F360764

General Info

Members Datasets Scaffolds Average Seq Length
249 147 249 119

Family's Representative Sequence

Representative Sequence 3300014969|Ga0157376_10723185|Ga0157376_107231852
Length 119
Sequence MIFGAHVVVYSKDATADRAFFREVLGTTSVDAGHGWLIFALPPAEVAVHPAEEHAGEEEPYFMCDDLKSEISALREKGVRCADVQEARWGSITKIRLPGGGEVGLYQPKHPIAVVRTSH

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
56 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
110 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
111 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
112 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
113 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
114 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
115 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
116 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
119 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
120 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
121 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
122 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
123 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
124 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
125 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
126 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
127 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
128 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
129 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
130 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
131 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
132 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
133 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
134 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
135 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
136 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
137 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
138 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
139 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
140 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
141 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
142 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
143 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
144 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
145 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
146 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
147 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.61
Nodule 0
Rhizoplane 4.82
Rhizosphere 90.36
Stem 0
Stem Tuber 0
Unclassified 1.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10033281 3300003316 Bacteria 2808
2 rootH2_10253761 3300003320 Bacteria 2823
3 rootL2_10101055 3300003322 Bacteria 7167
4 Ga0065707_10254295 3300005295 Bacteria 1115
5 Ga0070690_100406416 3300005330 Bacteria 1001
6 Ga0070666_10162397 3300005335 Bacteria 1562
7 Ga0070680_100008476 3300005336 Bacteria 7872
8 Ga0070689_101782304 3300005340 Unclassified 561
9 Ga0070687_100500920 3300005343 Bacteria 817
10 Ga0070692_10040730 3300005345 Bacteria 2377
11 Ga0070668_101852925 3300005347 Bacteria 555
12 Ga0070703_10017922 3300005406 Unclassified 2043
13 Ga0070709_10066026 3300005434 Bacteria 2319
14 Ga0070713_100293435 3300005436 Unclassified 1495
15 Ga0070701_10014930 3300005438 Bacteria 3573
16 Ga0070705_100129208 3300005440 Bacteria 1645
17 Ga0070705_101105979 3300005440 Bacteria 648
18 Ga0070694_100002984 3300005444 Bacteria 10056
19 Ga0070694_100045077 3300005444 Bacteria 2954
20 Ga0070694_101564270 3300005444 Bacteria 559
21 Ga0070708_100001578 3300005445 Bacteria 17464
22 Ga0070708_100012519 3300005445 Bacteria 6924
23 Ga0070708_100091436 3300005445 Bacteria 2771
24 Ga0070708_100480040 3300005445 Bacteria 1173
25 Ga0070708_100495069 3300005445 Bacteria 1153
26 Ga0070708_101221237 3300005445 Unclassified 703
27 Ga0070708_101338766 3300005445 Bacteria 668
28 Ga0070708_101443290 3300005445 Unclassified 641
29 Ga0070708_101554662 3300005445 Bacteria 616
30 Ga0070678_100041722 3300005456 Bacteria 3255
31 Ga0070681_10104611 3300005458 Bacteria 2773
32 Ga0070681_10348367 3300005458 Bacteria 1391
33 Ga0070706_100067360 3300005467 Bacteria 3311
34 Ga0070706_100128850 3300005467 Unclassified 2360
35 Ga0070706_100141071 3300005467 Bacteria 2250
36 Ga0070706_100177543 3300005467 Bacteria 1988
37 Ga0070706_100180096 3300005467 Unclassified 1973
38 Ga0070706_100198088 3300005467 Bacteria 1876
39 Ga0070707_100068382 3300005468 Unclassified 3419
40 Ga0070707_100139297 3300005468 Bacteria 2361
41 Ga0070707_100198086 3300005468 Unclassified 1958
42 Ga0070707_100376451 3300005468 Bacteria 1379
43 Ga0070707_100443276 3300005468 Bacteria 1259
44 Ga0070707_100493178 3300005468 Bacteria 1186
45 Ga0070707_100844844 3300005468 Unclassified 880
46 Ga0070698_100000291 3300005471 Bacteria 50991
47 Ga0070698_100060703 3300005471 Bacteria 3815
48 Ga0070698_100128633 3300005471 Unclassified 2489
49 Ga0070698_100204758 3300005471 Bacteria 1908
50 Ga0070698_100311888 3300005471 Bacteria 1504
51 Ga0070698_100765221 3300005471 Bacteria 909
52 Ga0070698_101366205 3300005471 Unclassified 659
53 Ga0070698_102187932 3300005471 Unclassified 507
54 Ga0070699_100028555 3300005518 Bacteria 4810
55 Ga0070699_100041231 3300005518 Unclassified 3997
56 Ga0070699_100050327 3300005518 Unclassified 3607
57 Ga0070699_100184989 3300005518 Unclassified 1850
58 Ga0070699_100340338 3300005518 Bacteria 1350
59 Ga0070699_100536720 3300005518 Unclassified 1064
60 Ga0070699_100651266 3300005518 Bacteria 961
61 Ga0070699_101342971 3300005518 Bacteria 656
62 Ga0070679_100150233 3300005530 Unclassified 2306
63 Ga0070679_100300464 3300005530 Bacteria 1556
64 Ga0070697_100041082 3300005536 Bacteria 3742
65 Ga0070697_100245011 3300005536 Bacteria 1531
66 Ga0070697_100274083 3300005536 Bacteria 1447
67 Ga0070697_100534749 3300005536 Bacteria 1027
68 Ga0070697_100633850 3300005536 Bacteria 941
69 Ga0070697_101272784 3300005536 Unclassified 656
70 Ga0070697_101361461 3300005536 Unclassified 633
71 Ga0070697_101782824 3300005536 Unclassified 551
72 Ga0068853_100036461 3300005539 Unclassified 4182
73 Ga0068853_100513625 3300005539 Unclassified 1132
74 Ga0070686_100830341 3300005544 Bacteria 747
75 Ga0070695_100000156 3300005545 Bacteria 32250
76 Ga0070695_100052286 3300005545 Bacteria 2624
77 Ga0070695_100936135 3300005545 Bacteria 701
78 Ga0070695_101818485 3300005545 Bacteria 511
79 Ga0070695_101850904 3300005545 Unclassified 507
80 Ga0070696_100497078 3300005546 Bacteria 970
81 Ga0070696_100689708 3300005546 Bacteria 831
82 Ga0070696_100829002 3300005546 Unclassified 763
83 Ga0070693_100000697 3300005547 Bacteria 14842
84 Ga0070704_100003502 3300005549 Bacteria 9011
85 Ga0070704_100066573 3300005549 Bacteria 2598
86 Ga0070704_100484410 3300005549 Bacteria 1071
87 Ga0068855_101965711 3300005563 Unclassified 591
88 Ga0068855_101996951 3300005563 Unclassified 586
89 Ga0068857_101530295 3300005577 Unclassified 650
90 Ga0068854_101582223 3300005578 Unclassified 597
91 Ga0068856_100627686 3300005614 Bacteria 1095
92 Ga0068859_100214327 3300005617 Unclassified 2013
93 Ga0068863_100112517 3300005841 Bacteria 2593
94 Ga0068863_100383414 3300005841 Bacteria 1373
95 Ga0068863_100747408 3300005841 Bacteria 974
96 Ga0068863_102159998 3300005841 Unclassified 567
97 Ga0068860_100792603 3300005843 Bacteria 961
98 Ga0068862_102150202 3300005844 Bacteria 569
99 Ga0070717_10040492 3300006028 Bacteria 3795
100 Ga0070717_11801470 3300006028 Unclassified 553
101 Ga0075365_10189006 3300006038 Bacteria 1441
102 Ga0075363_100323624 3300006048 Bacteria 897
103 Ga0070715_10456108 3300006163 Unclassified 723
104 Ga0070716_101626374 3300006173 Unclassified 531
105 Ga0075367_10732393 3300006178 Bacteria 629
106 Ga0075366_10942541 3300006195 Bacteria 538
107 Ga0097621_101011462 3300006237 Unclassified 778
108 Ga0068871_100189317 3300006358 Unclassified 1772
109 Ga0075431_101991511 3300006847 Bacteria 536
110 Ga0075433_11056665 3300006852 Unclassified 706
111 Ga0075436_100056473 3300006914 Bacteria 2711
112 Ga0075436_100110357 3300006914 Bacteria 1919
113 Ga0097620_100214336 3300006931 Unclassified 2013
114 Ga0075435_101073260 3300007076 Unclassified 704
115 Ga0099794_10012000 3300007265 Bacteria 3726
116 Ga0099795_10216851 3300007788 Bacteria 813
117 Ga0105240_10016670 3300009093 Bacteria 9937
118 Ga0105240_10242896 3300009093 Bacteria 2087
119 Ga0105240_10841147 3300009093 Unclassified 991
120 Ga0111539_10858331 3300009094 Bacteria 1056
121 Ga0111539_11709846 3300009094 Unclassified 730
122 Ga0105245_10056058 3300009098 Bacteria 3541
123 Ga0114129_10598140 3300009147 Unclassified 1429
124 Ga0114129_12559394 3300009147 Bacteria 609
125 Ga0105243_10145169 3300009148 Bacteria 2029
126 Ga0105241_10723554 3300009174 Bacteria 910
127 Ga0105242_10052836 3300009176 Bacteria 3317
128 Ga0105242_12189156 3300009176 Bacteria 598
129 Ga0105248_10091918 3300009177 Unclassified 3417
130 Ga0105248_11444456 3300009177 Unclassified 778
131 Ga0105237_10026620 3300009545 Bacteria 5911
132 Ga0105237_10122885 3300009545 Bacteria 2590
133 Ga0105238_10072189 3300009551 Bacteria 3448
134 Ga0105249_11675759 3300009553 Bacteria 708
135 Ga0099796_10147849 3300010159 Bacteria 923
136 Ga0105239_10084353 3300010375 Bacteria 3499
137 Ga0105239_11498619 3300010375 Unclassified 779
138 Ga0105239_13451057 3300010375 Unclassified 514
139 Ga0157371_11483885 3300013102 Unclassified 528
140 Ga0157374_10156640 3300013296 Bacteria 2217
141 Ga0157378_10315497 3300013297 Unclassified 1517
142 Ga0157378_10439052 3300013297 Bacteria 1293
143 Ga0157378_11861550 3300013297 Unclassified 650
144 Ga0157378_13179245 3300013297 Unclassified 510
145 Ga0163162_10210990 3300013306 Bacteria 2072
146 Ga0163162_12247914 3300013306 Bacteria 626
147 Ga0157372_10502103 3300013307 Unclassified 1414
148 Ga0163163_10119224 3300014325 Bacteria 2672
149 Ga0163163_12419118 3300014325 Bacteria 584
150 Ga0157380_10427861 3300014326 Bacteria 1264
151 Ga0157380_12290901 3300014326 Unclassified 605
152 Ga0157379_10207070 3300014968 Bacteria 1775
153 Ga0157376_10146328 3300014969 Bacteria 2126
154 Ga0157376_10504340 3300014969 Unclassified 1190
155 Ga0157376_10723185 3300014969 Bacteria 1003
156 Ga0163161_11514502 3300017792 Bacteria 589
157 Ga0207653_10043245 3300025885 Unclassified 1483
158 Ga0207684_10140557 3300025910 Bacteria 2075
159 Ga0207684_10150112 3300025910 Bacteria 2005
160 Ga0207684_10168113 3300025910 Bacteria 1890
161 Ga0207684_10241992 3300025910 Unclassified 1557
162 Ga0207684_10341697 3300025910 Bacteria 1289
163 Ga0207684_10974691 3300025910 Unclassified 710
164 Ga0207684_11685274 3300025910 Unclassified 511
165 Ga0207707_10103141 3300025912 Bacteria 2493
166 Ga0207707_10172819 3300025912 Bacteria 1888
167 Ga0207695_10079858 3300025913 Bacteria 3314
168 Ga0207671_10141005 3300025914 Bacteria 1857
169 Ga0207671_10166734 3300025914 Bacteria 1708
170 Ga0207663_11454950 3300025916 Bacteria 552
171 Ga0207660_10012412 3300025917 Bacteria 5574
172 Ga0207660_11499139 3300025917 Unclassified 545
173 Ga0207662_10162369 3300025918 Bacteria 1428
174 Ga0207652_10122978 3300025921 Unclassified 2310
175 Ga0207652_10203078 3300025921 Bacteria 1784
176 Ga0207646_10003625 3300025922 Bacteria 17280
177 Ga0207646_10031431 3300025922 Bacteria 4806
178 Ga0207646_10322601 3300025922 Bacteria 1396
179 Ga0207646_10402597 3300025922 Bacteria 1236
180 Ga0207694_10119927 3300025924 Bacteria 2099
181 Ga0207694_10633363 3300025924 Unclassified 900
182 Ga0207687_10005017 3300025927 Bacteria 8765
183 Ga0207700_10163115 3300025928 Unclassified 1852
184 Ga0207686_10024122 3300025934 Bacteria 3520
185 Ga0207709_10758163 3300025935 Unclassified 781
186 Ga0207711_10042799 3300025941 Unclassified 3859
187 Ga0207689_10756127 3300025942 Unclassified 820
188 Ga0207667_11330703 3300025949 Unclassified 694
189 Ga0207640_11320684 3300025981 Unclassified 644
190 Ga0207658_11099165 3300025986 Unclassified 726
191 Ga0207677_10061153 3300026023 Bacteria 2607
192 Ga0207703_10329798 3300026035 Bacteria 1400
193 Ga0207639_10068609 3300026041 Bacteria 2764
194 Ga0207702_10306843 3300026078 Unclassified 1508
195 Ga0207641_10032361 3300026088 Bacteria 4342
196 Ga0207641_11018231 3300026088 Bacteria 825
197 Ga0207641_11094743 3300026088 Bacteria 795
198 Ga0207674_11343624 3300026116 Unclassified 684
199 Ga0207683_10023025 3300026121 Bacteria 5353
200 Ga0209588_1019591 3300027671 Unclassified 2113
201 Ga0268264_10754988 3300028381 Bacteria 969
202 Ga0265338_10305541 3300028800 Unclassified 1155
203 Ga0265331_10074703 3300031250 Bacteria 1581
204 Ga0265331_10115265 3300031250 Unclassified 1230
205 Ga0373936_0063347 3300035113 Bacteria 1514
206 Ga0373946_0148073 3300035171 Bacteria 1093
207 Ga0373935_0174525 3300035692 Unclassified 1472
208 Ga0373927_0000683 3300035695 Bacteria 25847
209 Ga0373927_0052665 3300035695 Bacteria 2632
210 Ga0373927_0059203 3300035695 Bacteria 2478
211 Ga0373947_0012711 3300035725 Bacteria 4827
212 Ga0373947_0230067 3300035725 Bacteria 1221
213 Ga0373947_0282524 3300035725 Bacteria 1104
214 Ga0373925_0000564 3300037068 Bacteria 36366
215 Ga0395905_1226309 3300037471 Unclassified 654
216 Ga0439460_0314097 3300042461 Bacteria 549
217 Ga0453683_0397113 3300044673 Bacteria 889
218 Ga0495580_0752128 3300046472 Unclassified 635
219 Ga0495630_0523707 3300046517 Bacteria 909
220 Ga0495630_1347332 3300046517 Unclassified 537
221 Ga0495631_0206425 3300046518 Bacteria 840
222 Ga0495644_0058054 3300046523 Bacteria 1455
223 Ga0495666_0296884 3300046526 Bacteria 731
224 Ga0495621_0146244 3300046539 Unclassified 927
225 Ga0495667_0210752 3300046559 Unclassified 1242
226 Ga0495656_0048286 3300046615 Bacteria 1808
227 Ga0495636_0228468 3300047318 Unclassified 856
228 Ga0496102_0971562 3300048905 Unclassified 770
229 Ga0496103_0280182 3300048906 Unclassified 1072
230 Ga0496104_0399181 3300048907 Bacteria 1287
231 Ga0496105_0151621 3300048908 Unclassified 1905
232 Ga0496108_0014076 3300048911 Bacteria 6526
233 Ga0496109_0076297 3300048912 Bacteria 3083
234 Ga0496110_0207988 3300048913 Bacteria 1778
235 Ga0496111_0028345 3300048914 Bacteria 3968
236 Ga0496114_0004307 3300048917 Bacteria 11016
237 Ga0496115_0221039 3300048918 Bacteria 1563
238 Ga0496115_0294200 3300048918 Unclassified 1331
239 Ga0496115_0397997 3300048918 Bacteria 1118
240 nmdc:mga03683_486969_c1 3300050489 Bacteria 596
241 nmdc:mga03n38_573889_c1 3300050490 Bacteria 640
242 nmdc:mga0yw44_1008690_c1 3300050492 Bacteria 563
243 nmdc:mga0k408_770701_c1 3300050493 Bacteria 561
244 nmdc:mga06z11_303401_c1 3300050494 Bacteria 950
245 nmdc:mga05p37_373657_c1 3300050507 Bacteria 1672
246 nmdc:mga0rr50_520393_c1 3300050513 Unclassified 1012
247 nmdc:mga08x19_126902_c1 3300050514 Bacteria 1714
248 nmdc:mga08x19_8151_c1 3300050514 Bacteria 6227
249 nmdc:mga0a205_373013_c1 3300050515 Unclassified 1293

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046539 Ga0495621_0146244 Ga0495621_0146244_280_606 107
2 3300003316 rootH1_10033281 rootH1_100332815 116
3 3300003320 rootH2_10253761 rootH2_102537613 116
4 3300003322 rootL2_10101055 rootL2_101010556 116
5 3300005295 Ga0065707_10254295 Ga0065707_102542952 116
6 3300005330 Ga0070690_100406416 Ga0070690_1004064162 116
7 3300005335 Ga0070666_10162397 Ga0070666_101623973 116
8 3300005336 Ga0070680_100008476 Ga0070680_1000084769 116
9 3300005340 Ga0070689_101782304 Ga0070689_1017823041 116
10 3300005343 Ga0070687_100500920 Ga0070687_1005009201 116
11 3300005345 Ga0070692_10040730 Ga0070692_100407303 116
12 3300005347 Ga0070668_101852925 Ga0070668_1018529251 116
13 3300005406 Ga0070703_10017922 Ga0070703_100179222 116
14 3300005434 Ga0070709_10066026 Ga0070709_100660263 116
15 3300005436 Ga0070713_100293435 Ga0070713_1002934352 116
16 3300005438 Ga0070701_10014930 Ga0070701_100149303 116
17 3300005440 Ga0070705_100129208 Ga0070705_1001292082 116
18 3300005440 Ga0070705_101105979 Ga0070705_1011059792 116
19 3300005444 Ga0070694_100002984 Ga0070694_1000029847 116
20 3300005444 Ga0070694_100045077 Ga0070694_1000450776 116
21 3300005444 Ga0070694_101564270 Ga0070694_1015642701 116
22 3300005445 Ga0070708_100001578 Ga0070708_1000015785 116
23 3300005445 Ga0070708_100012519 Ga0070708_1000125198 116
24 3300005445 Ga0070708_100091436 Ga0070708_1000914363 116
25 3300005445 Ga0070708_100480040 Ga0070708_1004800401 116
26 3300005445 Ga0070708_100495069 Ga0070708_1004950693 116
27 3300005445 Ga0070708_101221237 Ga0070708_1012212371 116
28 3300005445 Ga0070708_101338766 Ga0070708_1013387661 116
29 3300005445 Ga0070708_101443290 Ga0070708_1014432901 116
30 3300005445 Ga0070708_101554662 Ga0070708_1015546621 116
31 3300005456 Ga0070678_100041722 Ga0070678_1000417224 116
32 3300005458 Ga0070681_10104611 Ga0070681_101046112 116
33 3300005458 Ga0070681_10348367 Ga0070681_103483673 116
34 3300005467 Ga0070706_100067360 Ga0070706_1000673603 116
35 3300005467 Ga0070706_100128850 Ga0070706_1001288502 116
36 3300005467 Ga0070706_100141071 Ga0070706_1001410712 116
37 3300005467 Ga0070706_100177543 Ga0070706_1001775434 116
38 3300005467 Ga0070706_100180096 Ga0070706_1001800963 116
39 3300005467 Ga0070706_100198088 Ga0070706_1001980882 116
40 3300005468 Ga0070707_100068382 Ga0070707_1000683823 116
41 3300005468 Ga0070707_100139297 Ga0070707_1001392971 116
42 3300005468 Ga0070707_100198086 Ga0070707_1001980863 116
43 3300005468 Ga0070707_100376451 Ga0070707_1003764512 116
44 3300005468 Ga0070707_100443276 Ga0070707_1004432762 116
45 3300005468 Ga0070707_100493178 Ga0070707_1004931782 116
46 3300005468 Ga0070707_100844844 Ga0070707_1008448441 116
47 3300005471 Ga0070698_100000291 Ga0070698_10000029148 116
48 3300005471 Ga0070698_100060703 Ga0070698_1000607032 116
49 3300005471 Ga0070698_100128633 Ga0070698_1001286334 116
50 3300005471 Ga0070698_100204758 Ga0070698_1002047582 116
51 3300005471 Ga0070698_100311888 Ga0070698_1003118882 116
52 3300005471 Ga0070698_100765221 Ga0070698_1007652212 116
53 3300005471 Ga0070698_101366205 Ga0070698_1013662051 116
54 3300005471 Ga0070698_102187932 Ga0070698_1021879321 116
55 3300005518 Ga0070699_100028555 Ga0070699_1000285555 116
56 3300005518 Ga0070699_100041231 Ga0070699_1000412315 116
57 3300005518 Ga0070699_100050327 Ga0070699_1000503272 116
58 3300005518 Ga0070699_100184989 Ga0070699_1001849893 116
59 3300005518 Ga0070699_100340338 Ga0070699_1003403383 116
60 3300005518 Ga0070699_100536720 Ga0070699_1005367202 116
61 3300005518 Ga0070699_100651266 Ga0070699_1006512661 116
62 3300005518 Ga0070699_101342971 Ga0070699_1013429711 116
63 3300005530 Ga0070679_100150233 Ga0070679_1001502332 116
64 3300005530 Ga0070679_100300464 Ga0070679_1003004641 116
65 3300005536 Ga0070697_100041082 Ga0070697_1000410822 116
66 3300005536 Ga0070697_100245011 Ga0070697_1002450111 116
67 3300005536 Ga0070697_100274083 Ga0070697_1002740831 116
68 3300005536 Ga0070697_100534749 Ga0070697_1005347491 116
69 3300005536 Ga0070697_100633850 Ga0070697_1006338502 116
70 3300005536 Ga0070697_101272784 Ga0070697_1012727841 116
71 3300005536 Ga0070697_101361461 Ga0070697_1013614611 116
72 3300005536 Ga0070697_101782824 Ga0070697_1017828242 116
73 3300005539 Ga0068853_100036461 Ga0068853_1000364613 116
74 3300005539 Ga0068853_100513625 Ga0068853_1005136254 116
75 3300005544 Ga0070686_100830341 Ga0070686_1008303411 116
76 3300005545 Ga0070695_100000156 Ga0070695_10000015612 116
77 3300005545 Ga0070695_100052286 Ga0070695_1000522864 116
78 3300005545 Ga0070695_100936135 Ga0070695_1009361352 116
79 3300005545 Ga0070695_101818485 Ga0070695_1018184851 116
80 3300005545 Ga0070695_101850904 Ga0070695_1018509041 116
81 3300005546 Ga0070696_100497078 Ga0070696_1004970782 116
82 3300005546 Ga0070696_100689708 Ga0070696_1006897082 116
83 3300005546 Ga0070696_100829002 Ga0070696_1008290021 116
84 3300005547 Ga0070693_100000697 Ga0070693_1000006978 116
85 3300005549 Ga0070704_100003502 Ga0070704_1000035028 116
86 3300005549 Ga0070704_100066573 Ga0070704_1000665731 116
87 3300005549 Ga0070704_100484410 Ga0070704_1004844102 116
88 3300005563 Ga0068855_101965711 Ga0068855_1019657111 116
89 3300005563 Ga0068855_101996951 Ga0068855_1019969512 116
90 3300005577 Ga0068857_101530295 Ga0068857_1015302952 116
91 3300005578 Ga0068854_101582223 Ga0068854_1015822232 116
92 3300005614 Ga0068856_100627686 Ga0068856_1006276862 116
93 3300005617 Ga0068859_100214327 Ga0068859_1002143273 116
94 3300005841 Ga0068863_100112517 Ga0068863_1001125172 116
95 3300005841 Ga0068863_100383414 Ga0068863_1003834142 116
96 3300005841 Ga0068863_100747408 Ga0068863_1007474081 116
97 3300005841 Ga0068863_102159998 Ga0068863_1021599981 116
98 3300005843 Ga0068860_100792603 Ga0068860_1007926032 116
99 3300005844 Ga0068862_102150202 Ga0068862_1021502021 116
100 3300006028 Ga0070717_10040492 Ga0070717_100404921 116
101 3300006028 Ga0070717_11801470 Ga0070717_118014702 116
102 3300006038 Ga0075365_10189006 Ga0075365_101890063 116
103 3300006048 Ga0075363_100323624 Ga0075363_1003236242 116
104 3300006163 Ga0070715_10456108 Ga0070715_104561082 116
105 3300006173 Ga0070716_101626374 Ga0070716_1016263742 116
106 3300006178 Ga0075367_10732393 Ga0075367_107323932 116
107 3300006195 Ga0075366_10942541 Ga0075366_109425411 116
108 3300006237 Ga0097621_101011462 Ga0097621_1010114622 116
109 3300006358 Ga0068871_100189317 Ga0068871_1001893172 116
110 3300006847 Ga0075431_101991511 Ga0075431_1019915112 116
111 3300006852 Ga0075433_11056665 Ga0075433_110566652 116
112 3300006914 Ga0075436_100056473 Ga0075436_1000564732 116
113 3300006914 Ga0075436_100110357 Ga0075436_1001103572 116
114 3300006931 Ga0097620_100214336 Ga0097620_1002143362 116
115 3300007076 Ga0075435_101073260 Ga0075435_1010732601 116
116 3300007265 Ga0099794_10012000 Ga0099794_100120003 116
117 3300007788 Ga0099795_10216851 Ga0099795_102168512 116
118 3300009093 Ga0105240_10016670 Ga0105240_100166706 116
119 3300009093 Ga0105240_10242896 Ga0105240_102428962 116
120 3300009093 Ga0105240_10841147 Ga0105240_108411472 116
121 3300009094 Ga0111539_10858331 Ga0111539_108583312 116
122 3300009094 Ga0111539_11709846 Ga0111539_117098461 116
123 3300009098 Ga0105245_10056058 Ga0105245_100560583 116
124 3300009147 Ga0114129_10598140 Ga0114129_105981402 116
125 3300009147 Ga0114129_12559394 Ga0114129_125593941 116
126 3300009148 Ga0105243_10145169 Ga0105243_101451694 116
127 3300009174 Ga0105241_10723554 Ga0105241_107235541 116
128 3300009176 Ga0105242_10052836 Ga0105242_100528365 116
129 3300009176 Ga0105242_12189156 Ga0105242_121891561 116
130 3300009177 Ga0105248_10091918 Ga0105248_100919182 116
131 3300009177 Ga0105248_11444456 Ga0105248_114444561 116
132 3300009545 Ga0105237_10026620 Ga0105237_100266208 116
133 3300009545 Ga0105237_10122885 Ga0105237_101228852 116
134 3300009551 Ga0105238_10072189 Ga0105238_100721892 116
135 3300009553 Ga0105249_11675759 Ga0105249_116757591 116
136 3300010159 Ga0099796_10147849 Ga0099796_101478492 116
137 3300010375 Ga0105239_10084353 Ga0105239_100843535 116
138 3300010375 Ga0105239_11498619 Ga0105239_114986191 116
139 3300010375 Ga0105239_13451057 Ga0105239_134510571 116
140 3300013102 Ga0157371_11483885 Ga0157371_114838851 116
141 3300013296 Ga0157374_10156640 Ga0157374_101566405 116
142 3300013297 Ga0157378_10315497 Ga0157378_103154974 116
143 3300013297 Ga0157378_10439052 Ga0157378_104390522 116
144 3300013297 Ga0157378_11861550 Ga0157378_118615502 116
145 3300013297 Ga0157378_13179245 Ga0157378_131792451 116
146 3300013306 Ga0163162_10210990 Ga0163162_102109903 116
147 3300013306 Ga0163162_12247914 Ga0163162_122479141 116
148 3300013307 Ga0157372_10502103 Ga0157372_105021033 116
149 3300014325 Ga0163163_10119224 Ga0163163_101192244 116
150 3300014325 Ga0163163_12419118 Ga0163163_124191182 116
151 3300014326 Ga0157380_10427861 Ga0157380_104278611 116
152 3300014326 Ga0157380_12290901 Ga0157380_122909011 116
153 3300014968 Ga0157379_10207070 Ga0157379_102070701 116
154 3300014969 Ga0157376_10146328 Ga0157376_101463282 116
155 3300014969 Ga0157376_10504340 Ga0157376_105043404 116
156 3300014969 Ga0157376_10723185 Ga0157376_107231852 116
157 3300017792 Ga0163161_11514502 Ga0163161_115145022 116
158 3300025885 Ga0207653_10043245 Ga0207653_100432452 116
159 3300025910 Ga0207684_10140557 Ga0207684_101405572 116
160 3300025910 Ga0207684_10150112 Ga0207684_101501123 116
161 3300025910 Ga0207684_10168113 Ga0207684_101681132 116
162 3300025910 Ga0207684_10241992 Ga0207684_102419923 116
163 3300025910 Ga0207684_10341697 Ga0207684_103416972 116
164 3300025910 Ga0207684_10974691 Ga0207684_109746911 116
165 3300025910 Ga0207684_11685274 Ga0207684_116852741 116
166 3300025912 Ga0207707_10103141 Ga0207707_101031412 116
167 3300025912 Ga0207707_10172819 Ga0207707_101728192 116
168 3300025913 Ga0207695_10079858 Ga0207695_100798582 116
169 3300025914 Ga0207671_10141005 Ga0207671_101410053 116
170 3300025914 Ga0207671_10166734 Ga0207671_101667343 116
171 3300025916 Ga0207663_11454950 Ga0207663_114549501 116
172 3300025917 Ga0207660_10012412 Ga0207660_100124128 116
173 3300025917 Ga0207660_11499139 Ga0207660_114991391 116
174 3300025918 Ga0207662_10162369 Ga0207662_101623693 116
175 3300025921 Ga0207652_10122978 Ga0207652_101229783 116
176 3300025921 Ga0207652_10203078 Ga0207652_102030783 116
177 3300025922 Ga0207646_10003625 Ga0207646_100036257 116
178 3300025922 Ga0207646_10031431 Ga0207646_100314312 116
179 3300025922 Ga0207646_10322601 Ga0207646_103226011 116
180 3300025922 Ga0207646_10402597 Ga0207646_104025972 116
181 3300025924 Ga0207694_10119927 Ga0207694_101199272 116
182 3300025924 Ga0207694_10633363 Ga0207694_106333632 116
183 3300025927 Ga0207687_10005017 Ga0207687_100050174 116
184 3300025928 Ga0207700_10163115 Ga0207700_101631152 116
185 3300025934 Ga0207686_10024122 Ga0207686_100241226 116
186 3300025935 Ga0207709_10758163 Ga0207709_107581631 116
187 3300025941 Ga0207711_10042799 Ga0207711_100427992 116
188 3300025942 Ga0207689_10756127 Ga0207689_107561271 116
189 3300025949 Ga0207667_11330703 Ga0207667_113307031 116
190 3300025981 Ga0207640_11320684 Ga0207640_113206842 116
191 3300025986 Ga0207658_11099165 Ga0207658_110991651 116
192 3300026023 Ga0207677_10061153 Ga0207677_100611533 116
193 3300026035 Ga0207703_10329798 Ga0207703_103297983 116
194 3300026041 Ga0207639_10068609 Ga0207639_100686095 116
195 3300026078 Ga0207702_10306843 Ga0207702_103068432 116
196 3300026088 Ga0207641_10032361 Ga0207641_100323614 116
197 3300026088 Ga0207641_11018231 Ga0207641_110182312 116
198 3300026088 Ga0207641_11094743 Ga0207641_110947431 116
199 3300026116 Ga0207674_11343624 Ga0207674_113436242 116
200 3300026121 Ga0207683_10023025 Ga0207683_100230254 116
201 3300027671 Ga0209588_1019591 Ga0209588_10195913 116
202 3300028381 Ga0268264_10754988 Ga0268264_107549882 116
203 3300028800 Ga0265338_10305541 Ga0265338_103055412 116
204 3300031250 Ga0265331_10074703 Ga0265331_100747032 116
205 3300031250 Ga0265331_10115265 Ga0265331_101152651 116
206 3300035113 Ga0373936_0063347 Ga0373936_0063347_185_571 116
207 3300035171 Ga0373946_0148073 Ga0373946_0148073_515_871 116
208 3300035692 Ga0373935_0174525 Ga0373935_0174525_1042_1398 116
209 3300035695 Ga0373927_0000683 Ga0373927_0000683_10147_10503 116
210 3300035695 Ga0373927_0052665 Ga0373927_0052665_1395_1745 116
211 3300035695 Ga0373927_0059203 Ga0373927_0059203_1124_1480 116
212 3300035725 Ga0373947_0012711 Ga0373947_0012711_1747_2103 116
213 3300035725 Ga0373947_0230067 Ga0373947_0230067_135_491 116
214 3300035725 Ga0373947_0282524 Ga0373947_0282524_292_678 116
215 3300037068 Ga0373925_0000564 Ga0373925_0000564_14052_14408 116
216 3300037471 Ga0395905_1226309 Ga0395905_1226309_228_584 116
217 3300042461 Ga0439460_0314097 Ga0439460_0314097_120_476 116
218 3300044673 Ga0453683_0397113 Ga0453683_0397113_188_547 116
219 3300046472 Ga0495580_0752128 Ga0495580_0752128_49_405 116
220 3300046517 Ga0495630_0523707 Ga0495630_0523707_319_675 116
221 3300046517 Ga0495630_1347332 Ga0495630_1347332_116_472 116
222 3300046518 Ga0495631_0206425 Ga0495631_0206425_195_545 116
223 3300046523 Ga0495644_0058054 Ga0495644_0058054_220_576 116
224 3300046526 Ga0495666_0296884 Ga0495666_0296884_219_575 116
225 3300046559 Ga0495667_0210752 Ga0495667_0210752_194_544 116
226 3300046615 Ga0495656_0048286 Ga0495656_0048286_1124_1480 116
227 3300047318 Ga0495636_0228468 Ga0495636_0228468_31_387 116
228 3300048905 Ga0496102_0971562 Ga0496102_0971562_80_436 116
229 3300048906 Ga0496103_0280182 Ga0496103_0280182_570_926 116
230 3300048907 Ga0496104_0399181 Ga0496104_0399181_31_387 116
231 3300048908 Ga0496105_0151621 Ga0496105_0151621_600_956 116
232 3300048911 Ga0496108_0014076 Ga0496108_0014076_4721_5077 116
233 3300048912 Ga0496109_0076297 Ga0496109_0076297_571_927 116
234 3300048913 Ga0496110_0207988 Ga0496110_0207988_1292_1648 116
235 3300048914 Ga0496111_0028345 Ga0496111_0028345_2203_2559 116
236 3300048917 Ga0496114_0004307 Ga0496114_0004307_5479_5835 116
237 3300048918 Ga0496115_0221039 Ga0496115_0221039_772_1122 116
238 3300048918 Ga0496115_0294200 Ga0496115_0294200_37_393 116
239 3300048918 Ga0496115_0397997 Ga0496115_0397997_436_792 116
240 3300050489 nmdc:mga03683_486969_c1 nmdc:mga03683_486969_c1_134_490 116
241 3300050490 nmdc:mga03n38_573889_c1 nmdc:mga03n38_573889_c1_198_554 116
242 3300050492 nmdc:mga0yw44_1008690_c1 nmdc:mga0yw44_1008690_c1_29_379 116
243 3300050493 nmdc:mga0k408_770701_c1 nmdc:mga0k408_770701_c1_78_434 116
244 3300050494 nmdc:mga06z11_303401_c1 nmdc:mga06z11_303401_c1_489_845 116
245 3300050507 nmdc:mga05p37_373657_c1 nmdc:mga05p37_373657_c1_1204_1554 116
246 3300050513 nmdc:mga0rr50_520393_c1 nmdc:mga0rr50_520393_c1_613_963 116
247 3300050514 nmdc:mga08x19_126902_c1 nmdc:mga08x19_126902_c1_591_941 116
248 3300050514 nmdc:mga08x19_8151_c1 nmdc:mga08x19_8151_c1_680_1036 116
249 3300050515 nmdc:mga0a205_373013_c1 nmdc:mga0a205_373013_c1_226_576 116

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gm5-assembly1.cif.gz_A-2 crystal structure of a putative methylmalonyl-coenzyme a epimerase from thermoanaerobacter tengcongensis at 2.0 a resolution 0.8405 60 107
6bnz-assembly1.cif.gz_A crystal structure of e144q-glyoxalase i mutant from zea mays in space group p4(1)2(1)2 0.7914 57 107
1tg5-assembly1.cif.gz_A-2 crystal structures of plant 4-hydroxyphenylpyruvate dioxygenases complexed with das645 0.7884 60 109
5d7z-assembly1.cif.gz_A crystal structure of glyoxalase i from zea mays 0.7838 57 107
8aid-assembly2.cif.gz_D crystal structure of n-terminally truncated pa4183 from p. aeruginosa pao1 0.7517 60 112
ID Description Score Start End Superfamily
3gm5A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8405 60 107 3.10.180.10
4huzA02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8226 60 111 3.10.180.10
3oajB02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7981 60 106 3.10.180.10
5yy7B01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7623 55 109 3.10.180.10
af_F8Y416_244_316_2.20.25.80 Mainly Beta;Single Sheet;N-terminal domain of TfIIb;WRKY domain 0.7521 76 109 2.20.25.80
ID Description Score Start End GO Terms
AF-A0A536BTK3-F1-model_v4 Extradiol dioxygenase 0.9643 1 112 GO:0051213
AF-A0A535S9I3-F1-model_v4 Extradiol dioxygenase 0.9612 8 113 GO:0051213
AF-A0A177HGC2-F1-model_v4 Glyoxalase-like domain protein 0.9592 2 112
AF-A0A535XI71-F1-model_v4 Extradiol dioxygenase 0.958 1 112 GO:0051213
AF-A0A3R9NYE2-F1-model_v4 VOC domain-containing protein 0.9533 2 116

Feature Viewer

pLDDT pTM Quality
88.08 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map