F360764
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 249 | 147 | 249 | 119 |
Family's Representative Sequence
| Representative Sequence | 3300014969|Ga0157376_10723185|Ga0157376_107231852 |
| Length | 119 |
| Sequence | MIFGAHVVVYSKDATADRAFFREVLGTTSVDAGHGWLIFALPPAEVAVHPAEEHAGEEEPYFMCDDLKSEISALREKGVRCADVQEARWGSITKIRLPGGGEVGLYQPKHPIAVVRTSH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 28 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 34 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 35 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 36 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 37 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 38 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 39 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 40 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 41 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 43 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 44 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 47 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 48 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 50 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 51 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 52 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 53 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 55 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 56 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 57 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 69 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 110 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 111 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 112 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 113 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 114 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 115 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 116 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 117 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 118 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 119 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 120 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 130 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 131 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 132 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 133 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 134 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 135 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 136 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 137 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 138 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 139 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 140 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 141 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 142 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 143 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 144 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 145 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 146 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 147 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.61 |
| Nodule | 0 |
| Rhizoplane | 4.82 |
| Rhizosphere | 90.36 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.2 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10033281 | 3300003316 | Bacteria | 2808 |
| 2 | rootH2_10253761 | 3300003320 | Bacteria | 2823 |
| 3 | rootL2_10101055 | 3300003322 | Bacteria | 7167 |
| 4 | Ga0065707_10254295 | 3300005295 | Bacteria | 1115 |
| 5 | Ga0070690_100406416 | 3300005330 | Bacteria | 1001 |
| 6 | Ga0070666_10162397 | 3300005335 | Bacteria | 1562 |
| 7 | Ga0070680_100008476 | 3300005336 | Bacteria | 7872 |
| 8 | Ga0070689_101782304 | 3300005340 | Unclassified | 561 |
| 9 | Ga0070687_100500920 | 3300005343 | Bacteria | 817 |
| 10 | Ga0070692_10040730 | 3300005345 | Bacteria | 2377 |
| 11 | Ga0070668_101852925 | 3300005347 | Bacteria | 555 |
| 12 | Ga0070703_10017922 | 3300005406 | Unclassified | 2043 |
| 13 | Ga0070709_10066026 | 3300005434 | Bacteria | 2319 |
| 14 | Ga0070713_100293435 | 3300005436 | Unclassified | 1495 |
| 15 | Ga0070701_10014930 | 3300005438 | Bacteria | 3573 |
| 16 | Ga0070705_100129208 | 3300005440 | Bacteria | 1645 |
| 17 | Ga0070705_101105979 | 3300005440 | Bacteria | 648 |
| 18 | Ga0070694_100002984 | 3300005444 | Bacteria | 10056 |
| 19 | Ga0070694_100045077 | 3300005444 | Bacteria | 2954 |
| 20 | Ga0070694_101564270 | 3300005444 | Bacteria | 559 |
| 21 | Ga0070708_100001578 | 3300005445 | Bacteria | 17464 |
| 22 | Ga0070708_100012519 | 3300005445 | Bacteria | 6924 |
| 23 | Ga0070708_100091436 | 3300005445 | Bacteria | 2771 |
| 24 | Ga0070708_100480040 | 3300005445 | Bacteria | 1173 |
| 25 | Ga0070708_100495069 | 3300005445 | Bacteria | 1153 |
| 26 | Ga0070708_101221237 | 3300005445 | Unclassified | 703 |
| 27 | Ga0070708_101338766 | 3300005445 | Bacteria | 668 |
| 28 | Ga0070708_101443290 | 3300005445 | Unclassified | 641 |
| 29 | Ga0070708_101554662 | 3300005445 | Bacteria | 616 |
| 30 | Ga0070678_100041722 | 3300005456 | Bacteria | 3255 |
| 31 | Ga0070681_10104611 | 3300005458 | Bacteria | 2773 |
| 32 | Ga0070681_10348367 | 3300005458 | Bacteria | 1391 |
| 33 | Ga0070706_100067360 | 3300005467 | Bacteria | 3311 |
| 34 | Ga0070706_100128850 | 3300005467 | Unclassified | 2360 |
| 35 | Ga0070706_100141071 | 3300005467 | Bacteria | 2250 |
| 36 | Ga0070706_100177543 | 3300005467 | Bacteria | 1988 |
| 37 | Ga0070706_100180096 | 3300005467 | Unclassified | 1973 |
| 38 | Ga0070706_100198088 | 3300005467 | Bacteria | 1876 |
| 39 | Ga0070707_100068382 | 3300005468 | Unclassified | 3419 |
| 40 | Ga0070707_100139297 | 3300005468 | Bacteria | 2361 |
| 41 | Ga0070707_100198086 | 3300005468 | Unclassified | 1958 |
| 42 | Ga0070707_100376451 | 3300005468 | Bacteria | 1379 |
| 43 | Ga0070707_100443276 | 3300005468 | Bacteria | 1259 |
| 44 | Ga0070707_100493178 | 3300005468 | Bacteria | 1186 |
| 45 | Ga0070707_100844844 | 3300005468 | Unclassified | 880 |
| 46 | Ga0070698_100000291 | 3300005471 | Bacteria | 50991 |
| 47 | Ga0070698_100060703 | 3300005471 | Bacteria | 3815 |
| 48 | Ga0070698_100128633 | 3300005471 | Unclassified | 2489 |
| 49 | Ga0070698_100204758 | 3300005471 | Bacteria | 1908 |
| 50 | Ga0070698_100311888 | 3300005471 | Bacteria | 1504 |
| 51 | Ga0070698_100765221 | 3300005471 | Bacteria | 909 |
| 52 | Ga0070698_101366205 | 3300005471 | Unclassified | 659 |
| 53 | Ga0070698_102187932 | 3300005471 | Unclassified | 507 |
| 54 | Ga0070699_100028555 | 3300005518 | Bacteria | 4810 |
| 55 | Ga0070699_100041231 | 3300005518 | Unclassified | 3997 |
| 56 | Ga0070699_100050327 | 3300005518 | Unclassified | 3607 |
| 57 | Ga0070699_100184989 | 3300005518 | Unclassified | 1850 |
| 58 | Ga0070699_100340338 | 3300005518 | Bacteria | 1350 |
| 59 | Ga0070699_100536720 | 3300005518 | Unclassified | 1064 |
| 60 | Ga0070699_100651266 | 3300005518 | Bacteria | 961 |
| 61 | Ga0070699_101342971 | 3300005518 | Bacteria | 656 |
| 62 | Ga0070679_100150233 | 3300005530 | Unclassified | 2306 |
| 63 | Ga0070679_100300464 | 3300005530 | Bacteria | 1556 |
| 64 | Ga0070697_100041082 | 3300005536 | Bacteria | 3742 |
| 65 | Ga0070697_100245011 | 3300005536 | Bacteria | 1531 |
| 66 | Ga0070697_100274083 | 3300005536 | Bacteria | 1447 |
| 67 | Ga0070697_100534749 | 3300005536 | Bacteria | 1027 |
| 68 | Ga0070697_100633850 | 3300005536 | Bacteria | 941 |
| 69 | Ga0070697_101272784 | 3300005536 | Unclassified | 656 |
| 70 | Ga0070697_101361461 | 3300005536 | Unclassified | 633 |
| 71 | Ga0070697_101782824 | 3300005536 | Unclassified | 551 |
| 72 | Ga0068853_100036461 | 3300005539 | Unclassified | 4182 |
| 73 | Ga0068853_100513625 | 3300005539 | Unclassified | 1132 |
| 74 | Ga0070686_100830341 | 3300005544 | Bacteria | 747 |
| 75 | Ga0070695_100000156 | 3300005545 | Bacteria | 32250 |
| 76 | Ga0070695_100052286 | 3300005545 | Bacteria | 2624 |
| 77 | Ga0070695_100936135 | 3300005545 | Bacteria | 701 |
| 78 | Ga0070695_101818485 | 3300005545 | Bacteria | 511 |
| 79 | Ga0070695_101850904 | 3300005545 | Unclassified | 507 |
| 80 | Ga0070696_100497078 | 3300005546 | Bacteria | 970 |
| 81 | Ga0070696_100689708 | 3300005546 | Bacteria | 831 |
| 82 | Ga0070696_100829002 | 3300005546 | Unclassified | 763 |
| 83 | Ga0070693_100000697 | 3300005547 | Bacteria | 14842 |
| 84 | Ga0070704_100003502 | 3300005549 | Bacteria | 9011 |
| 85 | Ga0070704_100066573 | 3300005549 | Bacteria | 2598 |
| 86 | Ga0070704_100484410 | 3300005549 | Bacteria | 1071 |
| 87 | Ga0068855_101965711 | 3300005563 | Unclassified | 591 |
| 88 | Ga0068855_101996951 | 3300005563 | Unclassified | 586 |
| 89 | Ga0068857_101530295 | 3300005577 | Unclassified | 650 |
| 90 | Ga0068854_101582223 | 3300005578 | Unclassified | 597 |
| 91 | Ga0068856_100627686 | 3300005614 | Bacteria | 1095 |
| 92 | Ga0068859_100214327 | 3300005617 | Unclassified | 2013 |
| 93 | Ga0068863_100112517 | 3300005841 | Bacteria | 2593 |
| 94 | Ga0068863_100383414 | 3300005841 | Bacteria | 1373 |
| 95 | Ga0068863_100747408 | 3300005841 | Bacteria | 974 |
| 96 | Ga0068863_102159998 | 3300005841 | Unclassified | 567 |
| 97 | Ga0068860_100792603 | 3300005843 | Bacteria | 961 |
| 98 | Ga0068862_102150202 | 3300005844 | Bacteria | 569 |
| 99 | Ga0070717_10040492 | 3300006028 | Bacteria | 3795 |
| 100 | Ga0070717_11801470 | 3300006028 | Unclassified | 553 |
| 101 | Ga0075365_10189006 | 3300006038 | Bacteria | 1441 |
| 102 | Ga0075363_100323624 | 3300006048 | Bacteria | 897 |
| 103 | Ga0070715_10456108 | 3300006163 | Unclassified | 723 |
| 104 | Ga0070716_101626374 | 3300006173 | Unclassified | 531 |
| 105 | Ga0075367_10732393 | 3300006178 | Bacteria | 629 |
| 106 | Ga0075366_10942541 | 3300006195 | Bacteria | 538 |
| 107 | Ga0097621_101011462 | 3300006237 | Unclassified | 778 |
| 108 | Ga0068871_100189317 | 3300006358 | Unclassified | 1772 |
| 109 | Ga0075431_101991511 | 3300006847 | Bacteria | 536 |
| 110 | Ga0075433_11056665 | 3300006852 | Unclassified | 706 |
| 111 | Ga0075436_100056473 | 3300006914 | Bacteria | 2711 |
| 112 | Ga0075436_100110357 | 3300006914 | Bacteria | 1919 |
| 113 | Ga0097620_100214336 | 3300006931 | Unclassified | 2013 |
| 114 | Ga0075435_101073260 | 3300007076 | Unclassified | 704 |
| 115 | Ga0099794_10012000 | 3300007265 | Bacteria | 3726 |
| 116 | Ga0099795_10216851 | 3300007788 | Bacteria | 813 |
| 117 | Ga0105240_10016670 | 3300009093 | Bacteria | 9937 |
| 118 | Ga0105240_10242896 | 3300009093 | Bacteria | 2087 |
| 119 | Ga0105240_10841147 | 3300009093 | Unclassified | 991 |
| 120 | Ga0111539_10858331 | 3300009094 | Bacteria | 1056 |
| 121 | Ga0111539_11709846 | 3300009094 | Unclassified | 730 |
| 122 | Ga0105245_10056058 | 3300009098 | Bacteria | 3541 |
| 123 | Ga0114129_10598140 | 3300009147 | Unclassified | 1429 |
| 124 | Ga0114129_12559394 | 3300009147 | Bacteria | 609 |
| 125 | Ga0105243_10145169 | 3300009148 | Bacteria | 2029 |
| 126 | Ga0105241_10723554 | 3300009174 | Bacteria | 910 |
| 127 | Ga0105242_10052836 | 3300009176 | Bacteria | 3317 |
| 128 | Ga0105242_12189156 | 3300009176 | Bacteria | 598 |
| 129 | Ga0105248_10091918 | 3300009177 | Unclassified | 3417 |
| 130 | Ga0105248_11444456 | 3300009177 | Unclassified | 778 |
| 131 | Ga0105237_10026620 | 3300009545 | Bacteria | 5911 |
| 132 | Ga0105237_10122885 | 3300009545 | Bacteria | 2590 |
| 133 | Ga0105238_10072189 | 3300009551 | Bacteria | 3448 |
| 134 | Ga0105249_11675759 | 3300009553 | Bacteria | 708 |
| 135 | Ga0099796_10147849 | 3300010159 | Bacteria | 923 |
| 136 | Ga0105239_10084353 | 3300010375 | Bacteria | 3499 |
| 137 | Ga0105239_11498619 | 3300010375 | Unclassified | 779 |
| 138 | Ga0105239_13451057 | 3300010375 | Unclassified | 514 |
| 139 | Ga0157371_11483885 | 3300013102 | Unclassified | 528 |
| 140 | Ga0157374_10156640 | 3300013296 | Bacteria | 2217 |
| 141 | Ga0157378_10315497 | 3300013297 | Unclassified | 1517 |
| 142 | Ga0157378_10439052 | 3300013297 | Bacteria | 1293 |
| 143 | Ga0157378_11861550 | 3300013297 | Unclassified | 650 |
| 144 | Ga0157378_13179245 | 3300013297 | Unclassified | 510 |
| 145 | Ga0163162_10210990 | 3300013306 | Bacteria | 2072 |
| 146 | Ga0163162_12247914 | 3300013306 | Bacteria | 626 |
| 147 | Ga0157372_10502103 | 3300013307 | Unclassified | 1414 |
| 148 | Ga0163163_10119224 | 3300014325 | Bacteria | 2672 |
| 149 | Ga0163163_12419118 | 3300014325 | Bacteria | 584 |
| 150 | Ga0157380_10427861 | 3300014326 | Bacteria | 1264 |
| 151 | Ga0157380_12290901 | 3300014326 | Unclassified | 605 |
| 152 | Ga0157379_10207070 | 3300014968 | Bacteria | 1775 |
| 153 | Ga0157376_10146328 | 3300014969 | Bacteria | 2126 |
| 154 | Ga0157376_10504340 | 3300014969 | Unclassified | 1190 |
| 155 | Ga0157376_10723185 | 3300014969 | Bacteria | 1003 |
| 156 | Ga0163161_11514502 | 3300017792 | Bacteria | 589 |
| 157 | Ga0207653_10043245 | 3300025885 | Unclassified | 1483 |
| 158 | Ga0207684_10140557 | 3300025910 | Bacteria | 2075 |
| 159 | Ga0207684_10150112 | 3300025910 | Bacteria | 2005 |
| 160 | Ga0207684_10168113 | 3300025910 | Bacteria | 1890 |
| 161 | Ga0207684_10241992 | 3300025910 | Unclassified | 1557 |
| 162 | Ga0207684_10341697 | 3300025910 | Bacteria | 1289 |
| 163 | Ga0207684_10974691 | 3300025910 | Unclassified | 710 |
| 164 | Ga0207684_11685274 | 3300025910 | Unclassified | 511 |
| 165 | Ga0207707_10103141 | 3300025912 | Bacteria | 2493 |
| 166 | Ga0207707_10172819 | 3300025912 | Bacteria | 1888 |
| 167 | Ga0207695_10079858 | 3300025913 | Bacteria | 3314 |
| 168 | Ga0207671_10141005 | 3300025914 | Bacteria | 1857 |
| 169 | Ga0207671_10166734 | 3300025914 | Bacteria | 1708 |
| 170 | Ga0207663_11454950 | 3300025916 | Bacteria | 552 |
| 171 | Ga0207660_10012412 | 3300025917 | Bacteria | 5574 |
| 172 | Ga0207660_11499139 | 3300025917 | Unclassified | 545 |
| 173 | Ga0207662_10162369 | 3300025918 | Bacteria | 1428 |
| 174 | Ga0207652_10122978 | 3300025921 | Unclassified | 2310 |
| 175 | Ga0207652_10203078 | 3300025921 | Bacteria | 1784 |
| 176 | Ga0207646_10003625 | 3300025922 | Bacteria | 17280 |
| 177 | Ga0207646_10031431 | 3300025922 | Bacteria | 4806 |
| 178 | Ga0207646_10322601 | 3300025922 | Bacteria | 1396 |
| 179 | Ga0207646_10402597 | 3300025922 | Bacteria | 1236 |
| 180 | Ga0207694_10119927 | 3300025924 | Bacteria | 2099 |
| 181 | Ga0207694_10633363 | 3300025924 | Unclassified | 900 |
| 182 | Ga0207687_10005017 | 3300025927 | Bacteria | 8765 |
| 183 | Ga0207700_10163115 | 3300025928 | Unclassified | 1852 |
| 184 | Ga0207686_10024122 | 3300025934 | Bacteria | 3520 |
| 185 | Ga0207709_10758163 | 3300025935 | Unclassified | 781 |
| 186 | Ga0207711_10042799 | 3300025941 | Unclassified | 3859 |
| 187 | Ga0207689_10756127 | 3300025942 | Unclassified | 820 |
| 188 | Ga0207667_11330703 | 3300025949 | Unclassified | 694 |
| 189 | Ga0207640_11320684 | 3300025981 | Unclassified | 644 |
| 190 | Ga0207658_11099165 | 3300025986 | Unclassified | 726 |
| 191 | Ga0207677_10061153 | 3300026023 | Bacteria | 2607 |
| 192 | Ga0207703_10329798 | 3300026035 | Bacteria | 1400 |
| 193 | Ga0207639_10068609 | 3300026041 | Bacteria | 2764 |
| 194 | Ga0207702_10306843 | 3300026078 | Unclassified | 1508 |
| 195 | Ga0207641_10032361 | 3300026088 | Bacteria | 4342 |
| 196 | Ga0207641_11018231 | 3300026088 | Bacteria | 825 |
| 197 | Ga0207641_11094743 | 3300026088 | Bacteria | 795 |
| 198 | Ga0207674_11343624 | 3300026116 | Unclassified | 684 |
| 199 | Ga0207683_10023025 | 3300026121 | Bacteria | 5353 |
| 200 | Ga0209588_1019591 | 3300027671 | Unclassified | 2113 |
| 201 | Ga0268264_10754988 | 3300028381 | Bacteria | 969 |
| 202 | Ga0265338_10305541 | 3300028800 | Unclassified | 1155 |
| 203 | Ga0265331_10074703 | 3300031250 | Bacteria | 1581 |
| 204 | Ga0265331_10115265 | 3300031250 | Unclassified | 1230 |
| 205 | Ga0373936_0063347 | 3300035113 | Bacteria | 1514 |
| 206 | Ga0373946_0148073 | 3300035171 | Bacteria | 1093 |
| 207 | Ga0373935_0174525 | 3300035692 | Unclassified | 1472 |
| 208 | Ga0373927_0000683 | 3300035695 | Bacteria | 25847 |
| 209 | Ga0373927_0052665 | 3300035695 | Bacteria | 2632 |
| 210 | Ga0373927_0059203 | 3300035695 | Bacteria | 2478 |
| 211 | Ga0373947_0012711 | 3300035725 | Bacteria | 4827 |
| 212 | Ga0373947_0230067 | 3300035725 | Bacteria | 1221 |
| 213 | Ga0373947_0282524 | 3300035725 | Bacteria | 1104 |
| 214 | Ga0373925_0000564 | 3300037068 | Bacteria | 36366 |
| 215 | Ga0395905_1226309 | 3300037471 | Unclassified | 654 |
| 216 | Ga0439460_0314097 | 3300042461 | Bacteria | 549 |
| 217 | Ga0453683_0397113 | 3300044673 | Bacteria | 889 |
| 218 | Ga0495580_0752128 | 3300046472 | Unclassified | 635 |
| 219 | Ga0495630_0523707 | 3300046517 | Bacteria | 909 |
| 220 | Ga0495630_1347332 | 3300046517 | Unclassified | 537 |
| 221 | Ga0495631_0206425 | 3300046518 | Bacteria | 840 |
| 222 | Ga0495644_0058054 | 3300046523 | Bacteria | 1455 |
| 223 | Ga0495666_0296884 | 3300046526 | Bacteria | 731 |
| 224 | Ga0495621_0146244 | 3300046539 | Unclassified | 927 |
| 225 | Ga0495667_0210752 | 3300046559 | Unclassified | 1242 |
| 226 | Ga0495656_0048286 | 3300046615 | Bacteria | 1808 |
| 227 | Ga0495636_0228468 | 3300047318 | Unclassified | 856 |
| 228 | Ga0496102_0971562 | 3300048905 | Unclassified | 770 |
| 229 | Ga0496103_0280182 | 3300048906 | Unclassified | 1072 |
| 230 | Ga0496104_0399181 | 3300048907 | Bacteria | 1287 |
| 231 | Ga0496105_0151621 | 3300048908 | Unclassified | 1905 |
| 232 | Ga0496108_0014076 | 3300048911 | Bacteria | 6526 |
| 233 | Ga0496109_0076297 | 3300048912 | Bacteria | 3083 |
| 234 | Ga0496110_0207988 | 3300048913 | Bacteria | 1778 |
| 235 | Ga0496111_0028345 | 3300048914 | Bacteria | 3968 |
| 236 | Ga0496114_0004307 | 3300048917 | Bacteria | 11016 |
| 237 | Ga0496115_0221039 | 3300048918 | Bacteria | 1563 |
| 238 | Ga0496115_0294200 | 3300048918 | Unclassified | 1331 |
| 239 | Ga0496115_0397997 | 3300048918 | Bacteria | 1118 |
| 240 | nmdc:mga03683_486969_c1 | 3300050489 | Bacteria | 596 |
| 241 | nmdc:mga03n38_573889_c1 | 3300050490 | Bacteria | 640 |
| 242 | nmdc:mga0yw44_1008690_c1 | 3300050492 | Bacteria | 563 |
| 243 | nmdc:mga0k408_770701_c1 | 3300050493 | Bacteria | 561 |
| 244 | nmdc:mga06z11_303401_c1 | 3300050494 | Bacteria | 950 |
| 245 | nmdc:mga05p37_373657_c1 | 3300050507 | Bacteria | 1672 |
| 246 | nmdc:mga0rr50_520393_c1 | 3300050513 | Unclassified | 1012 |
| 247 | nmdc:mga08x19_126902_c1 | 3300050514 | Bacteria | 1714 |
| 248 | nmdc:mga08x19_8151_c1 | 3300050514 | Bacteria | 6227 |
| 249 | nmdc:mga0a205_373013_c1 | 3300050515 | Unclassified | 1293 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046539 | Ga0495621_0146244 | Ga0495621_0146244_280_606 | 107 |
| 2 | 3300003316 | rootH1_10033281 | rootH1_100332815 | 116 |
| 3 | 3300003320 | rootH2_10253761 | rootH2_102537613 | 116 |
| 4 | 3300003322 | rootL2_10101055 | rootL2_101010556 | 116 |
| 5 | 3300005295 | Ga0065707_10254295 | Ga0065707_102542952 | 116 |
| 6 | 3300005330 | Ga0070690_100406416 | Ga0070690_1004064162 | 116 |
| 7 | 3300005335 | Ga0070666_10162397 | Ga0070666_101623973 | 116 |
| 8 | 3300005336 | Ga0070680_100008476 | Ga0070680_1000084769 | 116 |
| 9 | 3300005340 | Ga0070689_101782304 | Ga0070689_1017823041 | 116 |
| 10 | 3300005343 | Ga0070687_100500920 | Ga0070687_1005009201 | 116 |
| 11 | 3300005345 | Ga0070692_10040730 | Ga0070692_100407303 | 116 |
| 12 | 3300005347 | Ga0070668_101852925 | Ga0070668_1018529251 | 116 |
| 13 | 3300005406 | Ga0070703_10017922 | Ga0070703_100179222 | 116 |
| 14 | 3300005434 | Ga0070709_10066026 | Ga0070709_100660263 | 116 |
| 15 | 3300005436 | Ga0070713_100293435 | Ga0070713_1002934352 | 116 |
| 16 | 3300005438 | Ga0070701_10014930 | Ga0070701_100149303 | 116 |
| 17 | 3300005440 | Ga0070705_100129208 | Ga0070705_1001292082 | 116 |
| 18 | 3300005440 | Ga0070705_101105979 | Ga0070705_1011059792 | 116 |
| 19 | 3300005444 | Ga0070694_100002984 | Ga0070694_1000029847 | 116 |
| 20 | 3300005444 | Ga0070694_100045077 | Ga0070694_1000450776 | 116 |
| 21 | 3300005444 | Ga0070694_101564270 | Ga0070694_1015642701 | 116 |
| 22 | 3300005445 | Ga0070708_100001578 | Ga0070708_1000015785 | 116 |
| 23 | 3300005445 | Ga0070708_100012519 | Ga0070708_1000125198 | 116 |
| 24 | 3300005445 | Ga0070708_100091436 | Ga0070708_1000914363 | 116 |
| 25 | 3300005445 | Ga0070708_100480040 | Ga0070708_1004800401 | 116 |
| 26 | 3300005445 | Ga0070708_100495069 | Ga0070708_1004950693 | 116 |
| 27 | 3300005445 | Ga0070708_101221237 | Ga0070708_1012212371 | 116 |
| 28 | 3300005445 | Ga0070708_101338766 | Ga0070708_1013387661 | 116 |
| 29 | 3300005445 | Ga0070708_101443290 | Ga0070708_1014432901 | 116 |
| 30 | 3300005445 | Ga0070708_101554662 | Ga0070708_1015546621 | 116 |
| 31 | 3300005456 | Ga0070678_100041722 | Ga0070678_1000417224 | 116 |
| 32 | 3300005458 | Ga0070681_10104611 | Ga0070681_101046112 | 116 |
| 33 | 3300005458 | Ga0070681_10348367 | Ga0070681_103483673 | 116 |
| 34 | 3300005467 | Ga0070706_100067360 | Ga0070706_1000673603 | 116 |
| 35 | 3300005467 | Ga0070706_100128850 | Ga0070706_1001288502 | 116 |
| 36 | 3300005467 | Ga0070706_100141071 | Ga0070706_1001410712 | 116 |
| 37 | 3300005467 | Ga0070706_100177543 | Ga0070706_1001775434 | 116 |
| 38 | 3300005467 | Ga0070706_100180096 | Ga0070706_1001800963 | 116 |
| 39 | 3300005467 | Ga0070706_100198088 | Ga0070706_1001980882 | 116 |
| 40 | 3300005468 | Ga0070707_100068382 | Ga0070707_1000683823 | 116 |
| 41 | 3300005468 | Ga0070707_100139297 | Ga0070707_1001392971 | 116 |
| 42 | 3300005468 | Ga0070707_100198086 | Ga0070707_1001980863 | 116 |
| 43 | 3300005468 | Ga0070707_100376451 | Ga0070707_1003764512 | 116 |
| 44 | 3300005468 | Ga0070707_100443276 | Ga0070707_1004432762 | 116 |
| 45 | 3300005468 | Ga0070707_100493178 | Ga0070707_1004931782 | 116 |
| 46 | 3300005468 | Ga0070707_100844844 | Ga0070707_1008448441 | 116 |
| 47 | 3300005471 | Ga0070698_100000291 | Ga0070698_10000029148 | 116 |
| 48 | 3300005471 | Ga0070698_100060703 | Ga0070698_1000607032 | 116 |
| 49 | 3300005471 | Ga0070698_100128633 | Ga0070698_1001286334 | 116 |
| 50 | 3300005471 | Ga0070698_100204758 | Ga0070698_1002047582 | 116 |
| 51 | 3300005471 | Ga0070698_100311888 | Ga0070698_1003118882 | 116 |
| 52 | 3300005471 | Ga0070698_100765221 | Ga0070698_1007652212 | 116 |
| 53 | 3300005471 | Ga0070698_101366205 | Ga0070698_1013662051 | 116 |
| 54 | 3300005471 | Ga0070698_102187932 | Ga0070698_1021879321 | 116 |
| 55 | 3300005518 | Ga0070699_100028555 | Ga0070699_1000285555 | 116 |
| 56 | 3300005518 | Ga0070699_100041231 | Ga0070699_1000412315 | 116 |
| 57 | 3300005518 | Ga0070699_100050327 | Ga0070699_1000503272 | 116 |
| 58 | 3300005518 | Ga0070699_100184989 | Ga0070699_1001849893 | 116 |
| 59 | 3300005518 | Ga0070699_100340338 | Ga0070699_1003403383 | 116 |
| 60 | 3300005518 | Ga0070699_100536720 | Ga0070699_1005367202 | 116 |
| 61 | 3300005518 | Ga0070699_100651266 | Ga0070699_1006512661 | 116 |
| 62 | 3300005518 | Ga0070699_101342971 | Ga0070699_1013429711 | 116 |
| 63 | 3300005530 | Ga0070679_100150233 | Ga0070679_1001502332 | 116 |
| 64 | 3300005530 | Ga0070679_100300464 | Ga0070679_1003004641 | 116 |
| 65 | 3300005536 | Ga0070697_100041082 | Ga0070697_1000410822 | 116 |
| 66 | 3300005536 | Ga0070697_100245011 | Ga0070697_1002450111 | 116 |
| 67 | 3300005536 | Ga0070697_100274083 | Ga0070697_1002740831 | 116 |
| 68 | 3300005536 | Ga0070697_100534749 | Ga0070697_1005347491 | 116 |
| 69 | 3300005536 | Ga0070697_100633850 | Ga0070697_1006338502 | 116 |
| 70 | 3300005536 | Ga0070697_101272784 | Ga0070697_1012727841 | 116 |
| 71 | 3300005536 | Ga0070697_101361461 | Ga0070697_1013614611 | 116 |
| 72 | 3300005536 | Ga0070697_101782824 | Ga0070697_1017828242 | 116 |
| 73 | 3300005539 | Ga0068853_100036461 | Ga0068853_1000364613 | 116 |
| 74 | 3300005539 | Ga0068853_100513625 | Ga0068853_1005136254 | 116 |
| 75 | 3300005544 | Ga0070686_100830341 | Ga0070686_1008303411 | 116 |
| 76 | 3300005545 | Ga0070695_100000156 | Ga0070695_10000015612 | 116 |
| 77 | 3300005545 | Ga0070695_100052286 | Ga0070695_1000522864 | 116 |
| 78 | 3300005545 | Ga0070695_100936135 | Ga0070695_1009361352 | 116 |
| 79 | 3300005545 | Ga0070695_101818485 | Ga0070695_1018184851 | 116 |
| 80 | 3300005545 | Ga0070695_101850904 | Ga0070695_1018509041 | 116 |
| 81 | 3300005546 | Ga0070696_100497078 | Ga0070696_1004970782 | 116 |
| 82 | 3300005546 | Ga0070696_100689708 | Ga0070696_1006897082 | 116 |
| 83 | 3300005546 | Ga0070696_100829002 | Ga0070696_1008290021 | 116 |
| 84 | 3300005547 | Ga0070693_100000697 | Ga0070693_1000006978 | 116 |
| 85 | 3300005549 | Ga0070704_100003502 | Ga0070704_1000035028 | 116 |
| 86 | 3300005549 | Ga0070704_100066573 | Ga0070704_1000665731 | 116 |
| 87 | 3300005549 | Ga0070704_100484410 | Ga0070704_1004844102 | 116 |
| 88 | 3300005563 | Ga0068855_101965711 | Ga0068855_1019657111 | 116 |
| 89 | 3300005563 | Ga0068855_101996951 | Ga0068855_1019969512 | 116 |
| 90 | 3300005577 | Ga0068857_101530295 | Ga0068857_1015302952 | 116 |
| 91 | 3300005578 | Ga0068854_101582223 | Ga0068854_1015822232 | 116 |
| 92 | 3300005614 | Ga0068856_100627686 | Ga0068856_1006276862 | 116 |
| 93 | 3300005617 | Ga0068859_100214327 | Ga0068859_1002143273 | 116 |
| 94 | 3300005841 | Ga0068863_100112517 | Ga0068863_1001125172 | 116 |
| 95 | 3300005841 | Ga0068863_100383414 | Ga0068863_1003834142 | 116 |
| 96 | 3300005841 | Ga0068863_100747408 | Ga0068863_1007474081 | 116 |
| 97 | 3300005841 | Ga0068863_102159998 | Ga0068863_1021599981 | 116 |
| 98 | 3300005843 | Ga0068860_100792603 | Ga0068860_1007926032 | 116 |
| 99 | 3300005844 | Ga0068862_102150202 | Ga0068862_1021502021 | 116 |
| 100 | 3300006028 | Ga0070717_10040492 | Ga0070717_100404921 | 116 |
| 101 | 3300006028 | Ga0070717_11801470 | Ga0070717_118014702 | 116 |
| 102 | 3300006038 | Ga0075365_10189006 | Ga0075365_101890063 | 116 |
| 103 | 3300006048 | Ga0075363_100323624 | Ga0075363_1003236242 | 116 |
| 104 | 3300006163 | Ga0070715_10456108 | Ga0070715_104561082 | 116 |
| 105 | 3300006173 | Ga0070716_101626374 | Ga0070716_1016263742 | 116 |
| 106 | 3300006178 | Ga0075367_10732393 | Ga0075367_107323932 | 116 |
| 107 | 3300006195 | Ga0075366_10942541 | Ga0075366_109425411 | 116 |
| 108 | 3300006237 | Ga0097621_101011462 | Ga0097621_1010114622 | 116 |
| 109 | 3300006358 | Ga0068871_100189317 | Ga0068871_1001893172 | 116 |
| 110 | 3300006847 | Ga0075431_101991511 | Ga0075431_1019915112 | 116 |
| 111 | 3300006852 | Ga0075433_11056665 | Ga0075433_110566652 | 116 |
| 112 | 3300006914 | Ga0075436_100056473 | Ga0075436_1000564732 | 116 |
| 113 | 3300006914 | Ga0075436_100110357 | Ga0075436_1001103572 | 116 |
| 114 | 3300006931 | Ga0097620_100214336 | Ga0097620_1002143362 | 116 |
| 115 | 3300007076 | Ga0075435_101073260 | Ga0075435_1010732601 | 116 |
| 116 | 3300007265 | Ga0099794_10012000 | Ga0099794_100120003 | 116 |
| 117 | 3300007788 | Ga0099795_10216851 | Ga0099795_102168512 | 116 |
| 118 | 3300009093 | Ga0105240_10016670 | Ga0105240_100166706 | 116 |
| 119 | 3300009093 | Ga0105240_10242896 | Ga0105240_102428962 | 116 |
| 120 | 3300009093 | Ga0105240_10841147 | Ga0105240_108411472 | 116 |
| 121 | 3300009094 | Ga0111539_10858331 | Ga0111539_108583312 | 116 |
| 122 | 3300009094 | Ga0111539_11709846 | Ga0111539_117098461 | 116 |
| 123 | 3300009098 | Ga0105245_10056058 | Ga0105245_100560583 | 116 |
| 124 | 3300009147 | Ga0114129_10598140 | Ga0114129_105981402 | 116 |
| 125 | 3300009147 | Ga0114129_12559394 | Ga0114129_125593941 | 116 |
| 126 | 3300009148 | Ga0105243_10145169 | Ga0105243_101451694 | 116 |
| 127 | 3300009174 | Ga0105241_10723554 | Ga0105241_107235541 | 116 |
| 128 | 3300009176 | Ga0105242_10052836 | Ga0105242_100528365 | 116 |
| 129 | 3300009176 | Ga0105242_12189156 | Ga0105242_121891561 | 116 |
| 130 | 3300009177 | Ga0105248_10091918 | Ga0105248_100919182 | 116 |
| 131 | 3300009177 | Ga0105248_11444456 | Ga0105248_114444561 | 116 |
| 132 | 3300009545 | Ga0105237_10026620 | Ga0105237_100266208 | 116 |
| 133 | 3300009545 | Ga0105237_10122885 | Ga0105237_101228852 | 116 |
| 134 | 3300009551 | Ga0105238_10072189 | Ga0105238_100721892 | 116 |
| 135 | 3300009553 | Ga0105249_11675759 | Ga0105249_116757591 | 116 |
| 136 | 3300010159 | Ga0099796_10147849 | Ga0099796_101478492 | 116 |
| 137 | 3300010375 | Ga0105239_10084353 | Ga0105239_100843535 | 116 |
| 138 | 3300010375 | Ga0105239_11498619 | Ga0105239_114986191 | 116 |
| 139 | 3300010375 | Ga0105239_13451057 | Ga0105239_134510571 | 116 |
| 140 | 3300013102 | Ga0157371_11483885 | Ga0157371_114838851 | 116 |
| 141 | 3300013296 | Ga0157374_10156640 | Ga0157374_101566405 | 116 |
| 142 | 3300013297 | Ga0157378_10315497 | Ga0157378_103154974 | 116 |
| 143 | 3300013297 | Ga0157378_10439052 | Ga0157378_104390522 | 116 |
| 144 | 3300013297 | Ga0157378_11861550 | Ga0157378_118615502 | 116 |
| 145 | 3300013297 | Ga0157378_13179245 | Ga0157378_131792451 | 116 |
| 146 | 3300013306 | Ga0163162_10210990 | Ga0163162_102109903 | 116 |
| 147 | 3300013306 | Ga0163162_12247914 | Ga0163162_122479141 | 116 |
| 148 | 3300013307 | Ga0157372_10502103 | Ga0157372_105021033 | 116 |
| 149 | 3300014325 | Ga0163163_10119224 | Ga0163163_101192244 | 116 |
| 150 | 3300014325 | Ga0163163_12419118 | Ga0163163_124191182 | 116 |
| 151 | 3300014326 | Ga0157380_10427861 | Ga0157380_104278611 | 116 |
| 152 | 3300014326 | Ga0157380_12290901 | Ga0157380_122909011 | 116 |
| 153 | 3300014968 | Ga0157379_10207070 | Ga0157379_102070701 | 116 |
| 154 | 3300014969 | Ga0157376_10146328 | Ga0157376_101463282 | 116 |
| 155 | 3300014969 | Ga0157376_10504340 | Ga0157376_105043404 | 116 |
| 156 | 3300014969 | Ga0157376_10723185 | Ga0157376_107231852 | 116 |
| 157 | 3300017792 | Ga0163161_11514502 | Ga0163161_115145022 | 116 |
| 158 | 3300025885 | Ga0207653_10043245 | Ga0207653_100432452 | 116 |
| 159 | 3300025910 | Ga0207684_10140557 | Ga0207684_101405572 | 116 |
| 160 | 3300025910 | Ga0207684_10150112 | Ga0207684_101501123 | 116 |
| 161 | 3300025910 | Ga0207684_10168113 | Ga0207684_101681132 | 116 |
| 162 | 3300025910 | Ga0207684_10241992 | Ga0207684_102419923 | 116 |
| 163 | 3300025910 | Ga0207684_10341697 | Ga0207684_103416972 | 116 |
| 164 | 3300025910 | Ga0207684_10974691 | Ga0207684_109746911 | 116 |
| 165 | 3300025910 | Ga0207684_11685274 | Ga0207684_116852741 | 116 |
| 166 | 3300025912 | Ga0207707_10103141 | Ga0207707_101031412 | 116 |
| 167 | 3300025912 | Ga0207707_10172819 | Ga0207707_101728192 | 116 |
| 168 | 3300025913 | Ga0207695_10079858 | Ga0207695_100798582 | 116 |
| 169 | 3300025914 | Ga0207671_10141005 | Ga0207671_101410053 | 116 |
| 170 | 3300025914 | Ga0207671_10166734 | Ga0207671_101667343 | 116 |
| 171 | 3300025916 | Ga0207663_11454950 | Ga0207663_114549501 | 116 |
| 172 | 3300025917 | Ga0207660_10012412 | Ga0207660_100124128 | 116 |
| 173 | 3300025917 | Ga0207660_11499139 | Ga0207660_114991391 | 116 |
| 174 | 3300025918 | Ga0207662_10162369 | Ga0207662_101623693 | 116 |
| 175 | 3300025921 | Ga0207652_10122978 | Ga0207652_101229783 | 116 |
| 176 | 3300025921 | Ga0207652_10203078 | Ga0207652_102030783 | 116 |
| 177 | 3300025922 | Ga0207646_10003625 | Ga0207646_100036257 | 116 |
| 178 | 3300025922 | Ga0207646_10031431 | Ga0207646_100314312 | 116 |
| 179 | 3300025922 | Ga0207646_10322601 | Ga0207646_103226011 | 116 |
| 180 | 3300025922 | Ga0207646_10402597 | Ga0207646_104025972 | 116 |
| 181 | 3300025924 | Ga0207694_10119927 | Ga0207694_101199272 | 116 |
| 182 | 3300025924 | Ga0207694_10633363 | Ga0207694_106333632 | 116 |
| 183 | 3300025927 | Ga0207687_10005017 | Ga0207687_100050174 | 116 |
| 184 | 3300025928 | Ga0207700_10163115 | Ga0207700_101631152 | 116 |
| 185 | 3300025934 | Ga0207686_10024122 | Ga0207686_100241226 | 116 |
| 186 | 3300025935 | Ga0207709_10758163 | Ga0207709_107581631 | 116 |
| 187 | 3300025941 | Ga0207711_10042799 | Ga0207711_100427992 | 116 |
| 188 | 3300025942 | Ga0207689_10756127 | Ga0207689_107561271 | 116 |
| 189 | 3300025949 | Ga0207667_11330703 | Ga0207667_113307031 | 116 |
| 190 | 3300025981 | Ga0207640_11320684 | Ga0207640_113206842 | 116 |
| 191 | 3300025986 | Ga0207658_11099165 | Ga0207658_110991651 | 116 |
| 192 | 3300026023 | Ga0207677_10061153 | Ga0207677_100611533 | 116 |
| 193 | 3300026035 | Ga0207703_10329798 | Ga0207703_103297983 | 116 |
| 194 | 3300026041 | Ga0207639_10068609 | Ga0207639_100686095 | 116 |
| 195 | 3300026078 | Ga0207702_10306843 | Ga0207702_103068432 | 116 |
| 196 | 3300026088 | Ga0207641_10032361 | Ga0207641_100323614 | 116 |
| 197 | 3300026088 | Ga0207641_11018231 | Ga0207641_110182312 | 116 |
| 198 | 3300026088 | Ga0207641_11094743 | Ga0207641_110947431 | 116 |
| 199 | 3300026116 | Ga0207674_11343624 | Ga0207674_113436242 | 116 |
| 200 | 3300026121 | Ga0207683_10023025 | Ga0207683_100230254 | 116 |
| 201 | 3300027671 | Ga0209588_1019591 | Ga0209588_10195913 | 116 |
| 202 | 3300028381 | Ga0268264_10754988 | Ga0268264_107549882 | 116 |
| 203 | 3300028800 | Ga0265338_10305541 | Ga0265338_103055412 | 116 |
| 204 | 3300031250 | Ga0265331_10074703 | Ga0265331_100747032 | 116 |
| 205 | 3300031250 | Ga0265331_10115265 | Ga0265331_101152651 | 116 |
| 206 | 3300035113 | Ga0373936_0063347 | Ga0373936_0063347_185_571 | 116 |
| 207 | 3300035171 | Ga0373946_0148073 | Ga0373946_0148073_515_871 | 116 |
| 208 | 3300035692 | Ga0373935_0174525 | Ga0373935_0174525_1042_1398 | 116 |
| 209 | 3300035695 | Ga0373927_0000683 | Ga0373927_0000683_10147_10503 | 116 |
| 210 | 3300035695 | Ga0373927_0052665 | Ga0373927_0052665_1395_1745 | 116 |
| 211 | 3300035695 | Ga0373927_0059203 | Ga0373927_0059203_1124_1480 | 116 |
| 212 | 3300035725 | Ga0373947_0012711 | Ga0373947_0012711_1747_2103 | 116 |
| 213 | 3300035725 | Ga0373947_0230067 | Ga0373947_0230067_135_491 | 116 |
| 214 | 3300035725 | Ga0373947_0282524 | Ga0373947_0282524_292_678 | 116 |
| 215 | 3300037068 | Ga0373925_0000564 | Ga0373925_0000564_14052_14408 | 116 |
| 216 | 3300037471 | Ga0395905_1226309 | Ga0395905_1226309_228_584 | 116 |
| 217 | 3300042461 | Ga0439460_0314097 | Ga0439460_0314097_120_476 | 116 |
| 218 | 3300044673 | Ga0453683_0397113 | Ga0453683_0397113_188_547 | 116 |
| 219 | 3300046472 | Ga0495580_0752128 | Ga0495580_0752128_49_405 | 116 |
| 220 | 3300046517 | Ga0495630_0523707 | Ga0495630_0523707_319_675 | 116 |
| 221 | 3300046517 | Ga0495630_1347332 | Ga0495630_1347332_116_472 | 116 |
| 222 | 3300046518 | Ga0495631_0206425 | Ga0495631_0206425_195_545 | 116 |
| 223 | 3300046523 | Ga0495644_0058054 | Ga0495644_0058054_220_576 | 116 |
| 224 | 3300046526 | Ga0495666_0296884 | Ga0495666_0296884_219_575 | 116 |
| 225 | 3300046559 | Ga0495667_0210752 | Ga0495667_0210752_194_544 | 116 |
| 226 | 3300046615 | Ga0495656_0048286 | Ga0495656_0048286_1124_1480 | 116 |
| 227 | 3300047318 | Ga0495636_0228468 | Ga0495636_0228468_31_387 | 116 |
| 228 | 3300048905 | Ga0496102_0971562 | Ga0496102_0971562_80_436 | 116 |
| 229 | 3300048906 | Ga0496103_0280182 | Ga0496103_0280182_570_926 | 116 |
| 230 | 3300048907 | Ga0496104_0399181 | Ga0496104_0399181_31_387 | 116 |
| 231 | 3300048908 | Ga0496105_0151621 | Ga0496105_0151621_600_956 | 116 |
| 232 | 3300048911 | Ga0496108_0014076 | Ga0496108_0014076_4721_5077 | 116 |
| 233 | 3300048912 | Ga0496109_0076297 | Ga0496109_0076297_571_927 | 116 |
| 234 | 3300048913 | Ga0496110_0207988 | Ga0496110_0207988_1292_1648 | 116 |
| 235 | 3300048914 | Ga0496111_0028345 | Ga0496111_0028345_2203_2559 | 116 |
| 236 | 3300048917 | Ga0496114_0004307 | Ga0496114_0004307_5479_5835 | 116 |
| 237 | 3300048918 | Ga0496115_0221039 | Ga0496115_0221039_772_1122 | 116 |
| 238 | 3300048918 | Ga0496115_0294200 | Ga0496115_0294200_37_393 | 116 |
| 239 | 3300048918 | Ga0496115_0397997 | Ga0496115_0397997_436_792 | 116 |
| 240 | 3300050489 | nmdc:mga03683_486969_c1 | nmdc:mga03683_486969_c1_134_490 | 116 |
| 241 | 3300050490 | nmdc:mga03n38_573889_c1 | nmdc:mga03n38_573889_c1_198_554 | 116 |
| 242 | 3300050492 | nmdc:mga0yw44_1008690_c1 | nmdc:mga0yw44_1008690_c1_29_379 | 116 |
| 243 | 3300050493 | nmdc:mga0k408_770701_c1 | nmdc:mga0k408_770701_c1_78_434 | 116 |
| 244 | 3300050494 | nmdc:mga06z11_303401_c1 | nmdc:mga06z11_303401_c1_489_845 | 116 |
| 245 | 3300050507 | nmdc:mga05p37_373657_c1 | nmdc:mga05p37_373657_c1_1204_1554 | 116 |
| 246 | 3300050513 | nmdc:mga0rr50_520393_c1 | nmdc:mga0rr50_520393_c1_613_963 | 116 |
| 247 | 3300050514 | nmdc:mga08x19_126902_c1 | nmdc:mga08x19_126902_c1_591_941 | 116 |
| 248 | 3300050514 | nmdc:mga08x19_8151_c1 | nmdc:mga08x19_8151_c1_680_1036 | 116 |
| 249 | 3300050515 | nmdc:mga0a205_373013_c1 | nmdc:mga0a205_373013_c1_226_576 | 116 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3gm5-assembly1.cif.gz_A-2 | crystal structure of a putative methylmalonyl-coenzyme a epimerase from thermoanaerobacter tengcongensis at 2.0 a resolution | 0.8405 | 60 | 107 |
| 6bnz-assembly1.cif.gz_A | crystal structure of e144q-glyoxalase i mutant from zea mays in space group p4(1)2(1)2 | 0.7914 | 57 | 107 |
| 1tg5-assembly1.cif.gz_A-2 | crystal structures of plant 4-hydroxyphenylpyruvate dioxygenases complexed with das645 | 0.7884 | 60 | 109 |
| 5d7z-assembly1.cif.gz_A | crystal structure of glyoxalase i from zea mays | 0.7838 | 57 | 107 |
| 8aid-assembly2.cif.gz_D | crystal structure of n-terminally truncated pa4183 from p. aeruginosa pao1 | 0.7517 | 60 | 112 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3gm5A00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8405 | 60 | 107 | 3.10.180.10 |
| 4huzA02 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8226 | 60 | 111 | 3.10.180.10 |
| 3oajB02 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.7981 | 60 | 106 | 3.10.180.10 |
| 5yy7B01 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.7623 | 55 | 109 | 3.10.180.10 |
| af_F8Y416_244_316_2.20.25.80 | Mainly Beta;Single Sheet;N-terminal domain of TfIIb;WRKY domain | 0.7521 | 76 | 109 | 2.20.25.80 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A536BTK3-F1-model_v4 | Extradiol dioxygenase | 0.9643 | 1 | 112 |
GO:0051213
|
| AF-A0A535S9I3-F1-model_v4 | Extradiol dioxygenase | 0.9612 | 8 | 113 |
GO:0051213
|
| AF-A0A177HGC2-F1-model_v4 | Glyoxalase-like domain protein | 0.9592 | 2 | 112 |
|
| AF-A0A535XI71-F1-model_v4 | Extradiol dioxygenase | 0.958 | 1 | 112 |
GO:0051213
|
| AF-A0A3R9NYE2-F1-model_v4 | VOC domain-containing protein | 0.9533 | 2 | 116 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar