53773_104_241_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7957 7 146 3.30.530.20
4fpwA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.789 6 140 3.30.530.20
af_Q93168_208_339_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7808 6 131 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A6V6YFU6-F1-model_v4 deleted 1.003 6 161
AF-A0A3N1AZ77-F1-model_v4 Activator of Hsp90 ATPase-like protein 0.9975 6 162
AF-A0A4Q3U3C6-F1-model_v4 deleted 0.997 6 159
AF-A0A1G7S9Q2-F1-model_v4 Activator of Hsp90 ATPase homolog 1-like protein 0.9949 6 148
AF-A0A4Q3HGQ5-F1-model_v4 deleted 0.9949 6 145

Map