F360719

General Info

Members Datasets Scaffolds Average Seq Length
249 141 498 288

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10213100|Ga0105242_102131002
Length 324
Sequence VKKVRAYYESFFIFAPPKINFINSLSDSKAISLPGSFNIAAKLQDYGQLMKLRLASLVVFSAVMGFVIGSTGHFEWQQLWLLVLGGFLVTASSNAFNQVIEKDFDKLMDRTSQRPLPAGRMSMGEALVAATLMGIVGVAILWFYMNPLSGILGALSLVLYTLLYTPLKRVTPFAVFVGAIPGAMPPLLGWVAARNEIGFEALLLYTIQFIWQFPHFWSIAWILDDDYKKAGFKMMPSPGGRDHSSAFQTMVYSICLIPMALMPYMFHLGGVMSMIVLIICGFIFTVPSFRLYKDLSMESARKVMFSSFIYLPVVQIVLMLDKIL

Samples

Sample ID Description Type Environment
1 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
43 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
44 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
54 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
55 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
56 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
57 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
58 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
59 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
60 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
61 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
62 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
89 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
90 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
91 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
92 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
93 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
94 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
95 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
96 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
97 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
98 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
99 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
100 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
101 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
102 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
105 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
106 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
107 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
108 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
109 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
110 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
111 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
112 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
113 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
114 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
115 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
116 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
117 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
118 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
119 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
120 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
121 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
122 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
123 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
124 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
125 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
126 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
127 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
128 2738541283 Pedobacter sp. OK701 Isolate Unclassified
129 2738541284 Pedobacter sp. YR016 Isolate Unclassified
130 2738543023 Pedobacter sp. OK628 Isolate Unclassified
131 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
132 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
133 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
134 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
135 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
136 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
137 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
138 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
139 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
140 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
141 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.98
Metatranscriptomes 0.4
Isolates 5.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.43
Nodule 0
Rhizoplane 0
Rhizosphere 84.74
Stem 0
Stem Tuber 0
Unclassified 0.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105242_10213100 3300009176 Bacteria 1722
2 SwRhRL2b_contig_1499193 2162886007 Bacteria 2508
3 JGI24737J22298_10012064 3300001990 Bacteria 2821
4 JGI24744J21845_10000638 3300002077 Bacteria 6410
5 JGI25162J39368_1002524 3300002737 Bacteria 7000
6 JGI25164J39214_1001000 3300002772 Bacteria 8838
7 JGI25165J46597_1001414 3300003214 Bacteria 12976
8 rootH2_10005722 3300003320 Bacteria 98526
9 rootH2_10010675 3300003320 Bacteria 6648
10 rootL2_10104480 3300003322 Bacteria 1996
11 rootH1_10004106 3300003323 Bacteria 40486
12 rootH1_10008491 3300003323 Bacteria 3905
13 rootH1_10027719 3300003323 Bacteria 6381
14 rootH1_10113461 3300003323 Bacteria 2913
15 rootH1_10207062 3300003323 Bacteria 2839
16 Ga0058862_10002966 3300004803 Bacteria 14510
17 Ga0065714_10002497 3300005288 Bacteria 28272
18 Ga0065714_10006626 3300005288 Bacteria 7869
19 Ga0065714_10072461 3300005288 Bacteria 3364
20 Ga0065704_10070196 3300005289 Bacteria 94899
21 Ga0070658_10000060 3300005327 Bacteria 112561
22 Ga0070676_10000152 3300005328 Bacteria 27554
23 Ga0068868_100058296 3300005338 Bacteria 3051
24 Ga0070660_100003098 3300005339 Bacteria 11425
25 Ga0070671_100119164 3300005355 Bacteria 2221
26 Ga0070673_100023354 3300005364 Bacteria 4518
27 Ga0070659_100000199 3300005366 Bacteria 46342
28 Ga0070678_100039620 3300005456 Bacteria 3326
29 Ga0070662_100000935 3300005457 Bacteria 17877
30 Ga0068867_100002522 3300005459 Bacteria 12881
31 Ga0070679_100003968 3300005530 Bacteria 13626
32 Ga0070684_100030112 3300005535 Bacteria 4609
33 Ga0068853_100068684 3300005539 Bacteria 3081
34 Ga0068853_100136812 3300005539 Bacteria 2197
35 Ga0070665_100000264 3300005548 Bacteria 85867
36 Ga0068855_100000098 3300005563 Bacteria 105977
37 Ga0068855_100000149 3300005563 Bacteria 89273
38 Ga0068855_100006331 3300005563 Bacteria 14426
39 Ga0068855_100657145 3300005563 Unclassified 1125
40 Ga0068856_100000120 3300005614 Bacteria 78280
41 Ga0068856_100022739 3300005614 Bacteria 6096
42 Ga0068856_100121179 3300005614 Bacteria 2617
43 Ga0068856_100161090 3300005614 Bacteria 2254
44 Ga0068856_100378718 3300005614 Bacteria 1434
45 Ga0068852_100000389 3300005616 Bacteria 29439
46 Ga0068852_100271362 3300005616 Bacteria 1632
47 Ga0068852_100380485 3300005616 Bacteria 1385
48 Ga0068852_100452426 3300005616 Bacteria 1271
49 Ga0075366_10000422 3300006195 Bacteria 19817
50 Ga0075366_10031784 3300006195 Bacteria 3107
51 Ga0097621_100000232 3300006237 Bacteria 37391
52 Ga0068871_100000800 3300006358 Bacteria 21155
53 Ga0068865_100003071 3300006881 Bacteria 9985
54 Ga0105240_10000371 3300009093 Bacteria 84390
55 Ga0105240_10023602 3300009093 Bacteria 8126
56 Ga0105240_10038607 3300009093 Bacteria 6123
57 Ga0105240_10046333 3300009093 Bacteria 5510
58 Ga0105240_10081965 3300009093 Bacteria 3963
59 Ga0105240_10171846 3300009093 Bacteria 2566
60 Ga0105240_10315671 3300009093 Bacteria 1783
61 Ga0105245_10101136 3300009098 Bacteria 2668
62 Ga0105243_10036187 3300009148 Bacteria 3830
63 Ga0105241_10022400 3300009174 Bacteria 4680
64 Ga0105241_10059378 3300009174 Bacteria 2940
65 Ga0105241_10069808 3300009174 Bacteria 2725
66 Ga0105241_10168506 3300009174 Bacteria 1807
67 Ga0105237_10000120 3300009545 Bacteria 109953
68 Ga0105237_10000535 3300009545 Bacteria 53620
69 Ga0105237_10000632 3300009545 Bacteria 49178
70 Ga0105237_10084704 3300009545 Bacteria 3160
71 Ga0105237_10375998 3300009545 Bacteria 1425
72 Ga0105237_10505460 3300009545 Bacteria 1215
73 Ga0105238_10000612 3300009551 Bacteria 37482
74 Ga0105238_10041104 3300009551 Bacteria 4683
75 Ga0105238_10235440 3300009551 Bacteria 1808
76 Ga0105239_10000009 3300010375 Bacteria 361182
77 Ga0105239_10026119 3300010375 Bacteria 6429
78 Ga0105239_10105640 3300010375 Bacteria 3119
79 Ga0105239_10200891 3300010375 Bacteria 2233
80 Ga0105239_10339255 3300010375 Bacteria 1696
81 Ga0105246_10018736 3300011119 Bacteria 4414
82 Ga0157373_10000125 3300013100 Bacteria 59653
83 Ga0157373_10001788 3300013100 Bacteria 16341
84 Ga0157373_10045754 3300013100 Bacteria 3124
85 Ga0157371_10001492 3300013102 Bacteria 24223
86 Ga0157371_10001547 3300013102 Bacteria 23663
87 Ga0157371_10002309 3300013102 Bacteria 18350
88 Ga0157371_10017132 3300013102 Bacteria 5389
89 Ga0157371_10023021 3300013102 Bacteria 4556
90 Ga0157370_10015888 3300013104 Bacteria 7639
91 Ga0157370_10018164 3300013104 Bacteria 7077
92 Ga0157370_10031837 3300013104 Bacteria 5156
93 Ga0157370_10046883 3300013104 Bacteria 4143
94 Ga0157370_10047237 3300013104 Bacteria 4127
95 Ga0157370_10052273 3300013104 Bacteria 3901
96 Ga0157370_10734468 3300013104 Bacteria 900
97 Ga0157369_10034465 3300013105 Bacteria 5556
98 Ga0157369_10043369 3300013105 Bacteria 4903
99 Ga0157369_10070465 3300013105 Bacteria 3756
100 Ga0157369_10567499 3300013105 Bacteria 1172
101 Ga0157374_10033011 3300013296 Bacteria 4720
102 Ga0157378_10028615 3300013297 Bacteria 4918
103 Ga0157378_10061050 3300013297 Bacteria 3363
104 Ga0157378_10110260 3300013297 Bacteria 2522
105 Ga0163162_10000008 3300013306 Bacteria 316194
106 Ga0163162_10005211 3300013306 Bacteria 12536
107 Ga0157372_10000190 3300013307 Bacteria 67909
108 Ga0157372_10000404 3300013307 Bacteria 47383
109 Ga0157372_10005833 3300013307 Bacteria 13117
110 Ga0157372_10014925 3300013307 Bacteria 8317
111 Ga0157372_10131838 3300013307 Bacteria 2876
112 Ga0157375_10024294 3300013308 Bacteria 5606
113 Ga0157375_10104687 3300013308 Bacteria 2919
114 Ga0157375_10311599 3300013308 Bacteria 1738
115 Ga0157380_10000010 3300014326 Bacteria 140132
116 Ga0182008_10000002 3300014497 Bacteria 480216
117 Ga0182008_10000438 3300014497 Bacteria 31655
118 Ga0182006_1000870 3300015261 Bacteria 20258
119 Ga0182006_1001113 3300015261 Bacteria 17114
120 Ga0182006_1001237 3300015261 Bacteria 15831
121 Ga0182007_10011138 3300015262 Bacteria 3511
122 Ga0163161_10000194 3300017792 Bacteria 55862
123 Ga0213872_10026217 3300021361 Bacteria 2678
124 Ga0207427_100131 3300025231 Bacteria 93947
125 Ga0209437_100048 3300025233 Bacteria 405107
126 Ga0209026_1000683 3300025250 Bacteria 20446
127 Ga0209233_1000029 3300025261 Bacteria 641642
128 Ga0209455_1002941 3300025272 Bacteria 6271
129 Ga0207647_10000546 3300025904 Bacteria 29990
130 Ga0207645_10000948 3300025907 Bacteria 24090
131 Ga0207705_10000233 3300025909 Bacteria 55125
132 Ga0207705_10029816 3300025909 Bacteria 3890
133 Ga0207705_10046566 3300025909 Bacteria 3117
134 Ga0207654_10010858 3300025911 Bacteria 4636
135 Ga0207654_10012272 3300025911 Bacteria 4387
136 Ga0207654_10308969 3300025911 Bacteria 1077
137 Ga0207695_10000142 3300025913 Bacteria 214715
138 Ga0207695_10002312 3300025913 Bacteria 28435
139 Ga0207695_10009569 3300025913 Bacteria 11975
140 Ga0207695_10115124 3300025913 Bacteria 2663
141 Ga0207695_10248339 3300025913 Bacteria 1679
142 Ga0207671_10000110 3300025914 Bacteria 126480
143 Ga0207671_10001385 3300025914 Bacteria 28199
144 Ga0207671_10067126 3300025914 Bacteria 2670
145 Ga0207671_10302493 3300025914 Bacteria 1264
146 Ga0207657_10011218 3300025919 Bacteria 8909
147 Ga0207657_10065449 3300025919 Bacteria 3098
148 Ga0207652_10034540 3300025921 Bacteria 4262
149 Ga0207687_10193116 3300025927 Bacteria 1586
150 Ga0207644_10006015 3300025931 Bacteria 7911
151 Ga0207690_10000744 3300025932 Bacteria 21044
152 Ga0207690_10035499 3300025932 Bacteria 3221
153 Ga0207706_10000013 3300025933 Bacteria 188236
154 Ga0207686_10040466 3300025934 Bacteria 2834
155 Ga0207709_10142424 3300025935 Bacteria 1649
156 Ga0207670_10106952 3300025936 Bacteria 2008
157 Ga0207689_10223551 3300025942 Bacteria 1556
158 Ga0207667_10000014 3300025949 Bacteria 421261
159 Ga0207667_10000496 3300025949 Bacteria 51954
160 Ga0207667_10084926 3300025949 Bacteria 3277
161 Ga0207651_10102043 3300025960 Bacteria 2131
162 Ga0207677_10016979 3300026023 Bacteria 4326
163 Ga0207677_10116581 3300026023 Bacteria 2000
164 Ga0207702_10000195 3300026078 Bacteria 71757
165 Ga0207702_10011030 3300026078 Bacteria 7541
166 Ga0207702_10019399 3300026078 Bacteria 5626
167 Ga0207702_10043993 3300026078 Bacteria 3752
168 Ga0207702_10118056 3300026078 Bacteria 2370
169 Ga0207648_10001141 3300026089 Bacteria 29844
170 Ga0207683_10008935 3300026121 Bacteria 8536
171 Ga0207698_10026325 3300026142 Bacteria 4113
172 Ga0207698_10352351 3300026142 Bacteria 1391
173 Ga0268266_10000268 3300028379 Bacteria 85976
174 Ga0268264_10063971 3300028381 Bacteria 3095
175 Ga0307517_10000207 3300028786 Bacteria 99774
176 Ga0316177_1195072 3300030731 Bacteria 9957
177 Ga0316176_1017512 3300030732 Bacteria 17610
178 Ga0316183_1098725 3300030742 Bacteria 33143
179 Ga0316181_1188373 3300030744 Bacteria 5924
180 Ga0316182_1077988 3300030745 Bacteria 2330
181 Ga0265327_10015237 3300031251 Bacteria 4978
182 Ga0307412_10000038 3300031911 Bacteria 187857
183 Ga0307414_10001061 3300032004 Bacteria 14064
184 Ga0307414_10051331 3300032004 Bacteria 2862
185 Ga0307414_10070716 3300032004 Bacteria 2514
186 Ga0307414_10142392 3300032004 Bacteria 1879
187 Ga0307411_10465291 3300032005 Bacteria 1061
188 Ga0307510_10331902 3300033180 Bacteria 975
189 Ga0395899_0000027 3300037312 Bacteria 337387
190 Ga0395899_0000325 3300037312 Bacteria 60438
191 Ga0395899_0006674 3300037312 Bacteria 8940
192 Ga0395899_0161227 3300037312 Bacteria 1584
193 Ga0395900_0002139 3300037418 Bacteria 22114
194 Ga0395900_0025254 3300037418 Bacteria 6082
195 Ga0395900_0344440 3300037418 Bacteria 1465
196 Ga0395900_0364373 3300037418 Bacteria 1416
197 Ga0395898_0008551 3300037466 Bacteria 10807
198 Ga0395905_0000001 3300037471 Bacteria 2037079
199 Ga0395905_0000729 3300037471 Bacteria 43376
200 Ga0395905_0012192 3300037471 Bacteria 8279
201 Ga0395901_0008129 3300038443 Bacteria 10595
202 Ga0395901_0113462 3300038443 Bacteria 2846
203 Ga0395901_0117141 3300038443 Bacteria 2799
204 Ga0436361_1223234 3300039447 Bacteria 16015
205 Ga0439448_0001618 3300042005 Bacteria 5904
206 Ga0466969_0028757 3300044656 Bacteria 2841
207 Ga0466959_0035545 3300045049 Bacteria 3684
208 Ga0466959_0042243 3300045049 Bacteria 3363
209 Ga0495606_0131962 3300046507 Bacteria 1484
210 Ga0495642_0107435 3300046528 Bacteria 1191
211 Ga0495633_0000026 3300046558 Bacteria 204722
212 Ga0495668_0060377 3300046616 Bacteria 2092
213 Ga0495625_0021093 3300046660 Bacteria 5021
214 Ga0495625_0024463 3300046660 Bacteria 4595
215 Ga0495625_0063876 3300046660 Bacteria 2599
216 Ga0495661_0017412 3300046665 Bacteria 4747
217 Ga0495661_0113720 3300046665 Bacteria 1505
218 Ga0495687_016331 3300047443 Bacteria 3735
219 Ga0495677_0093579 3300047445 Bacteria 1134
220 Ga0495684_0077946 3300047471 Bacteria 2515
221 Ga0495686_0000319 3300047472 Bacteria 79929
222 Ga0495686_0078119 3300047472 Bacteria 2026
223 Ga0495686_0078187 3300047472 Bacteria 2025
224 Ga0496122_0000219 3300048925 Bacteria 127599
225 Ga0496123_0000866 3300048926 Bacteria 48135
226 Ga0496125_0131467 3300048928 Bacteria 1761
227 Ga0501241_000397 3300049758 Bacteria 9529
228 Ga0501241_001761 3300049758 Bacteria 4297
229 nmdc:mga0k408_57162_c1 3300050493 Bacteria 2264
230 nmdc:mga0k408_82_c1 3300050493 Bacteria 45008
231 Ga0500635_0067681 3300053080 Bacteria 1260
232 Ga0500651_0000188 3300053093 Bacteria 39379
233 Ga0500608_022507 3300053122 Bacteria 2922
234 Ga0500618_003273 3300053125 Bacteria 5631
235 Ga0500622_0000430 3300053156 Bacteria 39891
236 2738759019 2738541283 Bacteria 7222293
237 2738761869 2738541284 Bacteria 5199923
238 2739302208 2738543023 Bacteria 6767879
239 2740031155 2739367866 Bacteria 4215900
240 2776615486 2775506987 Bacteria 5373360
241 2839989734 2839989709 Bacteria 3773432
242 2842904833 2842903701 Bacteria 6986368
243 2852631125 2852627209 Bacteria 5896285
244 2910246275 2910245624 Bacteria 6935613
245 2919188702 2919186247 Bacteria 6244071
246 2919440278 2919437846 Bacteria 6199444
247 2939667143 2939664404 Bacteria 6364494
248 2977235641 2977232053 Bacteria 5485925
249 8055591158 8055588893 Bacteria 3619545
250 Ga0105242_10213100
251 SwRhRL2b_contig_1499193
252 JGI24737J22298_10012064
253 JGI24744J21845_10000638
254 JGI25162J39368_1002524
255 JGI25164J39214_1001000
256 JGI25165J46597_1001414
257 rootH2_10005722
258 rootH2_10010675
259 rootL2_10104480
260 rootH1_10004106
261 rootH1_10008491
262 rootH1_10027719
263 rootH1_10113461
264 rootH1_10207062
265 Ga0058862_10002966
266 Ga0065714_10002497
267 Ga0065714_10006626
268 Ga0065714_10072461
269 Ga0065704_10070196
270 Ga0070658_10000060
271 Ga0070676_10000152
272 Ga0068868_100058296
273 Ga0070660_100003098
274 Ga0070671_100119164
275 Ga0070673_100023354
276 Ga0070659_100000199
277 Ga0070678_100039620
278 Ga0070662_100000935
279 Ga0068867_100002522
280 Ga0070679_100003968
281 Ga0070684_100030112
282 Ga0068853_100068684
283 Ga0068853_100136812
284 Ga0070665_100000264
285 Ga0068855_100000098
286 Ga0068855_100000149
287 Ga0068855_100006331
288 Ga0068855_100657145
289 Ga0068856_100000120
290 Ga0068856_100022739
291 Ga0068856_100121179
292 Ga0068856_100161090
293 Ga0068856_100378718
294 Ga0068852_100000389
295 Ga0068852_100271362
296 Ga0068852_100380485
297 Ga0068852_100452426
298 Ga0075366_10000422
299 Ga0075366_10031784
300 Ga0097621_100000232
301 Ga0068871_100000800
302 Ga0068865_100003071
303 Ga0105240_10000371
304 Ga0105240_10023602
305 Ga0105240_10038607
306 Ga0105240_10046333
307 Ga0105240_10081965
308 Ga0105240_10171846
309 Ga0105240_10315671
310 Ga0105245_10101136
311 Ga0105243_10036187
312 Ga0105241_10022400
313 Ga0105241_10059378
314 Ga0105241_10069808
315 Ga0105241_10168506
316 Ga0105237_10000120
317 Ga0105237_10000535
318 Ga0105237_10000632
319 Ga0105237_10084704
320 Ga0105237_10375998
321 Ga0105237_10505460
322 Ga0105238_10000612
323 Ga0105238_10041104
324 Ga0105238_10235440
325 Ga0105239_10000009
326 Ga0105239_10026119
327 Ga0105239_10105640
328 Ga0105239_10200891
329 Ga0105239_10339255
330 Ga0105246_10018736
331 Ga0157373_10000125
332 Ga0157373_10001788
333 Ga0157373_10045754
334 Ga0157371_10001492
335 Ga0157371_10001547
336 Ga0157371_10002309
337 Ga0157371_10017132
338 Ga0157371_10023021
339 Ga0157370_10015888
340 Ga0157370_10018164
341 Ga0157370_10031837
342 Ga0157370_10046883
343 Ga0157370_10047237
344 Ga0157370_10052273
345 Ga0157370_10734468
346 Ga0157369_10034465
347 Ga0157369_10043369
348 Ga0157369_10070465
349 Ga0157369_10567499
350 Ga0157374_10033011
351 Ga0157378_10028615
352 Ga0157378_10061050
353 Ga0157378_10110260
354 Ga0163162_10000008
355 Ga0163162_10005211
356 Ga0157372_10000190
357 Ga0157372_10000404
358 Ga0157372_10005833
359 Ga0157372_10014925
360 Ga0157372_10131838
361 Ga0157375_10024294
362 Ga0157375_10104687
363 Ga0157375_10311599
364 Ga0157380_10000010
365 Ga0182008_10000002
366 Ga0182008_10000438
367 Ga0182006_1000870
368 Ga0182006_1001113
369 Ga0182006_1001237
370 Ga0182007_10011138
371 Ga0163161_10000194
372 Ga0213872_10026217
373 Ga0207427_100131
374 Ga0209437_100048
375 Ga0209026_1000683
376 Ga0209233_1000029
377 Ga0209455_1002941
378 Ga0207647_10000546
379 Ga0207645_10000948
380 Ga0207705_10000233
381 Ga0207705_10029816
382 Ga0207705_10046566
383 Ga0207654_10010858
384 Ga0207654_10012272
385 Ga0207654_10308969
386 Ga0207695_10000142
387 Ga0207695_10002312
388 Ga0207695_10009569
389 Ga0207695_10115124
390 Ga0207695_10248339
391 Ga0207671_10000110
392 Ga0207671_10001385
393 Ga0207671_10067126
394 Ga0207671_10302493
395 Ga0207657_10011218
396 Ga0207657_10065449
397 Ga0207652_10034540
398 Ga0207687_10193116
399 Ga0207644_10006015
400 Ga0207690_10000744
401 Ga0207690_10035499
402 Ga0207706_10000013
403 Ga0207686_10040466
404 Ga0207709_10142424
405 Ga0207670_10106952
406 Ga0207689_10223551
407 Ga0207667_10000014
408 Ga0207667_10000496
409 Ga0207667_10084926
410 Ga0207651_10102043
411 Ga0207677_10016979
412 Ga0207677_10116581
413 Ga0207702_10000195
414 Ga0207702_10011030
415 Ga0207702_10019399
416 Ga0207702_10043993
417 Ga0207702_10118056
418 Ga0207648_10001141
419 Ga0207683_10008935
420 Ga0207698_10026325
421 Ga0207698_10352351
422 Ga0268266_10000268
423 Ga0268264_10063971
424 Ga0307517_10000207
425 Ga0316177_1195072
426 Ga0316176_1017512
427 Ga0316183_1098725
428 Ga0316181_1188373
429 Ga0316182_1077988
430 Ga0265327_10015237
431 Ga0307412_10000038
432 Ga0307414_10001061
433 Ga0307414_10051331
434 Ga0307414_10070716
435 Ga0307414_10142392
436 Ga0307411_10465291
437 Ga0307510_10331902
438 Ga0395899_0000027
439 Ga0395899_0000325
440 Ga0395899_0006674
441 Ga0395899_0161227
442 Ga0395900_0002139
443 Ga0395900_0025254
444 Ga0395900_0344440
445 Ga0395900_0364373
446 Ga0395898_0008551
447 Ga0395905_0000001
448 Ga0395905_0000729
449 Ga0395905_0012192
450 Ga0395901_0008129
451 Ga0395901_0113462
452 Ga0395901_0117141
453 Ga0436361_1223234
454 Ga0439448_0001618
455 Ga0466969_0028757
456 Ga0466959_0035545
457 Ga0466959_0042243
458 Ga0495606_0131962
459 Ga0495642_0107435
460 Ga0495633_0000026
461 Ga0495668_0060377
462 Ga0495625_0021093
463 Ga0495625_0024463
464 Ga0495625_0063876
465 Ga0495661_0017412
466 Ga0495661_0113720
467 Ga0495687_016331
468 Ga0495677_0093579
469 Ga0495684_0077946
470 Ga0495686_0000319
471 Ga0495686_0078119
472 Ga0495686_0078187
473 Ga0496122_0000219
474 Ga0496123_0000866
475 Ga0496125_0131467
476 Ga0501241_000397
477 Ga0501241_001761
478 nmdc:mga0k408_57162_c1
479 nmdc:mga0k408_82_c1
480 Ga0500635_0067681
481 Ga0500651_0000188
482 Ga0500608_022507
483 Ga0500618_003273
484 Ga0500622_0000430
485 2738759019
486 2738761869
487 2739302208
488 2740031155
489 2776615486
490 2839989734
491 2842904833
492 2852631125
493 2910246275
494 2919188702
495 2919440278
496 2939667143
497 2977235641
498 8055591158

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01040

UbiA

UbiA prenyltransferase family

58

311

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bpu-assembly1.cif.gz_A structural and mechanistic insights into the biosynthesis of digeranylgeranylglyceryl phosphate synthase in membranes 0.8387 5 292
7bpu-assembly1.cif.gz_A structural and mechanistic insights into the biosynthesis of digeranylgeranylglyceryl phosphate synthase in membranes 0.8281 5 292
4od4-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.7566 15 291
4tq4-assembly3.cif.gz_C structure of a ubia homolog from archaeoglobus fulgidus bound to dmapp and mg2+ 0.7507 7 292
4tq3-assembly1.cif.gz_A structure of a ubia homolog from archaeoglobus fulgidus bound to gpp and mg2+ 0.7441 7 286
ID Description Score Start End Superfamily
af_F1LVF4_158_307_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.9636 15 167 1.10.357.140
af_A4I0M3_131_276_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.961 15 167 1.10.357.140
af_Q9Y7Y4_92_240_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.9609 15 163 1.10.357.140
af_I1NJ83_69_223_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.9562 15 169 1.10.357.140
af_P0AEA5_14_182_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.9518 17 188 1.10.357.140
ID Description Score Start End GO Terms
AF-A0A519WD51-F1-model_v4 heme o synthase (EC 2.5.1.141) 0.9889 156 292 GO:0006783
GO:0008495
GO:0016020
AF-A0A4Q6DWF4-F1-model_v4 Heme o synthase (EC 2.5.1.141) 0.9835 52 292 GO:0006784
GO:0008495
GO:0016020
AF-A0A2E4EBK2-F1-model_v4 Protoheme IX farnesyltransferase (EC 2.5.1.141) (Heme B farnesyltransferase) (Heme O synthase) 0.9833 2 288 GO:0005886
GO:0006784
GO:0008495
GO:0048034
AF-F4C3E1-F1-model_v4 Protoheme IX farnesyltransferase (EC 2.5.1.141) (Heme B farnesyltransferase) (Heme O synthase) 0.9823 1 288 GO:0005886
GO:0006784
GO:0008495
GO:0048034
AF-A0A524JBW9-F1-model_v4 heme o synthase (EC 2.5.1.141) 0.9821 5 181 GO:0006784
GO:0008495
GO:0016020

Map