F360631

General Info

Members Datasets Scaffolds Average Seq Length
249 178 237 246

Family's Representative Sequence

Representative Sequence 3300006048|Ga0075363_100123818|Ga0075363_1001238182
Length 257
Sequence MIDVSLFSASGGRELEGRVALVTGASRNIGRAIALSLADGGASVILTARGNKGALDEVAAAIHAKGGKAVAVLGDLTQPGDVEAVVAAGVSAFGGIDILVNNAALRNETPIDELTLEGWRGVMALSLDAPFLTVKAALGPLTQSGQGAVINIGGLTAYTGAKHRVHVVAAKSGLDGLTKALAHELADRGITVNLVSPGLIETMREGREPHHHATSANLAKRRGTPEEVAAMVRFLSGPWARYITGQTMHVNGGAYLP

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
3 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
4 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
5 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
6 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
7 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
8 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
9 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
10 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
11 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
12 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
15 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
16 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
90 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
137 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
138 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
139 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
140 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
141 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
142 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
143 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
144 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
147 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
148 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
149 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
150 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
151 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
152 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
153 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
154 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
155 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
156 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
157 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
158 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
159 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
160 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
161 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
162 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
163 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
164 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
165 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
167 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
168 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
169 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
170 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
171 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
172 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
173 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
174 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
175 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
176 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
177 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
178 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.18
Metatranscriptomes 0
Isolates 4.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.83
Nodule 0.8
Rhizoplane 2.01
Rhizosphere 87.15
Stem 0
Stem Tuber 0
Unclassified 3.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_10346489 2162886012 Bacteria 1066
2 Ga0055526_1022841 3300003771 Bacteria 2110
3 Ga0055524_1003148 3300003775 Bacteria 8128
4 Ga0055528_1000721 3300003790 Bacteria 23354
5 Ga0065707_10145324 3300005295 Bacteria 1721
6 Ga0070676_10002433 3300005328 Bacteria 9543
7 Ga0070676_10013241 3300005328 Bacteria 4518
8 Ga0070670_100002525 3300005331 Bacteria 15089
9 Ga0070670_100034658 3300005331 Bacteria 4344
10 Ga0068869_100014526 3300005334 Bacteria 5262
11 Ga0070666_10012089 3300005335 Bacteria 5436
12 Ga0070680_100426951 3300005336 Bacteria 1131
13 Ga0068868_100002459 3300005338 Bacteria 12861
14 Ga0068868_100062048 3300005338 Bacteria 2962
15 Ga0070689_100124950 3300005340 Bacteria 2058
16 Ga0070687_100082559 3300005343 Bacteria 1757
17 Ga0070668_100001962 3300005347 Bacteria 15016
18 Ga0070668_100010738 3300005347 Bacteria 6810
19 Ga0070668_100015494 3300005347 Bacteria 5699
20 Ga0070668_100591315 3300005347 Bacteria 970
21 Ga0070669_100000448 3300005353 Bacteria 31480
22 Ga0070669_100001502 3300005353 Bacteria 16863
23 Ga0070669_100168541 3300005353 Bacteria 1706
24 Ga0070675_100026466 3300005354 Bacteria 4655
25 Ga0070675_100027963 3300005354 Bacteria 4535
26 Ga0070671_100026070 3300005355 Bacteria 4802
27 Ga0070671_100165010 3300005355 Bacteria 1873
28 Ga0070671_100471420 3300005355 Unclassified 1078
29 Ga0070674_100019194 3300005356 Bacteria 4340
30 Ga0070673_100001736 3300005364 Bacteria 12973
31 Ga0070688_100098683 3300005365 Bacteria 1922
32 Ga0070667_100011903 3300005367 Bacteria 7196
33 Ga0070667_100012621 3300005367 Bacteria 6988
34 Ga0070667_100047758 3300005367 Bacteria 3602
35 Ga0070667_100049269 3300005367 Bacteria 3547
36 Ga0070667_100345820 3300005367 Bacteria 1345
37 Ga0070713_100001288 3300005436 Bacteria 16024
38 Ga0070713_100170961 3300005436 Bacteria 1947
39 Ga0070701_10012022 3300005438 Bacteria 3888
40 Ga0070705_100002490 3300005440 Bacteria 9255
41 Ga0070705_100444355 3300005440 Bacteria 971
42 Ga0070700_100008532 3300005441 Bacteria 5579
43 Ga0070694_100004064 3300005444 Bacteria 8771
44 Ga0070694_100012815 3300005444 Bacteria 5225
45 Ga0070678_100007775 3300005456 Bacteria 6377
46 Ga0070662_100015052 3300005457 Bacteria 5175
47 Ga0068867_100000717 3300005459 Bacteria 22125
48 Ga0068867_100020625 3300005459 Bacteria 4696
49 Ga0070685_10060671 3300005466 Bacteria 2212
50 Ga0070707_100169612 3300005468 Bacteria 2127
51 Ga0070707_100408136 3300005468 Bacteria 1319
52 Ga0070699_100015358 3300005518 Bacteria 6580
53 Ga0070699_100068356 3300005518 Bacteria 3085
54 Ga0070699_100086657 3300005518 Bacteria 2733
55 Ga0070697_100057904 3300005536 Bacteria 3153
56 Ga0070672_100005110 3300005543 Bacteria 8655
57 Ga0070672_100175528 3300005543 Bacteria 1784
58 Ga0070695_100000171 3300005545 Bacteria 30974
59 Ga0070696_100000124 3300005546 Bacteria 40765
60 Ga0070665_100027950 3300005548 Bacteria 5680
61 Ga0070704_100000145 3300005549 Bacteria 26912
62 Ga0070704_100393344 3300005549 Bacteria 1181
63 Ga0070664_100443793 3300005564 Bacteria 1191
64 Ga0068857_100058148 3300005577 Bacteria 3432
65 Ga0068857_100117959 3300005577 Bacteria 2388
66 Ga0068859_100002171 3300005617 Bacteria 19940
67 Ga0068859_100017985 3300005617 Bacteria 7103
68 Ga0068864_100011868 3300005618 Bacteria 7194
69 Ga0068864_100033021 3300005618 Bacteria 4399
70 Ga0068866_10090629 3300005718 Bacteria 1664
71 Ga0068861_100002179 3300005719 Bacteria 12715
72 Ga0068861_100032037 3300005719 Bacteria 3867
73 Ga0068870_10002483 3300005840 Bacteria 7693
74 Ga0068870_10007867 3300005840 Bacteria 4767
75 Ga0068863_100024639 3300005841 Bacteria 5738
76 Ga0068858_100026693 3300005842 Bacteria 5364
77 Ga0068858_100177895 3300005842 Bacteria 2008
78 Ga0068860_100019547 3300005843 Bacteria 6566
79 Ga0068860_100029823 3300005843 Bacteria 5248
80 Ga0068860_100090800 3300005843 Bacteria 2910
81 Ga0068862_100000905 3300005844 Bacteria 28737
82 Ga0075365_10046852 3300006038 Bacteria 2841
83 Ga0075363_100123818 3300006048 Bacteria 1446
84 Ga0070712_100257872 3300006175 Bacteria 1396
85 Ga0097621_100033108 3300006237 Bacteria 4113
86 Ga0097621_100327605 3300006237 Bacteria 1358
87 Ga0068871_100646395 3300006358 Bacteria 965
88 Ga0075428_100216306 3300006844 Bacteria 2070
89 Ga0075428_100272004 3300006844 Bacteria 1823
90 Ga0075433_10016463 3300006852 Bacteria 6096
91 Ga0068865_100077338 3300006881 Bacteria 2377
92 Ga0097620_100002171 3300006931 Bacteria 19940
93 Ga0097620_100017985 3300006931 Bacteria 7103
94 Ga0097620_100322057 3300006931 Bacteria 1640
95 Ga0099794_10014596 3300007265 Bacteria 3446
96 Ga0099794_10029365 3300007265 Bacteria 2561
97 Ga0099794_10071169 3300007265 Bacteria 1704
98 Ga0111539_10008450 3300009094 Bacteria 13096
99 Ga0111539_10077778 3300009094 Bacteria 3904
100 Ga0111539_10152001 3300009094 Bacteria 2709
101 Ga0114129_10000535 3300009147 Bacteria 46578
102 Ga0114129_10361318 3300009147 Bacteria 1921
103 Ga0105243_10053693 3300009148 Bacteria 3197
104 Ga0105248_10030586 3300009177 Bacteria 6013
105 Ga0105249_10016542 3300009553 Bacteria 6545
106 Ga0105249_10055292 3300009553 Bacteria 3630
107 Ga0105246_10077223 3300011119 Bacteria 2362
108 Ga0157369_10540689 3300013105 Bacteria 1204
109 Ga0157374_10048149 3300013296 Bacteria 3955
110 Ga0157374_10399981 3300013296 Bacteria 1370
111 Ga0157378_10174279 3300013297 Bacteria 2019
112 Ga0163162_10053776 3300013306 Bacteria 4047
113 Ga0157375_10007133 3300013308 Bacteria 9765
114 Ga0157375_10034789 3300013308 Bacteria 4802
115 Ga0157375_10557515 3300013308 Bacteria 1307
116 Ga0163163_10286316 3300014325 Bacteria 1700
117 Ga0157380_10192305 3300014326 Bacteria 1803
118 Ga0157380_10291011 3300014326 Bacteria 1500
119 Ga0157379_10026039 3300014968 Bacteria 5203
120 Ga0157376_10089018 3300014969 Bacteria 2668
121 Ga0163161_10003576 3300017792 Bacteria 10886
122 Ga0209673_1000138 3300025273 Bacteria 158321
123 Ga0209676_1030805 3300025292 Bacteria 1634
124 Ga0209025_1006066 3300025294 Bacteria 9556
125 Ga0209564_1008650 3300025295 Bacteria 4981
126 Ga0209256_1001236 3300025299 Bacteria 28328
127 Ga0207642_10041062 3300025899 Bacteria 2023
128 Ga0207688_10076843 3300025901 Bacteria 1902
129 Ga0207680_10061581 3300025903 Bacteria 2289
130 Ga0207645_10001646 3300025907 Bacteria 18199
131 Ga0207645_10107463 3300025907 Bacteria 1804
132 Ga0207645_10261571 3300025907 Bacteria 1146
133 Ga0207643_10001982 3300025908 Bacteria 11311
134 Ga0207643_10022341 3300025908 Bacteria 3482
135 Ga0207684_10169361 3300025910 Bacteria 1883
136 Ga0207684_10432064 3300025910 Bacteria 1131
137 Ga0207707_10157764 3300025912 Bacteria 1984
138 Ga0207662_10009726 3300025918 Bacteria 5302
139 Ga0207652_10533075 3300025921 Bacteria 1056
140 Ga0207646_10534570 3300025922 Bacteria 1055
141 Ga0207681_10002629 3300025923 Bacteria 11389
142 Ga0207681_10014671 3300025923 Bacteria 4877
143 Ga0207650_10006730 3300025925 Bacteria 7835
144 Ga0207650_10053549 3300025925 Bacteria 2991
145 Ga0207650_10167970 3300025925 Bacteria 1742
146 Ga0207659_10036792 3300025926 Bacteria 3394
147 Ga0207700_10000182 3300025928 Bacteria 37846
148 Ga0207700_10343324 3300025928 Bacteria 1299
149 Ga0207644_10009966 3300025931 Bacteria 6254
150 Ga0207644_10038127 3300025931 Bacteria 3384
151 Ga0207644_10313906 3300025931 Unclassified 1266
152 Ga0207690_10155368 3300025932 Bacteria 1700
153 Ga0207706_10461067 3300025933 Bacteria 1099
154 Ga0207670_10265453 3300025936 Bacteria 1332
155 Ga0207669_10008205 3300025937 Bacteria 4892
156 Ga0207704_10002734 3300025938 Bacteria 7952
157 Ga0207665_10038284 3300025939 Bacteria 3193
158 Ga0207691_10006881 3300025940 Bacteria 10970
159 Ga0207711_10038498 3300025941 Bacteria 4067
160 Ga0207689_10158255 3300025942 Bacteria 1867
161 Ga0207679_10309744 3300025945 Bacteria 1364
162 Ga0207651_10003999 3300025960 Bacteria 7331
163 Ga0207712_10045048 3300025961 Bacteria 3053
164 Ga0207668_10001330 3300025972 Bacteria 14669
165 Ga0207668_10009018 3300025972 Bacteria 5962
166 Ga0207668_10265110 3300025972 Bacteria 1402
167 Ga0207658_10024420 3300025986 Bacteria 4229
168 Ga0207658_10099783 3300025986 Bacteria 2272
169 Ga0207677_10024441 3300026023 Bacteria 3754
170 Ga0207703_10021845 3300026035 Bacteria 5010
171 Ga0207703_10042545 3300026035 Bacteria 3644
172 Ga0207639_10240781 3300026041 Bacteria 1573
173 Ga0207708_10005619 3300026075 Bacteria 9255
174 Ga0207641_10008990 3300026088 Bacteria 8252
175 Ga0207648_10001196 3300026089 Bacteria 29074
176 Ga0207648_10001556 3300026089 Bacteria 25265
177 Ga0207648_10864335 3300026089 Bacteria 844
178 Ga0207676_10018301 3300026095 Bacteria 5091
179 Ga0207674_10008960 3300026116 Bacteria 11499
180 Ga0207675_100014898 3300026118 Bacteria 7258
181 Ga0207683_10000250 3300026121 Bacteria 48026
182 Ga0207683_10044319 3300026121 Bacteria 3889
183 Ga0209813_10020742 3300027866 Bacteria 1842
184 Ga0207428_10176582 3300027907 Bacteria 1615
185 Ga0268266_10090258 3300028379 Bacteria 2685
186 Ga0268265_10000073 3300028380 Bacteria 128856
187 Ga0268265_10125618 3300028380 Bacteria 2122
188 Ga0268264_10009183 3300028381 Bacteria 8192
189 Ga0268264_10071570 3300028381 Bacteria 2938
190 Ga0265337_1000691 3300028556 Bacteria 17795
191 Ga0265334_10002246 3300028573 Bacteria 9081
192 Ga0265338_10029750 3300028800 Bacteria 5405
193 Ga0307513_10043212 3300031456 Bacteria 4953
194 Ga0265313_10036468 3300031595 Bacteria 2468
195 Ga0265314_10147584 3300031711 Bacteria 1446
196 Ga0307412_10462668 3300031911 Bacteria 1048
197 Ga0307416_100142559 3300032002 Bacteria 2181
198 Ga0373931_0011661 3300035691 Bacteria 4247
199 Ga0373937_0086517 3300036401 Bacteria 2900
200 Ga0373937_0365495 3300036401 Bacteria 1368
201 Ga0373937_0394102 3300036401 Bacteria 1314
202 Ga0439465_0090042 3300041413 Bacteria 1049
203 Ga0451577_0073349 3300042876 Bacteria 3054
204 Ga0495580_0321825 3300046472 Bacteria 1051
205 Ga0495582_0046295 3300046473 Bacteria 2396
206 Ga0495630_0314976 3300046517 Unclassified 1196
207 Ga0495642_0127402 3300046528 Bacteria 1095
208 Ga0495665_0004116 3300046531 Bacteria 7842
209 Ga0495586_0178054 3300046535 Unclassified 1202
210 Ga0495598_0019466 3300046537 Bacteria 1781
211 Ga0495609_0037182 3300046538 Bacteria 2196
212 Ga0495621_0045976 3300046539 Bacteria 1547
213 Ga0495667_0119238 3300046559 Bacteria 1704
214 Ga0495659_0017861 3300046664 Bacteria 2357
215 Ga0495659_0018447 3300046664 Bacteria 2325
216 Ga0495659_0022157 3300046664 Bacteria 2146
217 Ga0496108_0384759 3300048911 Bacteria 1225
218 Ga0496109_0136067 3300048912 Bacteria 2296
219 Ga0496114_0172272 3300048917 Bacteria 1887
220 Ga0496119_0001035 3300048922 Bacteria 35586
221 Ga0496122_0004059 3300048925 Bacteria 18584
222 Ga0496123_0001422 3300048926 Bacteria 33457
223 Ga0501038_0272574 3300049574 Bacteria 1334
224 Ga0501071_0104181 3300049587 Bacteria 2094
225 nmdc:mga0yw44_6969_c1 3300050492 Bacteria 5519
226 nmdc:mga06z11_68264_c1 3300050494 Bacteria 1874
227 nmdc:mga04h51_41751_c1 3300050495 Bacteria 1501
228 nmdc:mga05p37_1358_c1 3300050507 Bacteria 28465
229 nmdc:mga05p37_259358_c1 3300050507 Bacteria 2081
230 nmdc:mga08y16_173094_c1 3300050511 Bacteria 2242
231 nmdc:mga0rr50_136613_c1 3300050513 Bacteria 1968
232 nmdc:mga0a205_10110_c1 3300050515 Bacteria 8660
233 nmdc:mga0a205_508612_c1 3300050515 Bacteria 1061
234 Ga0495619_0206334 3300053085 Bacteria 1361
235 Ga0500556_0000199 3300053104 Bacteria 49258
236 Ga0500618_000008 3300053125 Bacteria 214678
237 Ga0500645_008458 3300053730 Bacteria 3514

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025939 Ga0207665_10038284 Ga0207665_100382843 206
2 3300026089 Ga0207648_10864335 Ga0207648_108643351 209
3 3300026121 Ga0207683_10044319 Ga0207683_100443192 209
4 3300046539 Ga0495621_0045976 Ga0495621_0045976_637_1383 209
5 3300042876 Ga0451577_0073349 Ga0451577_0073349_53_802 210
6 3300005468 Ga0070707_100169612 Ga0070707_1001696122 213
7 3300005367 Ga0070667_100345820 Ga0070667_1003458202 218
8 3300025907 Ga0207645_10261571 Ga0207645_102615711 218
9 3300025922 Ga0207646_10534570 Ga0207646_105345702 219
10 3300005347 Ga0070668_100591315 Ga0070668_1005913151 220
11 3300025928 Ga0207700_10343324 Ga0207700_103433242 221
12 3300005436 Ga0070713_100170961 Ga0070713_1001709612 222
13 3300005518 Ga0070699_100068356 Ga0070699_1000683563 222
14 3300025910 Ga0207684_10432064 Ga0207684_104320641 222
15 3300036401 Ga0373937_0086517 Ga0373937_0086517_1875_2618 222
16 3300046559 Ga0495667_0119238 Ga0495667_0119238_195_938 222
17 3300053085 Ga0495619_0206334 Ga0495619_0206334_485_1228 222
18 3300005355 Ga0070671_100471420 Ga0070671_1004714202 223
19 3300025931 Ga0207644_10038127 Ga0207644_100381273 223
20 3300049587 Ga0501071_0104181 Ga0501071_0104181_634_1377 226
21 3300031911 Ga0307412_10462668 Ga0307412_104626682 227
22 3300032002 Ga0307416_100142559 Ga0307416_1001425592 227
23 3300036401 Ga0373937_0394102 Ga0373937_0394102_364_1107 227
24 3300025972 Ga0207668_10265110 Ga0207668_102651101 229
25 3300046664 Ga0495659_0018447 Ga0495659_0018447_1343_2092 229
26 3300005367 Ga0070667_100047758 Ga0070667_1000477585 230
27 3300005543 Ga0070672_100175528 Ga0070672_1001755282 230
28 3300013296 Ga0157374_10399981 Ga0157374_103999812 230
29 3300013308 Ga0157375_10557515 Ga0157375_105575152 230
30 3300046538 Ga0495609_0037182 Ga0495609_0037182_414_1163 230
31 3300013306 Ga0163162_10053776 Ga0163162_100537764 231
32 3300014326 Ga0157380_10291011 Ga0157380_102910112 231
33 3300025923 Ga0207681_10014671 Ga0207681_100146714 231
34 3300005347 Ga0070668_100010738 Ga0070668_1000107383 232
35 3300028380 Ga0268265_10125618 Ga0268265_101256182 232
36 3300005338 Ga0068868_100062048 Ga0068868_1000620482 234
37 3300005355 Ga0070671_100165010 Ga0070671_1001650102 235
38 3300005440 Ga0070705_100002490 Ga0070705_10000249011 235
39 3300005444 Ga0070694_100004064 Ga0070694_1000040641 235
40 3300005545 Ga0070695_100000171 Ga0070695_10000017117 235
41 3300005546 Ga0070696_100000124 Ga0070696_10000012413 235
42 3300005549 Ga0070704_100393344 Ga0070704_1003933442 235
43 3300007265 Ga0099794_10029365 Ga0099794_100293653 236
44 3300005536 Ga0070697_100057904 Ga0070697_1000579042 237
45 3300007265 Ga0099794_10014596 Ga0099794_100145962 237
46 3300013105 Ga0157369_10540689 Ga0157369_105406891 237
47 3300025932 Ga0207690_10155368 Ga0207690_101553681 237
48 3300025986 Ga0207658_10099783 Ga0207658_100997833 237
49 3300050515 nmdc:mga0a205_508612_c1 nmdc:mga0a205_508612_c1_218_967 237
50 3300005367 Ga0070667_100011903 Ga0070667_1000119032 240
51 3300049574 Ga0501038_0272574 Ga0501038_0272574_283_1008 241
52 3300007265 Ga0099794_10071169 Ga0099794_100711692 242
53 3300041413 Ga0439465_0090042 Ga0439465_0090042_245_1003 242
54 3300005328 Ga0070676_10013241 Ga0070676_100132412 244
55 3300005331 Ga0070670_100034658 Ga0070670_1000346584 244
56 3300005353 Ga0070669_100000448 Ga0070669_10000044814 244
57 3300005354 Ga0070675_100027963 Ga0070675_1000279633 244
58 3300005436 Ga0070713_100001288 Ga0070713_10000128816 244
59 3300005444 Ga0070694_100012815 Ga0070694_1000128152 244
60 3300005457 Ga0070662_100015052 Ga0070662_1000150525 244
61 3300005459 Ga0068867_100000717 Ga0068867_10000071710 244
62 3300005549 Ga0070704_100000145 Ga0070704_10000014515 244
63 3300005577 Ga0068857_100058148 Ga0068857_1000581482 244
64 3300005617 Ga0068859_100002171 Ga0068859_10000217114 244
65 3300005618 Ga0068864_100033021 Ga0068864_1000330214 244
66 3300005840 Ga0068870_10002483 Ga0068870_100024834 244
67 3300005844 Ga0068862_100000905 Ga0068862_10000090528 244
68 3300006358 Ga0068871_100646395 Ga0068871_1006463951 244
69 3300006931 Ga0097620_100002171 Ga0097620_1000021717 244
70 3300009147 Ga0114129_10361318 Ga0114129_103613182 244
71 3300009553 Ga0105249_10016542 Ga0105249_100165424 244
72 3300011119 Ga0105246_10077223 Ga0105246_100772231 244
73 3300013308 Ga0157375_10007133 Ga0157375_100071334 244
74 3300025908 Ga0207643_10001982 Ga0207643_100019825 244
75 3300025918 Ga0207662_10009726 Ga0207662_100097262 244
76 3300025923 Ga0207681_10002629 Ga0207681_100026299 244
77 3300025925 Ga0207650_10006730 Ga0207650_100067309 244
78 3300025928 Ga0207700_10000182 Ga0207700_1000018213 244
79 3300026075 Ga0207708_10005619 Ga0207708_100056198 244
80 3300026089 Ga0207648_10001196 Ga0207648_1000119622 244
81 3300026116 Ga0207674_10008960 Ga0207674_1000896011 244
82 3300026118 Ga0207675_100014898 Ga0207675_1000148986 244
83 3300028380 Ga0268265_10000073 Ga0268265_1000007343 244
84 3300050507 nmdc:mga05p37_259358_c1 nmdc:mga05p37_259358_c1_799_1560 244
85 3300050513 nmdc:mga0rr50_136613_c1 nmdc:mga0rr50_136613_c1_958_1695 245
86 3300053125 Ga0500618_000008 Ga0500618_000008_93497_94252 245
87 iso_pu_bacteria 2841911363 2841914624 245
88 iso_pu_bacteria 2841917233 2841920211 245
89 3300028556 Ga0265337_1000691 Ga0265337_10006912 246
90 3300028573 Ga0265334_10002246 Ga0265334_100022467 246
91 3300028800 Ga0265338_10029750 Ga0265338_100297503 246
92 3300031595 Ga0265313_10036468 Ga0265313_100364681 246
93 3300031711 Ga0265314_10147584 Ga0265314_101475842 246
94 3300036401 Ga0373937_0365495 Ga0373937_0365495_182_922 246
95 3300046472 Ga0495580_0321825 Ga0495580_0321825_208_948 246
96 3300046517 Ga0495630_0314976 Ga0495630_0314976_204_944 246
97 3300046535 Ga0495586_0178054 Ga0495586_0178054_206_946 246
98 iso_pu_bacteria 2599185236 2599717847 246
99 3300005577 Ga0068857_100117959 Ga0068857_1001179592 247
100 3300006844 Ga0075428_100272004 Ga0075428_1002720042 247
101 3300009094 Ga0111539_10152001 Ga0111539_101520012 247
102 iso_pu_bacteria 2510917026 2511169151 247
103 3300005295 Ga0065707_10145324 Ga0065707_101453242 248
104 3300005336 Ga0070680_100426951 Ga0070680_1004269512 248
105 3300005340 Ga0070689_100124950 Ga0070689_1001249502 248
106 3300005343 Ga0070687_100082559 Ga0070687_1000825591 248
107 3300005347 Ga0070668_100015494 Ga0070668_1000154943 248
108 3300005353 Ga0070669_100168541 Ga0070669_1001685412 248
109 3300005438 Ga0070701_10012022 Ga0070701_100120222 248
110 3300005440 Ga0070705_100444355 Ga0070705_1004443551 248
111 3300005441 Ga0070700_100008532 Ga0070700_1000085324 248
112 3300005468 Ga0070707_100408136 Ga0070707_1004081362 248
113 3300005518 Ga0070699_100015358 Ga0070699_1000153582 248
114 3300005564 Ga0070664_100443793 Ga0070664_1004437932 248
115 3300005719 Ga0068861_100002179 Ga0068861_10000217911 248
116 3300005843 Ga0068860_100090800 Ga0068860_1000908002 248
117 3300006048 Ga0075363_100123818 Ga0075363_1001238182 248
118 3300006844 Ga0075428_100216306 Ga0075428_1002163062 248
119 3300006931 Ga0097620_100322057 Ga0097620_1003220572 248
120 3300009094 Ga0111539_10008450 Ga0111539_100084503 248
121 3300009147 Ga0114129_10000535 Ga0114129_1000053516 248
122 3300009148 Ga0105243_10053693 Ga0105243_100536933 248
123 3300014326 Ga0157380_10192305 Ga0157380_101923052 248
124 3300025901 Ga0207688_10076843 Ga0207688_100768431 248
125 3300025907 Ga0207645_10107463 Ga0207645_101074631 248
126 3300025910 Ga0207684_10169361 Ga0207684_101693612 248
127 3300025912 Ga0207707_10157764 Ga0207707_101577642 248
128 3300025921 Ga0207652_10533075 Ga0207652_105330752 248
129 3300025933 Ga0207706_10461067 Ga0207706_104610672 248
130 3300025936 Ga0207670_10265453 Ga0207670_102654532 248
131 3300025942 Ga0207689_10158255 Ga0207689_101582552 248
132 3300025945 Ga0207679_10309744 Ga0207679_103097442 248
133 3300025972 Ga0207668_10009018 Ga0207668_100090184 248
134 3300027866 Ga0209813_10020742 Ga0209813_100207422 248
135 3300027907 Ga0207428_10176582 Ga0207428_101765821 248
136 3300028381 Ga0268264_10071570 Ga0268264_100715703 248
137 3300031456 Ga0307513_10043212 Ga0307513_100432123 248
138 3300035691 Ga0373931_0011661 Ga0373931_0011661_2148_2894 248
139 3300046473 Ga0495582_0046295 Ga0495582_0046295_777_1523 248
140 3300046528 Ga0495642_0127402 Ga0495642_0127402_318_1067 248
141 3300046531 Ga0495665_0004116 Ga0495665_0004116_4075_4821 248
142 3300046537 Ga0495598_0019466 Ga0495598_0019466_682_1431 248
143 3300046664 Ga0495659_0017861 Ga0495659_0017861_758_1507 248
144 3300046664 Ga0495659_0022157 Ga0495659_0022157_148_897 248
145 3300050494 nmdc:mga06z11_68264_c1 nmdc:mga06z11_68264_c1_997_1770 248
146 3300050495 nmdc:mga04h51_41751_c1 nmdc:mga04h51_41751_c1_405_1178 248
147 3300050507 nmdc:mga05p37_1358_c1 nmdc:mga05p37_1358_c1_12530_13279 248
148 3300050511 nmdc:mga08y16_173094_c1 nmdc:mga08y16_173094_c1_1220_1969 248
149 3300050515 nmdc:mga0a205_10110_c1 nmdc:mga0a205_10110_c1_7821_8570 248
150 iso_pu_bacteria 2839993093 2839997693 248
151 iso_pu_bacteria 2840764183 2840765974 248
152 iso_pu_bacteria 8001845381 8001849559 248
153 3300048922 Ga0496119_0001035 Ga0496119_0001035_30293_31048 249
154 3300048925 Ga0496122_0004059 Ga0496122_0004059_4307_5062 249
155 3300048926 Ga0496123_0001422 Ga0496123_0001422_27690_28445 249
156 3300053104 Ga0500556_0000199 Ga0500556_0000199_4705_5460 249
157 3300053730 Ga0500645_008458 Ga0500645_008458_2463_3218 249
158 3300006852 Ga0075433_10016463 Ga0075433_100164634 250
159 3300009094 Ga0111539_10077778 Ga0111539_100777782 250
160 iso_pu_bacteria 2765235802 2765466665 250
161 iso_pu_bacteria 2904578770 2904581823 250
162 iso_pu_bacteria 2919119836 2919123491 250
163 3300003771 Ga0055526_1022841 Ga0055526_10228412 251
164 3300003775 Ga0055524_1003148 Ga0055524_10031487 251
165 3300003790 Ga0055528_1000721 Ga0055528_100072110 251
166 3300005518 Ga0070699_100086657 Ga0070699_1000866572 251
167 3300006038 Ga0075365_10046852 Ga0075365_100468522 251
168 3300025273 Ga0209673_1000138 Ga0209673_100013882 251
169 3300025292 Ga0209676_1030805 Ga0209676_10308052 251
170 3300025294 Ga0209025_1006066 Ga0209025_10060664 251
171 3300025295 Ga0209564_1008650 Ga0209564_10086505 251
172 3300025299 Ga0209256_1001236 Ga0209256_100123629 251
173 3300050492 nmdc:mga0yw44_6969_c1 nmdc:mga0yw44_6969_c1_3586_4341 251
174 iso_pu_bacteria 2894652903 2894657118 252
175 iso_pu_bacteria 3005409236 3005413871 252
176 2162886012 MBSR1b_contig_10346489 MBSR1b_0954.00007700 253
177 3300005328 Ga0070676_10002433 Ga0070676_100024339 253
178 3300005331 Ga0070670_100002525 Ga0070670_10000252519 253
179 3300005334 Ga0068869_100014526 Ga0068869_1000145264 253
180 3300005335 Ga0070666_10012089 Ga0070666_100120893 253
181 3300005338 Ga0068868_100002459 Ga0068868_1000024599 253
182 3300005347 Ga0070668_100001962 Ga0070668_10000196217 253
183 3300005353 Ga0070669_100001502 Ga0070669_10000150222 253
184 3300005354 Ga0070675_100026466 Ga0070675_1000264666 253
185 3300005355 Ga0070671_100026070 Ga0070671_1000260706 253
186 3300005356 Ga0070674_100019194 Ga0070674_1000191946 253
187 3300005364 Ga0070673_100001736 Ga0070673_10000173613 253
188 3300005365 Ga0070688_100098683 Ga0070688_1000986832 253
189 3300005367 Ga0070667_100012621 Ga0070667_1000126214 253
190 3300005367 Ga0070667_100049269 Ga0070667_1000492696 253
191 3300005456 Ga0070678_100007775 Ga0070678_1000077754 253
192 3300005459 Ga0068867_100020625 Ga0068867_1000206256 253
193 3300005466 Ga0070685_10060671 Ga0070685_100606711 253
194 3300005543 Ga0070672_100005110 Ga0070672_1000051107 253
195 3300005548 Ga0070665_100027950 Ga0070665_1000279506 253
196 3300005617 Ga0068859_100017985 Ga0068859_1000179855 253
197 3300005618 Ga0068864_100011868 Ga0068864_1000118686 253
198 3300005718 Ga0068866_10090629 Ga0068866_100906292 253
199 3300005719 Ga0068861_100032037 Ga0068861_1000320373 253
200 3300005840 Ga0068870_10007867 Ga0068870_100078672 253
201 3300005841 Ga0068863_100024639 Ga0068863_1000246396 253
202 3300005842 Ga0068858_100026693 Ga0068858_1000266934 253
203 3300005842 Ga0068858_100177895 Ga0068858_1001778952 253
204 3300005843 Ga0068860_100019547 Ga0068860_1000195476 253
205 3300005843 Ga0068860_100029823 Ga0068860_1000298238 253
206 3300006175 Ga0070712_100257872 Ga0070712_1002578721 253
207 3300006237 Ga0097621_100033108 Ga0097621_1000331082 253
208 3300006237 Ga0097621_100327605 Ga0097621_1003276052 253
209 3300006881 Ga0068865_100077338 Ga0068865_1000773382 253
210 3300006931 Ga0097620_100017985 Ga0097620_1000179856 253
211 3300009177 Ga0105248_10030586 Ga0105248_100305864 253
212 3300009553 Ga0105249_10055292 Ga0105249_100552924 253
213 3300013296 Ga0157374_10048149 Ga0157374_100481494 253
214 3300013297 Ga0157378_10174279 Ga0157378_101742792 253
215 3300013308 Ga0157375_10034789 Ga0157375_100347895 253
216 3300014325 Ga0163163_10286316 Ga0163163_102863162 253
217 3300014968 Ga0157379_10026039 Ga0157379_100260396 253
218 3300014969 Ga0157376_10089018 Ga0157376_100890183 253
219 3300017792 Ga0163161_10003576 Ga0163161_100035769 253
220 3300025899 Ga0207642_10041062 Ga0207642_100410622 253
221 3300025903 Ga0207680_10061581 Ga0207680_100615813 253
222 3300025907 Ga0207645_10001646 Ga0207645_100016466 253
223 3300025908 Ga0207643_10022341 Ga0207643_100223412 253
224 3300025925 Ga0207650_10053549 Ga0207650_100535492 253
225 3300025925 Ga0207650_10167970 Ga0207650_101679701 253
226 3300025926 Ga0207659_10036792 Ga0207659_100367922 253
227 3300025931 Ga0207644_10009966 Ga0207644_100099668 253
228 3300025931 Ga0207644_10313906 Ga0207644_103139062 253
229 3300025937 Ga0207669_10008205 Ga0207669_100082056 253
230 3300025938 Ga0207704_10002734 Ga0207704_100027345 253
231 3300025940 Ga0207691_10006881 Ga0207691_100068816 253
232 3300025941 Ga0207711_10038498 Ga0207711_100384984 253
233 3300025960 Ga0207651_10003999 Ga0207651_100039993 253
234 3300025961 Ga0207712_10045048 Ga0207712_100450484 253
235 3300025972 Ga0207668_10001330 Ga0207668_100013309 253
236 3300025986 Ga0207658_10024420 Ga0207658_100244206 253
237 3300026023 Ga0207677_10024441 Ga0207677_100244413 253
238 3300026035 Ga0207703_10021845 Ga0207703_100218454 253
239 3300026035 Ga0207703_10042545 Ga0207703_100425452 253
240 3300026041 Ga0207639_10240781 Ga0207639_102407812 253
241 3300026088 Ga0207641_10008990 Ga0207641_100089906 253
242 3300026089 Ga0207648_10001556 Ga0207648_1000155614 253
243 3300026095 Ga0207676_10018301 Ga0207676_100183012 253
244 3300026121 Ga0207683_10000250 Ga0207683_1000025055 253
245 3300028379 Ga0268266_10090258 Ga0268266_100902582 253
246 3300028381 Ga0268264_10009183 Ga0268264_1000918310 253
247 3300048911 Ga0496108_0384759 Ga0496108_0384759_154_921 253
248 3300048912 Ga0496109_0136067 Ga0496109_0136067_1293_2060 253
249 3300048917 Ga0496114_0172272 Ga0496114_0172272_16_783 253

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

18

212

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

24

255

0.94

PF08659

KR

KR domain

19

196

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ijk-assembly1.cif.gz_B crystal structure of a putative 3-oxoacyl-[acyl-carrier protein]reductase from helicobacter pylori 26695 0.9504 9 250
3woh-assembly1.cif.gz_A structure of ketoreductase siam from streptomyces sp. a7248 0.9488 6 248
4bmn-assembly1.cif.gz_A apo structure of short-chain alcohol dehydrogenase from ralstonia sp. dsm 6428 0.9481 3 248
4ijk-assembly1.cif.gz_D crystal structure of a putative 3-oxoacyl-[acyl-carrier protein]reductase from helicobacter pylori 26695 0.9461 9 250
4bmn-assembly1.cif.gz_B apo structure of short-chain alcohol dehydrogenase from ralstonia sp. dsm 6428 0.9442 6 248
ID Description Score Start End Superfamily
4hsyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9486 6 248 3.40.50.720
4bmnA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9481 3 248 3.40.50.720
af_A0A0P0X9U1_21_128_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9467 2 96 3.40.50.720
4iinB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9428 9 251 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9423 3 187 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2V8XGZ2-F1-model_v4 Oxidoreductase 0.9729 1 126
AF-A0A7Y5VCB1-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9638 1 131
AF-A0A834EXE5-F1-model_v4 3-ketoacyl-[acyl-carrier-protein] reductase beta subunit (Quinone reductase CBR4) 0.963 9 144 GO:0006633
GO:0008667
GO:0016616
GO:0019290
GO:0048038
AF-A0A2V8XGZ2-F1-model_v4 Oxidoreductase 0.9577 1 126
AF-A0A519VEW8-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9563 1 183 GO:0016491

Feature Viewer

pLDDT pTM Quality
89 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map