F360719
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 249 | 141 | 498 | 288 |
Family's Representative Sequence
| Representative Sequence | 3300009176|Ga0105242_10213100|Ga0105242_102131002 |
| Length | 324 |
| Sequence | VKKVRAYYESFFIFAPPKINFINSLSDSKAISLPGSFNIAAKLQDYGQLMKLRLASLVVFSAVMGFVIGSTGHFEWQQLWLLVLGGFLVTASSNAFNQVIEKDFDKLMDRTSQRPLPAGRMSMGEALVAATLMGIVGVAILWFYMNPLSGILGALSLVLYTLLYTPLKRVTPFAVFVGAIPGAMPPLLGWVAARNEIGFEALLLYTIQFIWQFPHFWSIAWILDDDYKKAGFKMMPSPGGRDHSSAFQTMVYSICLIPMALMPYMFHLGGVMSMIVLIICGFIFTVPSFRLYKDLSMESARKVMFSSFIYLPVVQIVLMLDKIL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 5 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 6 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 7 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 8 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 9 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 10 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 11 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 12 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 24 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 27 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 29 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 30 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 31 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 32 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 33 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 34 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 35 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 54 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 55 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 56 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 58 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 61 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 89 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 90 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 91 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 92 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 93 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 94 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 95 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 96 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 97 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 98 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 99 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 100 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 101 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 102 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 103 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 104 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 105 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 106 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 107 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 108 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 119 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 120 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 121 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 122 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 123 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 124 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 125 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 126 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 127 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 128 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 129 | 2738541284 | Pedobacter sp. YR016 | Isolate | Unclassified |
| 130 | 2738543023 | Pedobacter sp. OK628 | Isolate | Unclassified |
| 131 | 2739367866 | Hymenobacter sp. YR204 | Isolate | Unclassified |
| 132 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 133 | 2839989709 | Pontibacter arcticus 2b14 | Isolate | Unclassified |
| 134 | 2842903701 | Olivibacter sp. R-72191 | Isolate | Unclassified |
| 135 | 2852627209 | Pedobacter sp. AK017 | Isolate | Rhizosphere |
| 136 | 2910245624 | Adhaeribacter radiodurans KUDC8001 | Isolate | Rhizosphere |
| 137 | 2919186247 | Pedobacter africanus 2697 | Isolate | Rhizosphere |
| 138 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 139 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
| 140 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 141 | 8055588893 | Parapedobacter lycopersici KACC 18788 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.98 |
| Metatranscriptomes | 0.4 |
| Isolates | 5.62 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.43 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 84.74 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.4 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105242_10213100 | 3300009176 | Bacteria | 1722 |
| 2 | SwRhRL2b_contig_1499193 | 2162886007 | Bacteria | 2508 |
| 3 | JGI24737J22298_10012064 | 3300001990 | Bacteria | 2821 |
| 4 | JGI24744J21845_10000638 | 3300002077 | Bacteria | 6410 |
| 5 | JGI25162J39368_1002524 | 3300002737 | Bacteria | 7000 |
| 6 | JGI25164J39214_1001000 | 3300002772 | Bacteria | 8838 |
| 7 | JGI25165J46597_1001414 | 3300003214 | Bacteria | 12976 |
| 8 | rootH2_10005722 | 3300003320 | Bacteria | 98526 |
| 9 | rootH2_10010675 | 3300003320 | Bacteria | 6648 |
| 10 | rootL2_10104480 | 3300003322 | Bacteria | 1996 |
| 11 | rootH1_10004106 | 3300003323 | Bacteria | 40486 |
| 12 | rootH1_10008491 | 3300003323 | Bacteria | 3905 |
| 13 | rootH1_10027719 | 3300003323 | Bacteria | 6381 |
| 14 | rootH1_10113461 | 3300003323 | Bacteria | 2913 |
| 15 | rootH1_10207062 | 3300003323 | Bacteria | 2839 |
| 16 | Ga0058862_10002966 | 3300004803 | Bacteria | 14510 |
| 17 | Ga0065714_10002497 | 3300005288 | Bacteria | 28272 |
| 18 | Ga0065714_10006626 | 3300005288 | Bacteria | 7869 |
| 19 | Ga0065714_10072461 | 3300005288 | Bacteria | 3364 |
| 20 | Ga0065704_10070196 | 3300005289 | Bacteria | 94899 |
| 21 | Ga0070658_10000060 | 3300005327 | Bacteria | 112561 |
| 22 | Ga0070676_10000152 | 3300005328 | Bacteria | 27554 |
| 23 | Ga0068868_100058296 | 3300005338 | Bacteria | 3051 |
| 24 | Ga0070660_100003098 | 3300005339 | Bacteria | 11425 |
| 25 | Ga0070671_100119164 | 3300005355 | Bacteria | 2221 |
| 26 | Ga0070673_100023354 | 3300005364 | Bacteria | 4518 |
| 27 | Ga0070659_100000199 | 3300005366 | Bacteria | 46342 |
| 28 | Ga0070678_100039620 | 3300005456 | Bacteria | 3326 |
| 29 | Ga0070662_100000935 | 3300005457 | Bacteria | 17877 |
| 30 | Ga0068867_100002522 | 3300005459 | Bacteria | 12881 |
| 31 | Ga0070679_100003968 | 3300005530 | Bacteria | 13626 |
| 32 | Ga0070684_100030112 | 3300005535 | Bacteria | 4609 |
| 33 | Ga0068853_100068684 | 3300005539 | Bacteria | 3081 |
| 34 | Ga0068853_100136812 | 3300005539 | Bacteria | 2197 |
| 35 | Ga0070665_100000264 | 3300005548 | Bacteria | 85867 |
| 36 | Ga0068855_100000098 | 3300005563 | Bacteria | 105977 |
| 37 | Ga0068855_100000149 | 3300005563 | Bacteria | 89273 |
| 38 | Ga0068855_100006331 | 3300005563 | Bacteria | 14426 |
| 39 | Ga0068855_100657145 | 3300005563 | Unclassified | 1125 |
| 40 | Ga0068856_100000120 | 3300005614 | Bacteria | 78280 |
| 41 | Ga0068856_100022739 | 3300005614 | Bacteria | 6096 |
| 42 | Ga0068856_100121179 | 3300005614 | Bacteria | 2617 |
| 43 | Ga0068856_100161090 | 3300005614 | Bacteria | 2254 |
| 44 | Ga0068856_100378718 | 3300005614 | Bacteria | 1434 |
| 45 | Ga0068852_100000389 | 3300005616 | Bacteria | 29439 |
| 46 | Ga0068852_100271362 | 3300005616 | Bacteria | 1632 |
| 47 | Ga0068852_100380485 | 3300005616 | Bacteria | 1385 |
| 48 | Ga0068852_100452426 | 3300005616 | Bacteria | 1271 |
| 49 | Ga0075366_10000422 | 3300006195 | Bacteria | 19817 |
| 50 | Ga0075366_10031784 | 3300006195 | Bacteria | 3107 |
| 51 | Ga0097621_100000232 | 3300006237 | Bacteria | 37391 |
| 52 | Ga0068871_100000800 | 3300006358 | Bacteria | 21155 |
| 53 | Ga0068865_100003071 | 3300006881 | Bacteria | 9985 |
| 54 | Ga0105240_10000371 | 3300009093 | Bacteria | 84390 |
| 55 | Ga0105240_10023602 | 3300009093 | Bacteria | 8126 |
| 56 | Ga0105240_10038607 | 3300009093 | Bacteria | 6123 |
| 57 | Ga0105240_10046333 | 3300009093 | Bacteria | 5510 |
| 58 | Ga0105240_10081965 | 3300009093 | Bacteria | 3963 |
| 59 | Ga0105240_10171846 | 3300009093 | Bacteria | 2566 |
| 60 | Ga0105240_10315671 | 3300009093 | Bacteria | 1783 |
| 61 | Ga0105245_10101136 | 3300009098 | Bacteria | 2668 |
| 62 | Ga0105243_10036187 | 3300009148 | Bacteria | 3830 |
| 63 | Ga0105241_10022400 | 3300009174 | Bacteria | 4680 |
| 64 | Ga0105241_10059378 | 3300009174 | Bacteria | 2940 |
| 65 | Ga0105241_10069808 | 3300009174 | Bacteria | 2725 |
| 66 | Ga0105241_10168506 | 3300009174 | Bacteria | 1807 |
| 67 | Ga0105237_10000120 | 3300009545 | Bacteria | 109953 |
| 68 | Ga0105237_10000535 | 3300009545 | Bacteria | 53620 |
| 69 | Ga0105237_10000632 | 3300009545 | Bacteria | 49178 |
| 70 | Ga0105237_10084704 | 3300009545 | Bacteria | 3160 |
| 71 | Ga0105237_10375998 | 3300009545 | Bacteria | 1425 |
| 72 | Ga0105237_10505460 | 3300009545 | Bacteria | 1215 |
| 73 | Ga0105238_10000612 | 3300009551 | Bacteria | 37482 |
| 74 | Ga0105238_10041104 | 3300009551 | Bacteria | 4683 |
| 75 | Ga0105238_10235440 | 3300009551 | Bacteria | 1808 |
| 76 | Ga0105239_10000009 | 3300010375 | Bacteria | 361182 |
| 77 | Ga0105239_10026119 | 3300010375 | Bacteria | 6429 |
| 78 | Ga0105239_10105640 | 3300010375 | Bacteria | 3119 |
| 79 | Ga0105239_10200891 | 3300010375 | Bacteria | 2233 |
| 80 | Ga0105239_10339255 | 3300010375 | Bacteria | 1696 |
| 81 | Ga0105246_10018736 | 3300011119 | Bacteria | 4414 |
| 82 | Ga0157373_10000125 | 3300013100 | Bacteria | 59653 |
| 83 | Ga0157373_10001788 | 3300013100 | Bacteria | 16341 |
| 84 | Ga0157373_10045754 | 3300013100 | Bacteria | 3124 |
| 85 | Ga0157371_10001492 | 3300013102 | Bacteria | 24223 |
| 86 | Ga0157371_10001547 | 3300013102 | Bacteria | 23663 |
| 87 | Ga0157371_10002309 | 3300013102 | Bacteria | 18350 |
| 88 | Ga0157371_10017132 | 3300013102 | Bacteria | 5389 |
| 89 | Ga0157371_10023021 | 3300013102 | Bacteria | 4556 |
| 90 | Ga0157370_10015888 | 3300013104 | Bacteria | 7639 |
| 91 | Ga0157370_10018164 | 3300013104 | Bacteria | 7077 |
| 92 | Ga0157370_10031837 | 3300013104 | Bacteria | 5156 |
| 93 | Ga0157370_10046883 | 3300013104 | Bacteria | 4143 |
| 94 | Ga0157370_10047237 | 3300013104 | Bacteria | 4127 |
| 95 | Ga0157370_10052273 | 3300013104 | Bacteria | 3901 |
| 96 | Ga0157370_10734468 | 3300013104 | Bacteria | 900 |
| 97 | Ga0157369_10034465 | 3300013105 | Bacteria | 5556 |
| 98 | Ga0157369_10043369 | 3300013105 | Bacteria | 4903 |
| 99 | Ga0157369_10070465 | 3300013105 | Bacteria | 3756 |
| 100 | Ga0157369_10567499 | 3300013105 | Bacteria | 1172 |
| 101 | Ga0157374_10033011 | 3300013296 | Bacteria | 4720 |
| 102 | Ga0157378_10028615 | 3300013297 | Bacteria | 4918 |
| 103 | Ga0157378_10061050 | 3300013297 | Bacteria | 3363 |
| 104 | Ga0157378_10110260 | 3300013297 | Bacteria | 2522 |
| 105 | Ga0163162_10000008 | 3300013306 | Bacteria | 316194 |
| 106 | Ga0163162_10005211 | 3300013306 | Bacteria | 12536 |
| 107 | Ga0157372_10000190 | 3300013307 | Bacteria | 67909 |
| 108 | Ga0157372_10000404 | 3300013307 | Bacteria | 47383 |
| 109 | Ga0157372_10005833 | 3300013307 | Bacteria | 13117 |
| 110 | Ga0157372_10014925 | 3300013307 | Bacteria | 8317 |
| 111 | Ga0157372_10131838 | 3300013307 | Bacteria | 2876 |
| 112 | Ga0157375_10024294 | 3300013308 | Bacteria | 5606 |
| 113 | Ga0157375_10104687 | 3300013308 | Bacteria | 2919 |
| 114 | Ga0157375_10311599 | 3300013308 | Bacteria | 1738 |
| 115 | Ga0157380_10000010 | 3300014326 | Bacteria | 140132 |
| 116 | Ga0182008_10000002 | 3300014497 | Bacteria | 480216 |
| 117 | Ga0182008_10000438 | 3300014497 | Bacteria | 31655 |
| 118 | Ga0182006_1000870 | 3300015261 | Bacteria | 20258 |
| 119 | Ga0182006_1001113 | 3300015261 | Bacteria | 17114 |
| 120 | Ga0182006_1001237 | 3300015261 | Bacteria | 15831 |
| 121 | Ga0182007_10011138 | 3300015262 | Bacteria | 3511 |
| 122 | Ga0163161_10000194 | 3300017792 | Bacteria | 55862 |
| 123 | Ga0213872_10026217 | 3300021361 | Bacteria | 2678 |
| 124 | Ga0207427_100131 | 3300025231 | Bacteria | 93947 |
| 125 | Ga0209437_100048 | 3300025233 | Bacteria | 405107 |
| 126 | Ga0209026_1000683 | 3300025250 | Bacteria | 20446 |
| 127 | Ga0209233_1000029 | 3300025261 | Bacteria | 641642 |
| 128 | Ga0209455_1002941 | 3300025272 | Bacteria | 6271 |
| 129 | Ga0207647_10000546 | 3300025904 | Bacteria | 29990 |
| 130 | Ga0207645_10000948 | 3300025907 | Bacteria | 24090 |
| 131 | Ga0207705_10000233 | 3300025909 | Bacteria | 55125 |
| 132 | Ga0207705_10029816 | 3300025909 | Bacteria | 3890 |
| 133 | Ga0207705_10046566 | 3300025909 | Bacteria | 3117 |
| 134 | Ga0207654_10010858 | 3300025911 | Bacteria | 4636 |
| 135 | Ga0207654_10012272 | 3300025911 | Bacteria | 4387 |
| 136 | Ga0207654_10308969 | 3300025911 | Bacteria | 1077 |
| 137 | Ga0207695_10000142 | 3300025913 | Bacteria | 214715 |
| 138 | Ga0207695_10002312 | 3300025913 | Bacteria | 28435 |
| 139 | Ga0207695_10009569 | 3300025913 | Bacteria | 11975 |
| 140 | Ga0207695_10115124 | 3300025913 | Bacteria | 2663 |
| 141 | Ga0207695_10248339 | 3300025913 | Bacteria | 1679 |
| 142 | Ga0207671_10000110 | 3300025914 | Bacteria | 126480 |
| 143 | Ga0207671_10001385 | 3300025914 | Bacteria | 28199 |
| 144 | Ga0207671_10067126 | 3300025914 | Bacteria | 2670 |
| 145 | Ga0207671_10302493 | 3300025914 | Bacteria | 1264 |
| 146 | Ga0207657_10011218 | 3300025919 | Bacteria | 8909 |
| 147 | Ga0207657_10065449 | 3300025919 | Bacteria | 3098 |
| 148 | Ga0207652_10034540 | 3300025921 | Bacteria | 4262 |
| 149 | Ga0207687_10193116 | 3300025927 | Bacteria | 1586 |
| 150 | Ga0207644_10006015 | 3300025931 | Bacteria | 7911 |
| 151 | Ga0207690_10000744 | 3300025932 | Bacteria | 21044 |
| 152 | Ga0207690_10035499 | 3300025932 | Bacteria | 3221 |
| 153 | Ga0207706_10000013 | 3300025933 | Bacteria | 188236 |
| 154 | Ga0207686_10040466 | 3300025934 | Bacteria | 2834 |
| 155 | Ga0207709_10142424 | 3300025935 | Bacteria | 1649 |
| 156 | Ga0207670_10106952 | 3300025936 | Bacteria | 2008 |
| 157 | Ga0207689_10223551 | 3300025942 | Bacteria | 1556 |
| 158 | Ga0207667_10000014 | 3300025949 | Bacteria | 421261 |
| 159 | Ga0207667_10000496 | 3300025949 | Bacteria | 51954 |
| 160 | Ga0207667_10084926 | 3300025949 | Bacteria | 3277 |
| 161 | Ga0207651_10102043 | 3300025960 | Bacteria | 2131 |
| 162 | Ga0207677_10016979 | 3300026023 | Bacteria | 4326 |
| 163 | Ga0207677_10116581 | 3300026023 | Bacteria | 2000 |
| 164 | Ga0207702_10000195 | 3300026078 | Bacteria | 71757 |
| 165 | Ga0207702_10011030 | 3300026078 | Bacteria | 7541 |
| 166 | Ga0207702_10019399 | 3300026078 | Bacteria | 5626 |
| 167 | Ga0207702_10043993 | 3300026078 | Bacteria | 3752 |
| 168 | Ga0207702_10118056 | 3300026078 | Bacteria | 2370 |
| 169 | Ga0207648_10001141 | 3300026089 | Bacteria | 29844 |
| 170 | Ga0207683_10008935 | 3300026121 | Bacteria | 8536 |
| 171 | Ga0207698_10026325 | 3300026142 | Bacteria | 4113 |
| 172 | Ga0207698_10352351 | 3300026142 | Bacteria | 1391 |
| 173 | Ga0268266_10000268 | 3300028379 | Bacteria | 85976 |
| 174 | Ga0268264_10063971 | 3300028381 | Bacteria | 3095 |
| 175 | Ga0307517_10000207 | 3300028786 | Bacteria | 99774 |
| 176 | Ga0316177_1195072 | 3300030731 | Bacteria | 9957 |
| 177 | Ga0316176_1017512 | 3300030732 | Bacteria | 17610 |
| 178 | Ga0316183_1098725 | 3300030742 | Bacteria | 33143 |
| 179 | Ga0316181_1188373 | 3300030744 | Bacteria | 5924 |
| 180 | Ga0316182_1077988 | 3300030745 | Bacteria | 2330 |
| 181 | Ga0265327_10015237 | 3300031251 | Bacteria | 4978 |
| 182 | Ga0307412_10000038 | 3300031911 | Bacteria | 187857 |
| 183 | Ga0307414_10001061 | 3300032004 | Bacteria | 14064 |
| 184 | Ga0307414_10051331 | 3300032004 | Bacteria | 2862 |
| 185 | Ga0307414_10070716 | 3300032004 | Bacteria | 2514 |
| 186 | Ga0307414_10142392 | 3300032004 | Bacteria | 1879 |
| 187 | Ga0307411_10465291 | 3300032005 | Bacteria | 1061 |
| 188 | Ga0307510_10331902 | 3300033180 | Bacteria | 975 |
| 189 | Ga0395899_0000027 | 3300037312 | Bacteria | 337387 |
| 190 | Ga0395899_0000325 | 3300037312 | Bacteria | 60438 |
| 191 | Ga0395899_0006674 | 3300037312 | Bacteria | 8940 |
| 192 | Ga0395899_0161227 | 3300037312 | Bacteria | 1584 |
| 193 | Ga0395900_0002139 | 3300037418 | Bacteria | 22114 |
| 194 | Ga0395900_0025254 | 3300037418 | Bacteria | 6082 |
| 195 | Ga0395900_0344440 | 3300037418 | Bacteria | 1465 |
| 196 | Ga0395900_0364373 | 3300037418 | Bacteria | 1416 |
| 197 | Ga0395898_0008551 | 3300037466 | Bacteria | 10807 |
| 198 | Ga0395905_0000001 | 3300037471 | Bacteria | 2037079 |
| 199 | Ga0395905_0000729 | 3300037471 | Bacteria | 43376 |
| 200 | Ga0395905_0012192 | 3300037471 | Bacteria | 8279 |
| 201 | Ga0395901_0008129 | 3300038443 | Bacteria | 10595 |
| 202 | Ga0395901_0113462 | 3300038443 | Bacteria | 2846 |
| 203 | Ga0395901_0117141 | 3300038443 | Bacteria | 2799 |
| 204 | Ga0436361_1223234 | 3300039447 | Bacteria | 16015 |
| 205 | Ga0439448_0001618 | 3300042005 | Bacteria | 5904 |
| 206 | Ga0466969_0028757 | 3300044656 | Bacteria | 2841 |
| 207 | Ga0466959_0035545 | 3300045049 | Bacteria | 3684 |
| 208 | Ga0466959_0042243 | 3300045049 | Bacteria | 3363 |
| 209 | Ga0495606_0131962 | 3300046507 | Bacteria | 1484 |
| 210 | Ga0495642_0107435 | 3300046528 | Bacteria | 1191 |
| 211 | Ga0495633_0000026 | 3300046558 | Bacteria | 204722 |
| 212 | Ga0495668_0060377 | 3300046616 | Bacteria | 2092 |
| 213 | Ga0495625_0021093 | 3300046660 | Bacteria | 5021 |
| 214 | Ga0495625_0024463 | 3300046660 | Bacteria | 4595 |
| 215 | Ga0495625_0063876 | 3300046660 | Bacteria | 2599 |
| 216 | Ga0495661_0017412 | 3300046665 | Bacteria | 4747 |
| 217 | Ga0495661_0113720 | 3300046665 | Bacteria | 1505 |
| 218 | Ga0495687_016331 | 3300047443 | Bacteria | 3735 |
| 219 | Ga0495677_0093579 | 3300047445 | Bacteria | 1134 |
| 220 | Ga0495684_0077946 | 3300047471 | Bacteria | 2515 |
| 221 | Ga0495686_0000319 | 3300047472 | Bacteria | 79929 |
| 222 | Ga0495686_0078119 | 3300047472 | Bacteria | 2026 |
| 223 | Ga0495686_0078187 | 3300047472 | Bacteria | 2025 |
| 224 | Ga0496122_0000219 | 3300048925 | Bacteria | 127599 |
| 225 | Ga0496123_0000866 | 3300048926 | Bacteria | 48135 |
| 226 | Ga0496125_0131467 | 3300048928 | Bacteria | 1761 |
| 227 | Ga0501241_000397 | 3300049758 | Bacteria | 9529 |
| 228 | Ga0501241_001761 | 3300049758 | Bacteria | 4297 |
| 229 | nmdc:mga0k408_57162_c1 | 3300050493 | Bacteria | 2264 |
| 230 | nmdc:mga0k408_82_c1 | 3300050493 | Bacteria | 45008 |
| 231 | Ga0500635_0067681 | 3300053080 | Bacteria | 1260 |
| 232 | Ga0500651_0000188 | 3300053093 | Bacteria | 39379 |
| 233 | Ga0500608_022507 | 3300053122 | Bacteria | 2922 |
| 234 | Ga0500618_003273 | 3300053125 | Bacteria | 5631 |
| 235 | Ga0500622_0000430 | 3300053156 | Bacteria | 39891 |
| 236 | 2738759019 | 2738541283 | Bacteria | 7222293 |
| 237 | 2738761869 | 2738541284 | Bacteria | 5199923 |
| 238 | 2739302208 | 2738543023 | Bacteria | 6767879 |
| 239 | 2740031155 | 2739367866 | Bacteria | 4215900 |
| 240 | 2776615486 | 2775506987 | Bacteria | 5373360 |
| 241 | 2839989734 | 2839989709 | Bacteria | 3773432 |
| 242 | 2842904833 | 2842903701 | Bacteria | 6986368 |
| 243 | 2852631125 | 2852627209 | Bacteria | 5896285 |
| 244 | 2910246275 | 2910245624 | Bacteria | 6935613 |
| 245 | 2919188702 | 2919186247 | Bacteria | 6244071 |
| 246 | 2919440278 | 2919437846 | Bacteria | 6199444 |
| 247 | 2939667143 | 2939664404 | Bacteria | 6364494 |
| 248 | 2977235641 | 2977232053 | Bacteria | 5485925 |
| 249 | 8055591158 | 8055588893 | Bacteria | 3619545 |
| 250 | Ga0105242_10213100 | |||
| 251 | SwRhRL2b_contig_1499193 | |||
| 252 | JGI24737J22298_10012064 | |||
| 253 | JGI24744J21845_10000638 | |||
| 254 | JGI25162J39368_1002524 | |||
| 255 | JGI25164J39214_1001000 | |||
| 256 | JGI25165J46597_1001414 | |||
| 257 | rootH2_10005722 | |||
| 258 | rootH2_10010675 | |||
| 259 | rootL2_10104480 | |||
| 260 | rootH1_10004106 | |||
| 261 | rootH1_10008491 | |||
| 262 | rootH1_10027719 | |||
| 263 | rootH1_10113461 | |||
| 264 | rootH1_10207062 | |||
| 265 | Ga0058862_10002966 | |||
| 266 | Ga0065714_10002497 | |||
| 267 | Ga0065714_10006626 | |||
| 268 | Ga0065714_10072461 | |||
| 269 | Ga0065704_10070196 | |||
| 270 | Ga0070658_10000060 | |||
| 271 | Ga0070676_10000152 | |||
| 272 | Ga0068868_100058296 | |||
| 273 | Ga0070660_100003098 | |||
| 274 | Ga0070671_100119164 | |||
| 275 | Ga0070673_100023354 | |||
| 276 | Ga0070659_100000199 | |||
| 277 | Ga0070678_100039620 | |||
| 278 | Ga0070662_100000935 | |||
| 279 | Ga0068867_100002522 | |||
| 280 | Ga0070679_100003968 | |||
| 281 | Ga0070684_100030112 | |||
| 282 | Ga0068853_100068684 | |||
| 283 | Ga0068853_100136812 | |||
| 284 | Ga0070665_100000264 | |||
| 285 | Ga0068855_100000098 | |||
| 286 | Ga0068855_100000149 | |||
| 287 | Ga0068855_100006331 | |||
| 288 | Ga0068855_100657145 | |||
| 289 | Ga0068856_100000120 | |||
| 290 | Ga0068856_100022739 | |||
| 291 | Ga0068856_100121179 | |||
| 292 | Ga0068856_100161090 | |||
| 293 | Ga0068856_100378718 | |||
| 294 | Ga0068852_100000389 | |||
| 295 | Ga0068852_100271362 | |||
| 296 | Ga0068852_100380485 | |||
| 297 | Ga0068852_100452426 | |||
| 298 | Ga0075366_10000422 | |||
| 299 | Ga0075366_10031784 | |||
| 300 | Ga0097621_100000232 | |||
| 301 | Ga0068871_100000800 | |||
| 302 | Ga0068865_100003071 | |||
| 303 | Ga0105240_10000371 | |||
| 304 | Ga0105240_10023602 | |||
| 305 | Ga0105240_10038607 | |||
| 306 | Ga0105240_10046333 | |||
| 307 | Ga0105240_10081965 | |||
| 308 | Ga0105240_10171846 | |||
| 309 | Ga0105240_10315671 | |||
| 310 | Ga0105245_10101136 | |||
| 311 | Ga0105243_10036187 | |||
| 312 | Ga0105241_10022400 | |||
| 313 | Ga0105241_10059378 | |||
| 314 | Ga0105241_10069808 | |||
| 315 | Ga0105241_10168506 | |||
| 316 | Ga0105237_10000120 | |||
| 317 | Ga0105237_10000535 | |||
| 318 | Ga0105237_10000632 | |||
| 319 | Ga0105237_10084704 | |||
| 320 | Ga0105237_10375998 | |||
| 321 | Ga0105237_10505460 | |||
| 322 | Ga0105238_10000612 | |||
| 323 | Ga0105238_10041104 | |||
| 324 | Ga0105238_10235440 | |||
| 325 | Ga0105239_10000009 | |||
| 326 | Ga0105239_10026119 | |||
| 327 | Ga0105239_10105640 | |||
| 328 | Ga0105239_10200891 | |||
| 329 | Ga0105239_10339255 | |||
| 330 | Ga0105246_10018736 | |||
| 331 | Ga0157373_10000125 | |||
| 332 | Ga0157373_10001788 | |||
| 333 | Ga0157373_10045754 | |||
| 334 | Ga0157371_10001492 | |||
| 335 | Ga0157371_10001547 | |||
| 336 | Ga0157371_10002309 | |||
| 337 | Ga0157371_10017132 | |||
| 338 | Ga0157371_10023021 | |||
| 339 | Ga0157370_10015888 | |||
| 340 | Ga0157370_10018164 | |||
| 341 | Ga0157370_10031837 | |||
| 342 | Ga0157370_10046883 | |||
| 343 | Ga0157370_10047237 | |||
| 344 | Ga0157370_10052273 | |||
| 345 | Ga0157370_10734468 | |||
| 346 | Ga0157369_10034465 | |||
| 347 | Ga0157369_10043369 | |||
| 348 | Ga0157369_10070465 | |||
| 349 | Ga0157369_10567499 | |||
| 350 | Ga0157374_10033011 | |||
| 351 | Ga0157378_10028615 | |||
| 352 | Ga0157378_10061050 | |||
| 353 | Ga0157378_10110260 | |||
| 354 | Ga0163162_10000008 | |||
| 355 | Ga0163162_10005211 | |||
| 356 | Ga0157372_10000190 | |||
| 357 | Ga0157372_10000404 | |||
| 358 | Ga0157372_10005833 | |||
| 359 | Ga0157372_10014925 | |||
| 360 | Ga0157372_10131838 | |||
| 361 | Ga0157375_10024294 | |||
| 362 | Ga0157375_10104687 | |||
| 363 | Ga0157375_10311599 | |||
| 364 | Ga0157380_10000010 | |||
| 365 | Ga0182008_10000002 | |||
| 366 | Ga0182008_10000438 | |||
| 367 | Ga0182006_1000870 | |||
| 368 | Ga0182006_1001113 | |||
| 369 | Ga0182006_1001237 | |||
| 370 | Ga0182007_10011138 | |||
| 371 | Ga0163161_10000194 | |||
| 372 | Ga0213872_10026217 | |||
| 373 | Ga0207427_100131 | |||
| 374 | Ga0209437_100048 | |||
| 375 | Ga0209026_1000683 | |||
| 376 | Ga0209233_1000029 | |||
| 377 | Ga0209455_1002941 | |||
| 378 | Ga0207647_10000546 | |||
| 379 | Ga0207645_10000948 | |||
| 380 | Ga0207705_10000233 | |||
| 381 | Ga0207705_10029816 | |||
| 382 | Ga0207705_10046566 | |||
| 383 | Ga0207654_10010858 | |||
| 384 | Ga0207654_10012272 | |||
| 385 | Ga0207654_10308969 | |||
| 386 | Ga0207695_10000142 | |||
| 387 | Ga0207695_10002312 | |||
| 388 | Ga0207695_10009569 | |||
| 389 | Ga0207695_10115124 | |||
| 390 | Ga0207695_10248339 | |||
| 391 | Ga0207671_10000110 | |||
| 392 | Ga0207671_10001385 | |||
| 393 | Ga0207671_10067126 | |||
| 394 | Ga0207671_10302493 | |||
| 395 | Ga0207657_10011218 | |||
| 396 | Ga0207657_10065449 | |||
| 397 | Ga0207652_10034540 | |||
| 398 | Ga0207687_10193116 | |||
| 399 | Ga0207644_10006015 | |||
| 400 | Ga0207690_10000744 | |||
| 401 | Ga0207690_10035499 | |||
| 402 | Ga0207706_10000013 | |||
| 403 | Ga0207686_10040466 | |||
| 404 | Ga0207709_10142424 | |||
| 405 | Ga0207670_10106952 | |||
| 406 | Ga0207689_10223551 | |||
| 407 | Ga0207667_10000014 | |||
| 408 | Ga0207667_10000496 | |||
| 409 | Ga0207667_10084926 | |||
| 410 | Ga0207651_10102043 | |||
| 411 | Ga0207677_10016979 | |||
| 412 | Ga0207677_10116581 | |||
| 413 | Ga0207702_10000195 | |||
| 414 | Ga0207702_10011030 | |||
| 415 | Ga0207702_10019399 | |||
| 416 | Ga0207702_10043993 | |||
| 417 | Ga0207702_10118056 | |||
| 418 | Ga0207648_10001141 | |||
| 419 | Ga0207683_10008935 | |||
| 420 | Ga0207698_10026325 | |||
| 421 | Ga0207698_10352351 | |||
| 422 | Ga0268266_10000268 | |||
| 423 | Ga0268264_10063971 | |||
| 424 | Ga0307517_10000207 | |||
| 425 | Ga0316177_1195072 | |||
| 426 | Ga0316176_1017512 | |||
| 427 | Ga0316183_1098725 | |||
| 428 | Ga0316181_1188373 | |||
| 429 | Ga0316182_1077988 | |||
| 430 | Ga0265327_10015237 | |||
| 431 | Ga0307412_10000038 | |||
| 432 | Ga0307414_10001061 | |||
| 433 | Ga0307414_10051331 | |||
| 434 | Ga0307414_10070716 | |||
| 435 | Ga0307414_10142392 | |||
| 436 | Ga0307411_10465291 | |||
| 437 | Ga0307510_10331902 | |||
| 438 | Ga0395899_0000027 | |||
| 439 | Ga0395899_0000325 | |||
| 440 | Ga0395899_0006674 | |||
| 441 | Ga0395899_0161227 | |||
| 442 | Ga0395900_0002139 | |||
| 443 | Ga0395900_0025254 | |||
| 444 | Ga0395900_0344440 | |||
| 445 | Ga0395900_0364373 | |||
| 446 | Ga0395898_0008551 | |||
| 447 | Ga0395905_0000001 | |||
| 448 | Ga0395905_0000729 | |||
| 449 | Ga0395905_0012192 | |||
| 450 | Ga0395901_0008129 | |||
| 451 | Ga0395901_0113462 | |||
| 452 | Ga0395901_0117141 | |||
| 453 | Ga0436361_1223234 | |||
| 454 | Ga0439448_0001618 | |||
| 455 | Ga0466969_0028757 | |||
| 456 | Ga0466959_0035545 | |||
| 457 | Ga0466959_0042243 | |||
| 458 | Ga0495606_0131962 | |||
| 459 | Ga0495642_0107435 | |||
| 460 | Ga0495633_0000026 | |||
| 461 | Ga0495668_0060377 | |||
| 462 | Ga0495625_0021093 | |||
| 463 | Ga0495625_0024463 | |||
| 464 | Ga0495625_0063876 | |||
| 465 | Ga0495661_0017412 | |||
| 466 | Ga0495661_0113720 | |||
| 467 | Ga0495687_016331 | |||
| 468 | Ga0495677_0093579 | |||
| 469 | Ga0495684_0077946 | |||
| 470 | Ga0495686_0000319 | |||
| 471 | Ga0495686_0078119 | |||
| 472 | Ga0495686_0078187 | |||
| 473 | Ga0496122_0000219 | |||
| 474 | Ga0496123_0000866 | |||
| 475 | Ga0496125_0131467 | |||
| 476 | Ga0501241_000397 | |||
| 477 | Ga0501241_001761 | |||
| 478 | nmdc:mga0k408_57162_c1 | |||
| 479 | nmdc:mga0k408_82_c1 | |||
| 480 | Ga0500635_0067681 | |||
| 481 | Ga0500651_0000188 | |||
| 482 | Ga0500608_022507 | |||
| 483 | Ga0500618_003273 | |||
| 484 | Ga0500622_0000430 | |||
| 485 | 2738759019 | |||
| 486 | 2738761869 | |||
| 487 | 2739302208 | |||
| 488 | 2740031155 | |||
| 489 | 2776615486 | |||
| 490 | 2839989734 | |||
| 491 | 2842904833 | |||
| 492 | 2852631125 | |||
| 493 | 2910246275 | |||
| 494 | 2919188702 | |||
| 495 | 2919440278 | |||
| 496 | 2939667143 | |||
| 497 | 2977235641 | |||
| 498 | 8055591158 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7bpu-assembly1.cif.gz_A | structural and mechanistic insights into the biosynthesis of digeranylgeranylglyceryl phosphate synthase in membranes | 0.8387 | 5 | 292 |
| 7bpu-assembly1.cif.gz_A | structural and mechanistic insights into the biosynthesis of digeranylgeranylglyceryl phosphate synthase in membranes | 0.8281 | 5 | 292 |
| 4od4-assembly1.cif.gz_A | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.7566 | 15 | 291 |
| 4tq4-assembly3.cif.gz_C | structure of a ubia homolog from archaeoglobus fulgidus bound to dmapp and mg2+ | 0.7507 | 7 | 292 |
| 4tq3-assembly1.cif.gz_A | structure of a ubia homolog from archaeoglobus fulgidus bound to gpp and mg2+ | 0.7441 | 7 | 286 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_F1LVF4_158_307_1.10.357.140 | Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase | 0.9636 | 15 | 167 | 1.10.357.140 |
| af_A4I0M3_131_276_1.10.357.140 | Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase | 0.961 | 15 | 167 | 1.10.357.140 |
| af_Q9Y7Y4_92_240_1.10.357.140 | Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase | 0.9609 | 15 | 163 | 1.10.357.140 |
| af_I1NJ83_69_223_1.10.357.140 | Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase | 0.9562 | 15 | 169 | 1.10.357.140 |
| af_P0AEA5_14_182_1.10.357.140 | Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase | 0.9518 | 17 | 188 | 1.10.357.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A519WD51-F1-model_v4 | heme o synthase (EC 2.5.1.141) | 0.9889 | 156 | 292 |
GO:0006783
GO:0008495 GO:0016020 |
| AF-A0A4Q6DWF4-F1-model_v4 | Heme o synthase (EC 2.5.1.141) | 0.9835 | 52 | 292 |
GO:0006784
GO:0008495 GO:0016020 |
| AF-A0A2E4EBK2-F1-model_v4 | Protoheme IX farnesyltransferase (EC 2.5.1.141) (Heme B farnesyltransferase) (Heme O synthase) | 0.9833 | 2 | 288 |
GO:0005886
GO:0006784 GO:0008495 GO:0048034 |
| AF-F4C3E1-F1-model_v4 | Protoheme IX farnesyltransferase (EC 2.5.1.141) (Heme B farnesyltransferase) (Heme O synthase) | 0.9823 | 1 | 288 |
GO:0005886
GO:0006784 GO:0008495 GO:0048034 |
| AF-A0A524JBW9-F1-model_v4 | heme o synthase (EC 2.5.1.141) | 0.9821 | 5 | 181 |
GO:0006784
GO:0008495 GO:0016020 |