F360304

General Info

Members Datasets Scaffolds Average Seq Length
248 174 496 220

Family's Representative Sequence

Representative Sequence 3300053730|Ga0500645_020671|Ga0500645_020671_1244_1942
Length 232
Sequence MIENSALKLNTMKNATGSLRKLFLLAALTGSLTAAMAQEQQTTTETSLQPKIGIRGGINLSNLYVDDVKDENMKVGVNVGVFAKFPITKGFSIQPEVNYSSKGAKLTYDNIFGDGEYRFNLNYVEVPLLAVVNLGKNFNIHAGPYAAFLTSANIKRLDNESGEVDDIADLDADNFKRFDFGLVGGLGFDIQNFTIGARYNYGLNEIGDGGIAGEATKNSKNSAFTFYIGIGF

Samples

Sample ID Description Type Environment
1 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
2 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
67 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
71 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
109 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
110 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
111 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
112 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
113 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
114 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
115 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
116 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
117 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
118 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
119 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
120 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
121 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
122 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
123 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
124 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
125 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
126 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
127 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
128 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
129 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
130 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
131 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
132 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
133 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
134 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
135 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
136 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
137 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
138 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
139 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
140 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
141 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
142 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
143 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
146 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
149 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
150 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
151 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
152 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
153 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
154 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
155 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
156 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
157 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
158 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
159 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
160 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
161 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
162 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
163 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
164 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
165 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
166 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
167 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
168 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
169 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
170 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
171 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
172 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
173 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
174 2738541278 Niastella sp. CF465 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.56
Metatranscriptomes 4.03
Isolates 0.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.06
Nodule 0
Rhizoplane 1.21
Rhizosphere 80.24
Stem 0
Stem Tuber 0
Unclassified 15.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500645_020671 3300053730 Bacteria 2038
2 Ga0006777J48905_1028183 3300003308 Bacteria 770
3 rootH1_10002948 3300003316 Bacteria 59617
4 rootH1_10013446 3300003316 Bacteria 10023
5 rootH1_10020107 3300003316 Bacteria 7907
6 rootH1_10055612 3300003316 Bacteria 1453
7 rootH2_10038793 3300003320 Bacteria 23005
8 rootH2_10154567 3300003320 Bacteria 8794
9 rootL2_10065535 3300003322 Bacteria 16016
10 rootL2_10084436 3300003322 Unclassified 2739
11 rootL2_10216341 3300003322 Bacteria 6272
12 rootH1_10003164 3300003323 Bacteria 93415
13 rootH1_10068367 3300003323 Bacteria 5002
14 rootH1_10124439 3300003323 Bacteria 6275
15 rootH1_10157093 3300003323 Bacteria 1482
16 rootH1_10201866 3300003323 Unclassified 4225
17 Ga0032354_1020528 3300003693 Unclassified 1872
18 Ga0058862_12651262 3300004803 Bacteria 1382
19 Ga0070676_10005198 3300005328 Bacteria 6915
20 Ga0070666_10000265 3300005335 Bacteria 34771
21 Ga0070682_100010815 3300005337 Bacteria 5192
22 Ga0068868_100019538 3300005338 Bacteria 5077
23 Ga0070691_10011573 3300005341 Bacteria 4031
24 Ga0070668_100000036 3300005347 Bacteria 81256
25 Ga0070675_100255562 3300005354 Bacteria 1534
26 Ga0070675_100401854 3300005354 Unclassified 1222
27 Ga0070673_100000803 3300005364 Bacteria 17538
28 Ga0070667_100000151 3300005367 Bacteria 86629
29 Ga0070667_100913921 3300005367 Unclassified 817
30 Ga0070663_100397152 3300005455 Bacteria 1126
31 Ga0070678_100889955 3300005456 Bacteria 813
32 Ga0070662_100002810 3300005457 Bacteria 10791
33 Ga0070681_10004505 3300005458 Bacteria 13289
34 Ga0068867_100002246 3300005459 Bacteria 13578
35 Ga0070679_100058952 3300005530 Bacteria 3826
36 Ga0068853_100021915 3300005539 Bacteria 5329
37 Ga0068853_100099462 3300005539 Unclassified 2569
38 Ga0070672_100000481 3300005543 Bacteria 23169
39 Ga0070693_100151067 3300005547 Unclassified 1471
40 Ga0070665_100001651 3300005548 Bacteria 25701
41 Ga0068855_100121650 3300005563 Bacteria 2987
42 Ga0068855_100181771 3300005563 Bacteria 2377
43 Ga0068854_100069020 3300005578 Unclassified 2579
44 Ga0068854_100371994 3300005578 Bacteria 1175
45 Ga0068856_100010399 3300005614 Bacteria 9037
46 Ga0068856_100050870 3300005614 Unclassified 4086
47 Ga0068856_100186565 3300005614 Bacteria 2088
48 Ga0068852_100036766 3300005616 Bacteria 4101
49 Ga0068864_100019628 3300005618 Bacteria 5654
50 Ga0068861_100359301 3300005719 Bacteria 1280
51 Ga0068851_10003720 3300005834 Bacteria 6811
52 Ga0068863_100004069 3300005841 Bacteria 14440
53 Ga0068858_100000760 3300005842 Bacteria 33815
54 Ga0068860_100002392 3300005843 Bacteria 19698
55 Ga0068862_100857625 3300005844 Bacteria 890
56 Ga0075366_10026081 3300006195 Unclassified 3421
57 Ga0097621_100003739 3300006237 Bacteria 10543
58 Ga0097621_100009281 3300006237 Bacteria 7138
59 Ga0068871_100001303 3300006358 Bacteria 16691
60 Ga0068871_100035863 3300006358 Unclassified 3944
61 Ga0068871_100313840 3300006358 Bacteria 1379
62 Ga0105240_10007119 3300009093 Bacteria 16295
63 Ga0105240_10060507 3300009093 Bacteria 4722
64 Ga0105240_10158485 3300009093 Unclassified 2690
65 Ga0105245_10039187 3300009098 Bacteria 4217
66 Ga0114129_10004171 3300009147 Bacteria 20411
67 Ga0105243_10100376 3300009148 Bacteria 2401
68 Ga0105241_10007589 3300009174 Bacteria 7976
69 Ga0105241_10017541 3300009174 Bacteria 5263
70 Ga0105241_10053873 3300009174 Bacteria 3078
71 Ga0105241_10091697 3300009174 Bacteria 2398
72 Ga0105241_10431494 3300009174 Bacteria 1162
73 Ga0105242_10070894 3300009176 Bacteria 2890
74 Ga0105237_10180700 3300009545 Bacteria 2110
75 Ga0105237_10189007 3300009545 Bacteria 2060
76 Ga0105237_10552343 3300009545 Bacteria 1158
77 Ga0105238_10008640 3300009551 Bacteria 10192
78 Ga0105238_10008647 3300009551 Bacteria 10188
79 Ga0105249_10000514 3300009553 Bacteria 35783
80 Ga0105239_10000746 3300010375 Bacteria 46202
81 Ga0105239_10015520 3300010375 Bacteria 8435
82 Ga0105239_10329408 3300010375 Bacteria 1722
83 Ga0105239_11179536 3300010375 Unclassified 882
84 Ga0105239_11458434 3300010375 Unclassified 790
85 Ga0105246_10392003 3300011119 Bacteria 1151
86 Ga0157371_10048151 3300013102 Unclassified 3030
87 Ga0157371_10187349 3300013102 Bacteria 1481
88 Ga0157370_10017363 3300013104 Bacteria 7263
89 Ga0157370_10035168 3300013104 Bacteria 4872
90 Ga0157369_10010939 3300013105 Bacteria 10330
91 Ga0157369_10862975 3300013105 Bacteria 929
92 Ga0157374_10000153 3300013296 Bacteria 63211
93 Ga0157374_10019653 3300013296 Bacteria 5981
94 Ga0157374_10276287 3300013296 Bacteria 1658
95 Ga0157374_11313136 3300013296 Bacteria 745
96 Ga0157378_10002091 3300013297 Bacteria 17834
97 Ga0163162_10000040 3300013306 Bacteria 133855
98 Ga0163162_10024785 3300013306 Bacteria 5926
99 Ga0163162_10100918 3300013306 Unclassified 2977
100 Ga0163162_10120381 3300013306 Bacteria 2729
101 Ga0157372_10001557 3300013307 Bacteria 24967
102 Ga0157372_10174643 3300013307 Bacteria 2487
103 Ga0157372_11088870 3300013307 Bacteria 924
104 Ga0157375_10000407 3300013308 Bacteria 39103
105 Ga0157380_10793678 3300014326 Unclassified 963
106 Ga0157379_10000173 3300014968 Bacteria 48672
107 Ga0157379_10125354 3300014968 Bacteria 2311
108 Ga0157376_10000278 3300014969 Bacteria 34737
109 Ga0157376_10069139 3300014969 Unclassified 2993
110 Ga0157376_10070092 3300014969 Unclassified 2974
111 Ga0157376_10133153 3300014969 Bacteria 2221
112 Ga0157376_10232637 3300014969 Bacteria 1713
113 Ga0163161_10026301 3300017792 Bacteria 4122
114 Ga0163161_10323923 3300017792 Unclassified 1219
115 Ga0197907_11090403 3300020069 Bacteria 699
116 Ga0206355_1099252 3300020076 Bacteria 708
117 Ga0206351_10734328 3300020077 Bacteria 709
118 Ga0206352_10383259 3300020078 Unclassified 804
119 Ga0206353_10547220 3300020082 Bacteria 706
120 Ga0209646_1004246 3300025246 Bacteria 2639
121 Ga0207656_10004384 3300025321 Unclassified 4924
122 Ga0207680_10000508 3300025903 Bacteria 18576
123 Ga0207647_10031998 3300025904 Bacteria 3383
124 Ga0207645_10009004 3300025907 Bacteria 6929
125 Ga0207705_10220605 3300025909 Bacteria 1440
126 Ga0207654_10007644 3300025911 Bacteria 5451
127 Ga0207654_10351281 3300025911 Bacteria 1015
128 Ga0207707_10008228 3300025912 Bacteria 9054
129 Ga0207707_10079400 3300025912 Unclassified 2865
130 Ga0207695_10026860 3300025913 Bacteria 6419
131 Ga0207695_10049180 3300025913 Bacteria 4446
132 Ga0207671_10006526 3300025914 Bacteria 10369
133 Ga0207671_10101601 3300025914 Bacteria 2179
134 Ga0207660_10039530 3300025917 Bacteria 3298
135 Ga0207652_10027439 3300025921 Bacteria 4745
136 Ga0207694_10006125 3300025924 Bacteria 9192
137 Ga0207694_10173953 3300025924 Unclassified 1744
138 Ga0207659_10229476 3300025926 Bacteria 1497
139 Ga0207687_10704319 3300025927 Bacteria 857
140 Ga0207690_10364926 3300025932 Bacteria 1145
141 Ga0207706_10006547 3300025933 Bacteria 10791
142 Ga0207709_10081997 3300025935 Bacteria 2081
143 Ga0207704_10006448 3300025938 Bacteria 5477
144 Ga0207691_10000067 3300025940 Bacteria 84512
145 Ga0207691_10133226 3300025940 Bacteria 2194
146 Ga0207667_10000519 3300025949 Bacteria 50770
147 Ga0207667_10097466 3300025949 Bacteria 3035
148 Ga0207667_10152648 3300025949 Bacteria 2377
149 Ga0207651_10000309 3300025960 Bacteria 20977
150 Ga0207712_10002122 3300025961 Bacteria 12960
151 Ga0207668_10000274 3300025972 Bacteria 34337
152 Ga0207640_10014596 3300025981 Unclassified 4526
153 Ga0207658_10000225 3300025986 Bacteria 59285
154 Ga0207677_10011296 3300026023 Bacteria 5085
155 Ga0207703_10002889 3300026035 Bacteria 14629
156 Ga0207639_10006238 3300026041 Bacteria 8100
157 Ga0207639_10357852 3300026041 Bacteria 1305
158 Ga0207678_10385622 3300026067 Bacteria 1212
159 Ga0207702_10009820 3300026078 Bacteria 8024
160 Ga0207702_10033918 3300026078 Bacteria 4265
161 Ga0207702_10081036 3300026078 Bacteria 2818
162 Ga0207641_10034682 3300026088 Bacteria 4199
163 Ga0207648_10002613 3300026089 Bacteria 19296
164 Ga0207676_10004694 3300026095 Bacteria 9680
165 Ga0207698_10647822 3300026142 Bacteria 1046
166 Ga0268266_10028165 3300028379 Bacteria 4776
167 Ga0268265_10930061 3300028380 Bacteria 855
168 Ga0268264_10015647 3300028381 Bacteria 6211
169 Ga0307513_10029028 3300031456 Bacteria 6314
170 Ga0307513_10180370 3300031456 Unclassified 1976
171 Ga0307513_10261043 3300031456 Bacteria 1522
172 Ga0307509_10035663 3300031507 Bacteria 5457
173 Ga0307509_10112572 3300031507 Bacteria 2721
174 Ga0307508_10001107 3300031616 Bacteria 31214
175 Ga0307516_10179512 3300031730 Bacteria 1851
176 Ga0373931_0337152 3300035691 Bacteria 941
177 Ga0373935_0159638 3300035692 Bacteria 1536
178 Ga0373933_0227705 3300035724 Unclassified 1197
179 Ga0373925_0104750 3300037068 Bacteria 2179
180 Ga0439439_0000381 3300041406 Bacteria 7295
181 Ga0451791_1935389 3300041451 Bacteria 1305
182 Ga0451798_0772835 3300041458 Unclassified 1302
183 Ga0451841_1381834 3300041498 Unclassified 801
184 Ga0451853_0967589 3300041512 Unclassified 1185
185 Ga0439449_0001255 3300042007 Bacteria 9955
186 Ga0439457_004018 3300042014 Bacteria 3903
187 Ga0439462_0000035 3300042015 Bacteria 19556
188 Ga0466969_0000201 3300044656 Bacteria 32555
189 Ga0466972_0000075 3300044658 Bacteria 94290
190 Ga0466972_0012370 3300044658 Bacteria 4289
191 Ga0466966_0000022 3300044684 Bacteria 112729
192 Ga0466961_0288641 3300044693 Bacteria 1003
193 Ga0466957_0002266 3300044842 Bacteria 10306
194 Ga0466959_0000055 3300045049 Bacteria 78801
195 Ga0495629_0103794 3300046459 Bacteria 1983
196 Ga0495638_0049025 3300046460 Unclassified 2641
197 Ga0495638_0187225 3300046460 Bacteria 1177
198 Ga0495580_0102164 3300046472 Bacteria 1993
199 Ga0495630_0043370 3300046517 Bacteria 3360
200 Ga0495586_0164850 3300046535 Bacteria 1251
201 Ga0495668_0004385 3300046616 Bacteria 10056
202 Ga0495647_0070980 3300046681 Bacteria 1394
203 Ga0495658_0019261 3300046683 Bacteria 3560
204 Ga0495674_0048666 3300047319 Bacteria 3751
205 Ga0495676_0479593 3300047321 Bacteria 818
206 Ga0495686_0000058 3300047472 Bacteria 240089
207 Ga0496109_0023100 3300048912 Bacteria 5517
208 Ga0496126_0589768 3300048929 Unclassified 877
209 Ga0501308_034345 3300049128 Unclassified 693
210 Ga0501307_038956 3300049162 Unclassified 685
211 Ga0501290_001301 3300049513 Bacteria 3462
212 Ga0501034_0748778 3300049571 Bacteria 873
213 Ga0501047_0006731 3300049581 Bacteria 10804
214 Ga0501047_0009810 3300049581 Bacteria 9047
215 Ga0501047_0219101 3300049581 Bacteria 1760
216 Ga0501069_0082740 3300049585 Bacteria 1809
217 Ga0501070_0166656 3300049586 Bacteria 1815
218 Ga0501073_0049707 3300049589 Bacteria 2939
219 Ga0501074_0252263 3300049590 Bacteria 1255
220 Ga0501199_004363 3300049650 Bacteria 1391
221 Ga0501242_002710 3300049674 Bacteria 1874
222 Ga0501257_000771 3300049686 Bacteria 6381
223 Ga0501259_004626 3300049688 Bacteria 2184
224 Ga0501083_0372588 3300049744 Bacteria 928
225 Ga0501044_0016620 3300049823 Bacteria 7899
226 Ga0501044_0215062 3300049823 Bacteria 1875
227 nmdc:mga0k408_21669_c1 3300050493 Unclassified 3611
228 nmdc:mga0k408_416903_c1 3300050493 Bacteria 798
229 nmdc:mga05p37_2780_c1 3300050507 Bacteria 20350
230 Ga0495619_0196655 3300053085 Bacteria 1396
231 Ga0500578_0000572 3300053086 Bacteria 44844
232 Ga0500578_0032221 3300053086 Bacteria 3369
233 Ga0500646_0005892 3300053090 Bacteria 3109
234 Ga0500583_0000011 3300053092 Bacteria 160380
235 Ga0500583_0011187 3300053092 Bacteria 3371
236 Ga0500651_0243935 3300053093 Bacteria 1047
237 Ga0500650_0165370 3300053098 Bacteria 1019
238 Ga0500568_0117357 3300053139 Bacteria 993
239 Ga0500588_0003701 3300053146 Bacteria 3250
240 Ga0500589_002893 3300053147 Bacteria 5959
241 Ga0500604_0007574 3300053151 Unclassified 2877
242 Ga0500616_0028668 3300053153 Unclassified 3067
243 Ga0500616_0045848 3300053153 Unclassified 2327
244 Ga0500622_0001915 3300053156 Bacteria 15695
245 Ga0500622_0005501 3300053156 Bacteria 7593
246 Ga0500636_0118589 3300053177 Bacteria 1487
247 Ga0501084_0098795 3300054114 Unclassified 2451
248 2738724827 2738541278 Bacteria 9755573
249 Ga0500645_020671
250 Ga0006777J48905_1028183
251 rootH1_10002948
252 rootH1_10013446
253 rootH1_10020107
254 rootH1_10055612
255 rootH2_10038793
256 rootH2_10154567
257 rootL2_10065535
258 rootL2_10084436
259 rootL2_10216341
260 rootH1_10003164
261 rootH1_10068367
262 rootH1_10124439
263 rootH1_10157093
264 rootH1_10201866
265 Ga0032354_1020528
266 Ga0058862_12651262
267 Ga0070676_10005198
268 Ga0070666_10000265
269 Ga0070682_100010815
270 Ga0068868_100019538
271 Ga0070691_10011573
272 Ga0070668_100000036
273 Ga0070675_100255562
274 Ga0070675_100401854
275 Ga0070673_100000803
276 Ga0070667_100000151
277 Ga0070667_100913921
278 Ga0070663_100397152
279 Ga0070678_100889955
280 Ga0070662_100002810
281 Ga0070681_10004505
282 Ga0068867_100002246
283 Ga0070679_100058952
284 Ga0068853_100021915
285 Ga0068853_100099462
286 Ga0070672_100000481
287 Ga0070693_100151067
288 Ga0070665_100001651
289 Ga0068855_100121650
290 Ga0068855_100181771
291 Ga0068854_100069020
292 Ga0068854_100371994
293 Ga0068856_100010399
294 Ga0068856_100050870
295 Ga0068856_100186565
296 Ga0068852_100036766
297 Ga0068864_100019628
298 Ga0068861_100359301
299 Ga0068851_10003720
300 Ga0068863_100004069
301 Ga0068858_100000760
302 Ga0068860_100002392
303 Ga0068862_100857625
304 Ga0075366_10026081
305 Ga0097621_100003739
306 Ga0097621_100009281
307 Ga0068871_100001303
308 Ga0068871_100035863
309 Ga0068871_100313840
310 Ga0105240_10007119
311 Ga0105240_10060507
312 Ga0105240_10158485
313 Ga0105245_10039187
314 Ga0114129_10004171
315 Ga0105243_10100376
316 Ga0105241_10007589
317 Ga0105241_10017541
318 Ga0105241_10053873
319 Ga0105241_10091697
320 Ga0105241_10431494
321 Ga0105242_10070894
322 Ga0105237_10180700
323 Ga0105237_10189007
324 Ga0105237_10552343
325 Ga0105238_10008640
326 Ga0105238_10008647
327 Ga0105249_10000514
328 Ga0105239_10000746
329 Ga0105239_10015520
330 Ga0105239_10329408
331 Ga0105239_11179536
332 Ga0105239_11458434
333 Ga0105246_10392003
334 Ga0157371_10048151
335 Ga0157371_10187349
336 Ga0157370_10017363
337 Ga0157370_10035168
338 Ga0157369_10010939
339 Ga0157369_10862975
340 Ga0157374_10000153
341 Ga0157374_10019653
342 Ga0157374_10276287
343 Ga0157374_11313136
344 Ga0157378_10002091
345 Ga0163162_10000040
346 Ga0163162_10024785
347 Ga0163162_10100918
348 Ga0163162_10120381
349 Ga0157372_10001557
350 Ga0157372_10174643
351 Ga0157372_11088870
352 Ga0157375_10000407
353 Ga0157380_10793678
354 Ga0157379_10000173
355 Ga0157379_10125354
356 Ga0157376_10000278
357 Ga0157376_10069139
358 Ga0157376_10070092
359 Ga0157376_10133153
360 Ga0157376_10232637
361 Ga0163161_10026301
362 Ga0163161_10323923
363 Ga0197907_11090403
364 Ga0206355_1099252
365 Ga0206351_10734328
366 Ga0206352_10383259
367 Ga0206353_10547220
368 Ga0209646_1004246
369 Ga0207656_10004384
370 Ga0207680_10000508
371 Ga0207647_10031998
372 Ga0207645_10009004
373 Ga0207705_10220605
374 Ga0207654_10007644
375 Ga0207654_10351281
376 Ga0207707_10008228
377 Ga0207707_10079400
378 Ga0207695_10026860
379 Ga0207695_10049180
380 Ga0207671_10006526
381 Ga0207671_10101601
382 Ga0207660_10039530
383 Ga0207652_10027439
384 Ga0207694_10006125
385 Ga0207694_10173953
386 Ga0207659_10229476
387 Ga0207687_10704319
388 Ga0207690_10364926
389 Ga0207706_10006547
390 Ga0207709_10081997
391 Ga0207704_10006448
392 Ga0207691_10000067
393 Ga0207691_10133226
394 Ga0207667_10000519
395 Ga0207667_10097466
396 Ga0207667_10152648
397 Ga0207651_10000309
398 Ga0207712_10002122
399 Ga0207668_10000274
400 Ga0207640_10014596
401 Ga0207658_10000225
402 Ga0207677_10011296
403 Ga0207703_10002889
404 Ga0207639_10006238
405 Ga0207639_10357852
406 Ga0207678_10385622
407 Ga0207702_10009820
408 Ga0207702_10033918
409 Ga0207702_10081036
410 Ga0207641_10034682
411 Ga0207648_10002613
412 Ga0207676_10004694
413 Ga0207698_10647822
414 Ga0268266_10028165
415 Ga0268265_10930061
416 Ga0268264_10015647
417 Ga0307513_10029028
418 Ga0307513_10180370
419 Ga0307513_10261043
420 Ga0307509_10035663
421 Ga0307509_10112572
422 Ga0307508_10001107
423 Ga0307516_10179512
424 Ga0373931_0337152
425 Ga0373935_0159638
426 Ga0373933_0227705
427 Ga0373925_0104750
428 Ga0439439_0000381
429 Ga0451791_1935389
430 Ga0451798_0772835
431 Ga0451841_1381834
432 Ga0451853_0967589
433 Ga0439449_0001255
434 Ga0439457_004018
435 Ga0439462_0000035
436 Ga0466969_0000201
437 Ga0466972_0000075
438 Ga0466972_0012370
439 Ga0466966_0000022
440 Ga0466961_0288641
441 Ga0466957_0002266
442 Ga0466959_0000055
443 Ga0495629_0103794
444 Ga0495638_0049025
445 Ga0495638_0187225
446 Ga0495580_0102164
447 Ga0495630_0043370
448 Ga0495586_0164850
449 Ga0495668_0004385
450 Ga0495647_0070980
451 Ga0495658_0019261
452 Ga0495674_0048666
453 Ga0495676_0479593
454 Ga0495686_0000058
455 Ga0496109_0023100
456 Ga0496126_0589768
457 Ga0501308_034345
458 Ga0501307_038956
459 Ga0501290_001301
460 Ga0501034_0748778
461 Ga0501047_0006731
462 Ga0501047_0009810
463 Ga0501047_0219101
464 Ga0501069_0082740
465 Ga0501070_0166656
466 Ga0501073_0049707
467 Ga0501074_0252263
468 Ga0501199_004363
469 Ga0501242_002710
470 Ga0501257_000771
471 Ga0501259_004626
472 Ga0501083_0372588
473 Ga0501044_0016620
474 Ga0501044_0215062
475 nmdc:mga0k408_21669_c1
476 nmdc:mga0k408_416903_c1
477 nmdc:mga05p37_2780_c1
478 Ga0495619_0196655
479 Ga0500578_0000572
480 Ga0500578_0032221
481 Ga0500646_0005892
482 Ga0500583_0000011
483 Ga0500583_0011187
484 Ga0500651_0243935
485 Ga0500650_0165370
486 Ga0500568_0117357
487 Ga0500588_0003701
488 Ga0500589_002893
489 Ga0500604_0007574
490 Ga0500616_0028668
491 Ga0500616_0045848
492 Ga0500622_0001915
493 Ga0500622_0005501
494 Ga0500636_0118589
495 Ga0501084_0098795
496 2738724827

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13568

OMP_b-brl_2

Outer membrane protein beta-barrel domain

36

208

0.9

PF13505

OMP_b-brl

Outer membrane protein beta-barrel domain

23

232

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
1qj8-assembly1.cif.gz_A crystal structure of the outer membrane protein ompx from escherichia coli 0.6706 32 216
6x9z-assembly1.cif.gz_A de novo design of transmembrane beta-barrels 0.67 27 216
1qj8-assembly1.cif.gz_A crystal structure of the outer membrane protein ompx from escherichia coli 0.6668 32 216
6x9z-assembly1.cif.gz_A de novo design of transmembrane beta-barrels 0.6606 27 216
1p4t-assembly1.cif.gz_A crystal structure of neisserial surface protein a (nspa) 0.6572 32 216
ID Description Score Start End Superfamily
1p4tA00 Mainly Beta;Beta Barrel;Porin; 0.6572 32 216 2.40.160.20
1p4tA00 Mainly Beta;Beta Barrel;Porin; 0.6498 32 216 2.40.160.20
1qjpA00 Mainly Beta;Beta Barrel;Porin; 0.6484 27 216 2.40.160.20
1qjpA00 Mainly Beta;Beta Barrel;Porin; 0.6403 27 216 2.40.160.20
4rlcA00 Mainly Beta;Beta Barrel;Porin; 0.6009 34 216 2.40.160.20
ID Description Score Start End GO Terms
AF-A0A3A1NQ46-F1-model_v4 PorT family protein 0.9006 32 216
AF-R5PDH0-F1-model_v4 deleted 0.885 33 216
AF-A0A1F3M8S6-F1-model_v4 Outer membrane protein beta-barrel domain-containing protein 0.8669 32 216
AF-A0A0C1LAI1-F1-model_v4 Outer membrane protein beta-barrel domain-containing protein 0.8601 25 216
AF-A0A0E9MXX1-F1-model_v4 Outer membrane protein beta-barrel domain-containing protein 0.8586 31 216

Map