F360774

General Info

Members Datasets Scaffolds Average Seq Length
249 173 498 290

Family's Representative Sequence

Representative Sequence 3300025273|Ga0209673_1031458|Ga0209673_10314582
Length 301
Sequence MRDFSQDHRWLSINTATLRKSRGADLPLPDIIEACVRKGVRAISPWRDQVHAAGLAKVSQLVRTHGLELSGYCRGGMFPAADAAGLQAARDDNRRAVDEAAELRAPCLVLVVGGLPGALQGQAAHKDIALARSQVRDGIAELLEYAKKARMPLAIEPLHPMYAADRACVNTMEQALDLCDALDPQPRTSASSERTQASLGVAVDVYHVWWDPKLEQQIARAGKERILAFHVCDWMTPTTDLLNDRGMMGDGVIDIPRIRGWVEAQGFAGYSEVEIFSTNNWYRRPHEETLDTCIARHRTVV

Samples

Sample ID Description Type Environment
1 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
14 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
15 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
16 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
17 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
22 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
59 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
60 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
61 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
62 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
63 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
65 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
68 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
70 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
73 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
90 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
91 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
92 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
93 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
94 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
95 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
96 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
97 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
98 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
101 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
103 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
104 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
105 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
106 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
107 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
108 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
109 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
110 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
111 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
112 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
113 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
114 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
115 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
116 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
117 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
118 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
119 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
120 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
121 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
122 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
123 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
124 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
125 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
126 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
127 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
128 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
129 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
130 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
131 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
132 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
133 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
134 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
135 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
136 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
137 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
138 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
139 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
140 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
141 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
152 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
153 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
154 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
155 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
156 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
157 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
158 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
159 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
160 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
161 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
162 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
163 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
164 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
165 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
166 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
167 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
168 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
169 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
170 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
171 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
172 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
173 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.19
Metatranscriptomes 0
Isolates 2.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 38.96
Nodule 0
Rhizoplane 0
Rhizosphere 53.41
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209673_1031458 3300025273 Bacteria 1651
2 JGI25156J39149_1000002 3300002705 Bacteria 343501
3 JGI25154J39366_1000010 3300002738 Bacteria 297985
4 JGI25157J39369_1000001 3300002741 Bacteria 363277
5 JGI25159J45721_1000315 3300002987 Bacteria 22604
6 JGI25151J46595_10009905 3300003187 Bacteria 4474
7 rootH1_10036976 3300003323 Bacteria 7659
8 JGI25160J50197_1000192 3300003354 Bacteria 51376
9 JGI25161J50226_1000082 3300003374 Bacteria 78461
10 Ga0055526_1011521 3300003771 Bacteria 3972
11 Ga0055537_1000259 3300003773 Bacteria 38671
12 Ga0055524_1000156 3300003775 Bacteria 79669
13 Ga0055536_1000270 3300003781 Bacteria 39711
14 Ga0055534_1004872 3300003784 Bacteria 3755
15 Ga0055528_1001366 3300003790 Bacteria 15009
16 Ga0055530_10000408 3300003791 Bacteria 38218
17 Ga0055540_1000033 3300003792 Bacteria 172048
18 Ga0055540_1003203 3300003792 Bacteria 8042
19 Ga0055540_1006566 3300003792 Bacteria 4590
20 Ga0055531_10000273 3300003794 Bacteria 53570
21 Ga0055531_10002940 3300003794 Bacteria 11088
22 Ga0055543_1000127 3300004625 Bacteria 63245
23 Ga0065165_1020052 3300005262 Bacteria 2367
24 Ga0065704_10117547 3300005289 Bacteria 1832
25 Ga0065707_10081825 3300005295 Bacteria 35840
26 Ga0068869_100140272 3300005334 Bacteria 1866
27 Ga0070668_100115920 3300005347 Bacteria 2136
28 Ga0070671_100007394 3300005355 Bacteria 8775
29 Ga0070674_100065418 3300005356 Bacteria 2552
30 Ga0068867_100003739 3300005459 Bacteria 10713
31 Ga0068867_100017842 3300005459 Bacteria 5041
32 Ga0070665_100260540 3300005548 Bacteria 1735
33 Ga0068855_100164197 3300005563 Bacteria 2519
34 Ga0068852_100486631 3300005616 Bacteria 1227
35 Ga0068859_100443897 3300005617 Bacteria 1394
36 Ga0068864_100188044 3300005618 Bacteria 1892
37 Ga0068866_10013647 3300005718 Bacteria 3570
38 Ga0068861_100047179 3300005719 Bacteria 3250
39 Ga0068861_100049458 3300005719 Bacteria 3183
40 Ga0068863_100195623 3300005841 Bacteria 1944
41 Ga0068858_100107529 3300005842 Bacteria 2604
42 Ga0068860_100008041 3300005843 Bacteria 10516
43 Ga0068862_100063068 3300005844 Bacteria 3189
44 Ga0081455_10020274 3300005937 Bacteria 6266
45 Ga0075365_10009437 3300006038 Bacteria 5610
46 Ga0075365_10035990 3300006038 Bacteria 3206
47 Ga0075365_10081442 3300006038 Bacteria 2193
48 Ga0075362_10002836 3300006177 Bacteria 5914
49 Ga0075362_10004617 3300006177 Bacteria 4963
50 Ga0075362_10110149 3300006177 Bacteria 1295
51 Ga0075367_10011270 3300006178 Bacteria 4723
52 Ga0075367_10034615 3300006178 Bacteria 2919
53 Ga0075369_10010578 3300006186 Bacteria 3611
54 Ga0075366_10002258 3300006195 Bacteria 9841
55 Ga0075366_10024826 3300006195 Bacteria 3496
56 Ga0075366_10025076 3300006195 Bacteria 3480
57 Ga0075366_10047564 3300006195 Bacteria 2543
58 Ga0075366_10091485 3300006195 Bacteria 1822
59 Ga0075370_10001670 3300006353 Bacteria 9822
60 Ga0075370_10013125 3300006353 Bacteria 4396
61 Ga0068865_100046877 3300006881 Bacteria 2967
62 Ga0068865_100128275 3300006881 Bacteria 1897
63 Ga0097620_100443897 3300006931 Bacteria 1394
64 Ga0105245_10189241 3300009098 Bacteria 1970
65 Ga0105249_10065970 3300009553 Bacteria 3332
66 Ga0157370_10144045 3300013104 Bacteria 2219
67 Ga0163162_10127644 3300013306 Bacteria 2651
68 Ga0163162_10595012 3300013306 Bacteria 1233
69 Ga0157375_10215743 3300013308 Bacteria 2077
70 Ga0163163_10172492 3300014325 Bacteria 2209
71 Ga0157380_10081415 3300014326 Bacteria 2648
72 Ga0157379_10014706 3300014968 Bacteria 6865
73 Ga0157376_10002902 3300014969 Bacteria 11751
74 Ga0163161_10029748 3300017792 Bacteria 3884
75 Ga0209435_100001 3300025206 Bacteria 1424171
76 Ga0207425_1000931 3300025245 Bacteria 13926
77 Ga0207425_1003633 3300025245 Bacteria 4868
78 Ga0209646_1000001 3300025246 Bacteria 3092932
79 Ga0209026_1000001 3300025250 Bacteria 1228671
80 Ga0209759_1000001 3300025256 Bacteria 2799452
81 Ga0209565_1000326 3300025263 Bacteria 42448
82 Ga0209565_1000791 3300025263 Bacteria 18307
83 Ga0209673_1000839 3300025273 Bacteria 40180
84 Ga0209130_1000041 3300025284 Bacteria 261078
85 Ga0209130_1001694 3300025284 Bacteria 13330
86 Ga0209675_1000482 3300025291 Bacteria 30258
87 Ga0209675_1005005 3300025291 Bacteria 5686
88 Ga0209676_1000054 3300025292 Bacteria 365890
89 Ga0209676_1016108 3300025292 Bacteria 2719
90 Ga0209025_1001546 3300025294 Bacteria 29313
91 Ga0209025_1001743 3300025294 Bacteria 26113
92 Ga0209025_1030173 3300025294 Bacteria 2602
93 Ga0209564_1000784 3300025295 Bacteria 44001
94 Ga0209564_1006820 3300025295 Bacteria 6033
95 Ga0209758_1029959 3300025297 Bacteria 2263
96 Ga0209758_1040436 3300025297 Bacteria 1758
97 Ga0209758_1041272 3300025297 Bacteria 1728
98 Ga0209050_1000003 3300025298 Bacteria 1609245
99 Ga0209050_1005930 3300025298 Bacteria 7445
100 Ga0209050_1018395 3300025298 Bacteria 2717
101 Ga0209256_1000001 3300025299 Bacteria 2166974
102 Ga0207426_1000061 3300025302 Bacteria 362507
103 Ga0207426_1001845 3300025302 Bacteria 15584
104 Ga0209051_1000003 3300025303 Bacteria 1609245
105 Ga0209051_1000529 3300025303 Bacteria 47407
106 Ga0209051_1001130 3300025303 Bacteria 24433
107 Ga0209257_1000012 3300025304 Bacteria 1111138
108 Ga0209257_1000018 3300025304 Bacteria 836016
109 Ga0209257_1025320 3300025304 Bacteria 2029
110 Ga0207687_10034092 3300025927 Bacteria 3455
111 Ga0207669_10063318 3300025937 Bacteria 2282
112 Ga0207691_10057878 3300025940 Bacteria 3526
113 Ga0207689_10298478 3300025942 Bacteria 1335
114 Ga0207712_10022103 3300025961 Bacteria 4185
115 Ga0207677_10044694 3300026023 Bacteria 2953
116 Ga0207703_10095215 3300026035 Bacteria 2512
117 Ga0207708_10175803 3300026075 Bacteria 1698
118 Ga0207648_10001021 3300026089 Bacteria 31511
119 Ga0207648_10042453 3300026089 Bacteria 3992
120 Ga0207648_10086953 3300026089 Bacteria 2728
121 Ga0207648_10182929 3300026089 Bacteria 1855
122 Ga0207676_10388815 3300026095 Bacteria 1300
123 Ga0207675_100001107 3300026118 Bacteria 26669
124 Ga0209970_1000441 3300027614 Bacteria 7088
125 Ga0268265_10006824 3300028380 Bacteria 7726
126 Ga0268264_10003509 3300028381 Bacteria 13517
127 Ga0307517_10119004 3300028786 Bacteria 1963
128 Ga0307517_10123221 3300028786 Bacteria 1905
129 Ga0307515_10000006 3300028794 Bacteria 725810
130 Ga0307515_10117257 3300028794 Bacteria 3049
131 Ga0307513_10000012 3300031456 Bacteria 328865
132 Ga0307513_10000285 3300031456 Bacteria 73356
133 Ga0307513_10002218 3300031456 Bacteria 27161
134 Ga0307408_100001846 3300031548 Bacteria 15426
135 Ga0307408_100039455 3300031548 Bacteria 3338
136 Ga0265314_10131788 3300031711 Bacteria 1558
137 Ga0265342_10043496 3300031712 Bacteria 2710
138 Ga0307516_10010756 3300031730 Bacteria 10022
139 Ga0307405_10004300 3300031731 Bacteria 6705
140 Ga0307406_10123486 3300031901 Bacteria 1804
141 Ga0307412_10007737 3300031911 Bacteria 6110
142 Ga0307416_100161247 3300032002 Bacteria 2073
143 Ga0307416_100230058 3300032002 Bacteria 1786
144 Ga0307411_10001973 3300032005 Bacteria 8799
145 Ga0373925_0010570 3300037068 Bacteria 6693
146 Ga0395898_0008676 3300037466 Bacteria 10722
147 Ga0395905_0008547 3300037471 Bacteria 10096
148 Ga0395901_0104315 3300038443 Bacteria 2975
149 Ga0439436_0003624 3300041404 Bacteria 4703
150 Ga0439439_0012423 3300041406 Bacteria 2060
151 Ga0439447_010420 3300041407 Bacteria 2758
152 Ga0439466_0000854 3300041411 Bacteria 11623
153 Ga0439466_0005369 3300041411 Bacteria 4900
154 Ga0439465_0000034 3300041413 Bacteria 28027
155 Ga0439431_0000727 3300041997 Bacteria 7098
156 Ga0439433_0009497 3300041999 Bacteria 2121
157 Ga0439445_0000511 3300042004 Bacteria 7863
158 Ga0439432_008034 3300042006 Bacteria 3718
159 Ga0439449_0004176 3300042007 Bacteria 5581
160 Ga0439449_0008110 3300042007 Bacteria 3991
161 Ga0439449_0012112 3300042007 Bacteria 3241
162 Ga0439449_0028973 3300042007 Bacteria 2063
163 Ga0439452_014584 3300042010 Bacteria 2178
164 Ga0439457_006314 3300042014 Bacteria 2911
165 Ga0439462_0001371 3300042015 Bacteria 5384
166 Ga0439462_0005624 3300042015 Bacteria 3095
167 Ga0450911_018619 3300042115 Bacteria 912
168 Ga0450898_000684 3300042134 Bacteria 4088
169 Ga0450898_008056 3300042134 Bacteria 1653
170 Ga0450902_009682 3300042137 Bacteria 1520
171 Ga0450906_002699 3300042145 Bacteria 3862
172 Ga0439434_0004418 3300042435 Bacteria 4110
173 Ga0439434_0018033 3300042435 Bacteria 2112
174 Ga0450893_0011826 3300042532 Bacteria 1445
175 Ga0466965_0067449 3300044683 Bacteria 1796
176 Ga0466961_0157243 3300044693 Bacteria 1418
177 Ga0466970_0254888 3300044765 Bacteria 984
178 Ga0466957_0111969 3300044842 Bacteria 1732
179 Ga0466957_0181260 3300044842 Bacteria 1376
180 Ga0495638_0005707 3300046460 Bacteria 9167
181 Ga0495632_0054012 3300046519 Bacteria 1970
182 Ga0495665_0025231 3300046531 Bacteria 3193
183 Ga0495621_0026982 3300046539 Bacteria 1942
184 Ga0495611_0046472 3300046648 Bacteria 1947
185 Ga0495625_0000896 3300046660 Bacteria 40225
186 Ga0495625_0017045 3300046660 Bacteria 5693
187 Ga0495625_0163205 3300046660 Bacteria 1491
188 Ga0495649_0004910 3300046694 Bacteria 8623
189 Ga0495660_0031288 3300046810 Bacteria 2992
190 Ga0495581_0016476 3300047315 Bacteria 4296
191 Ga0495636_0081975 3300047318 Bacteria 1390
192 Ga0495685_016406 3300047447 Bacteria 2530
193 Ga0495626_0106854 3300048091 Bacteria 1215
194 Ga0496121_0004129 3300048924 Bacteria 19884
195 Ga0501032_0015947 3300049569 Bacteria 5289
196 Ga0501033_0001652 3300049570 Bacteria 19522
197 Ga0501033_0151447 3300049570 Bacteria 1673
198 Ga0501034_0082503 3300049571 Bacteria 3216
199 Ga0501036_0001669 3300049572 Bacteria 17200
200 Ga0501037_0040203 3300049573 Bacteria 3441
201 Ga0501037_0042429 3300049573 Bacteria 3342
202 Ga0501038_0043674 3300049574 Bacteria 3896
203 Ga0501043_0004134 3300049579 Bacteria 11860
204 Ga0501046_0010185 3300049580 Bacteria 8089
205 Ga0501046_0174008 3300049580 Bacteria 1614
206 Ga0501046_0198351 3300049580 Bacteria 1494
207 Ga0501047_0001038 3300049581 Bacteria 27775
208 Ga0501047_0183716 3300049581 Bacteria 1957
209 Ga0501035_0021541 3300049822 Bacteria 5926
210 Ga0501035_0206983 3300049822 Bacteria 1680
211 Ga0501044_0024356 3300049823 Bacteria 6428
212 nmdc:mga03683_1222_c1 3300050489 Bacteria 7587
213 nmdc:mga03683_38050_c1 3300050489 Bacteria 1963
214 nmdc:mga03683_5855_c1 3300050489 Bacteria 4177
215 nmdc:mga03683_9372_c1 3300050489 Bacteria 3478
216 nmdc:mga03n38_119422_c1 3300050490 Bacteria 1294
217 nmdc:mga03n38_29315_c1 3300050490 Bacteria 2302
218 nmdc:mga00v17_32223_c1 3300050491 Bacteria 3097
219 nmdc:mga00v17_37675_c1 3300050491 Bacteria 2888
220 nmdc:mga0yw44_114278_c1 3300050492 Bacteria 1733
221 nmdc:mga0yw44_20255_c1 3300050492 Bacteria 3687
222 nmdc:mga0k408_11411_c2 3300050493 Bacteria 4253
223 nmdc:mga0k408_138519_c1 3300050493 Bacteria 1447
224 nmdc:mga0k408_1652_c1 3300050493 Bacteria 12054
225 nmdc:mga0k408_5128_c1 3300050493 Bacteria 6939
226 nmdc:mga0k408_8366_c1 3300050493 Bacteria 5552
227 nmdc:mga0k408_83790_c1 3300050493 Bacteria 1870
228 nmdc:mga0k408_88397_c1 3300050493 Bacteria 1820
229 nmdc:mga0k408_93423_c1 3300050493 Bacteria 1769
230 nmdc:mga06z11_1107_c1 3300050494 Bacteria 9841
231 nmdc:mga07m45_127_c1 3300050496 Bacteria 30414
232 nmdc:mga07m45_1407_c1 3300050496 Bacteria 11010
233 nmdc:mga07m45_614_c1 3300050496 Bacteria 15154
234 nmdc:mga0sz30_40045_c1 3300050516 Bacteria 1969
235 Ga0500650_0006663 3300053098 Bacteria 4433
236 Ga0500593_000393 3300053117 Bacteria 17401
237 Ga0500658_0005005 3300053134 Bacteria 4938
238 Ga0500568_0002786 3300053139 Bacteria 10110
239 Ga0500590_027634 3300053148 Bacteria 2943
240 Ga0500634_0110060 3300053161 Bacteria 1361
241 Ga0500645_000426 3300053730 Bacteria 29176
242 Ga0500645_000739 3300053730 Bacteria 20078
243 2511244337 2511231002 Bacteria 5042903
244 2881101436 2881101125 Bacteria 4590519
245 2885195608 2885192300 Bacteria 5882526
246 2902839937 2902837492 Bacteria 6697721
247 2904479926 2904479285 Bacteria 5073931
248 2919707343 2919704043 Bacteria 5560311
249 2945948724 2945945610 Bacteria 5951079
250 Ga0209673_1031458
251 JGI25156J39149_1000002
252 JGI25154J39366_1000010
253 JGI25157J39369_1000001
254 JGI25159J45721_1000315
255 JGI25151J46595_10009905
256 rootH1_10036976
257 JGI25160J50197_1000192
258 JGI25161J50226_1000082
259 Ga0055526_1011521
260 Ga0055537_1000259
261 Ga0055524_1000156
262 Ga0055536_1000270
263 Ga0055534_1004872
264 Ga0055528_1001366
265 Ga0055530_10000408
266 Ga0055540_1000033
267 Ga0055540_1003203
268 Ga0055540_1006566
269 Ga0055531_10000273
270 Ga0055531_10002940
271 Ga0055543_1000127
272 Ga0065165_1020052
273 Ga0065704_10117547
274 Ga0065707_10081825
275 Ga0068869_100140272
276 Ga0070668_100115920
277 Ga0070671_100007394
278 Ga0070674_100065418
279 Ga0068867_100003739
280 Ga0068867_100017842
281 Ga0070665_100260540
282 Ga0068855_100164197
283 Ga0068852_100486631
284 Ga0068859_100443897
285 Ga0068864_100188044
286 Ga0068866_10013647
287 Ga0068861_100047179
288 Ga0068861_100049458
289 Ga0068863_100195623
290 Ga0068858_100107529
291 Ga0068860_100008041
292 Ga0068862_100063068
293 Ga0081455_10020274
294 Ga0075365_10009437
295 Ga0075365_10035990
296 Ga0075365_10081442
297 Ga0075362_10002836
298 Ga0075362_10004617
299 Ga0075362_10110149
300 Ga0075367_10011270
301 Ga0075367_10034615
302 Ga0075369_10010578
303 Ga0075366_10002258
304 Ga0075366_10024826
305 Ga0075366_10025076
306 Ga0075366_10047564
307 Ga0075366_10091485
308 Ga0075370_10001670
309 Ga0075370_10013125
310 Ga0068865_100046877
311 Ga0068865_100128275
312 Ga0097620_100443897
313 Ga0105245_10189241
314 Ga0105249_10065970
315 Ga0157370_10144045
316 Ga0163162_10127644
317 Ga0163162_10595012
318 Ga0157375_10215743
319 Ga0163163_10172492
320 Ga0157380_10081415
321 Ga0157379_10014706
322 Ga0157376_10002902
323 Ga0163161_10029748
324 Ga0209435_100001
325 Ga0207425_1000931
326 Ga0207425_1003633
327 Ga0209646_1000001
328 Ga0209026_1000001
329 Ga0209759_1000001
330 Ga0209565_1000326
331 Ga0209565_1000791
332 Ga0209673_1000839
333 Ga0209130_1000041
334 Ga0209130_1001694
335 Ga0209675_1000482
336 Ga0209675_1005005
337 Ga0209676_1000054
338 Ga0209676_1016108
339 Ga0209025_1001546
340 Ga0209025_1001743
341 Ga0209025_1030173
342 Ga0209564_1000784
343 Ga0209564_1006820
344 Ga0209758_1029959
345 Ga0209758_1040436
346 Ga0209758_1041272
347 Ga0209050_1000003
348 Ga0209050_1005930
349 Ga0209050_1018395
350 Ga0209256_1000001
351 Ga0207426_1000061
352 Ga0207426_1001845
353 Ga0209051_1000003
354 Ga0209051_1000529
355 Ga0209051_1001130
356 Ga0209257_1000012
357 Ga0209257_1000018
358 Ga0209257_1025320
359 Ga0207687_10034092
360 Ga0207669_10063318
361 Ga0207691_10057878
362 Ga0207689_10298478
363 Ga0207712_10022103
364 Ga0207677_10044694
365 Ga0207703_10095215
366 Ga0207708_10175803
367 Ga0207648_10001021
368 Ga0207648_10042453
369 Ga0207648_10086953
370 Ga0207648_10182929
371 Ga0207676_10388815
372 Ga0207675_100001107
373 Ga0209970_1000441
374 Ga0268265_10006824
375 Ga0268264_10003509
376 Ga0307517_10119004
377 Ga0307517_10123221
378 Ga0307515_10000006
379 Ga0307515_10117257
380 Ga0307513_10000012
381 Ga0307513_10000285
382 Ga0307513_10002218
383 Ga0307408_100001846
384 Ga0307408_100039455
385 Ga0265314_10131788
386 Ga0265342_10043496
387 Ga0307516_10010756
388 Ga0307405_10004300
389 Ga0307406_10123486
390 Ga0307412_10007737
391 Ga0307416_100161247
392 Ga0307416_100230058
393 Ga0307411_10001973
394 Ga0373925_0010570
395 Ga0395898_0008676
396 Ga0395905_0008547
397 Ga0395901_0104315
398 Ga0439436_0003624
399 Ga0439439_0012423
400 Ga0439447_010420
401 Ga0439466_0000854
402 Ga0439466_0005369
403 Ga0439465_0000034
404 Ga0439431_0000727
405 Ga0439433_0009497
406 Ga0439445_0000511
407 Ga0439432_008034
408 Ga0439449_0004176
409 Ga0439449_0008110
410 Ga0439449_0012112
411 Ga0439449_0028973
412 Ga0439452_014584
413 Ga0439457_006314
414 Ga0439462_0001371
415 Ga0439462_0005624
416 Ga0450911_018619
417 Ga0450898_000684
418 Ga0450898_008056
419 Ga0450902_009682
420 Ga0450906_002699
421 Ga0439434_0004418
422 Ga0439434_0018033
423 Ga0450893_0011826
424 Ga0466965_0067449
425 Ga0466961_0157243
426 Ga0466970_0254888
427 Ga0466957_0111969
428 Ga0466957_0181260
429 Ga0495638_0005707
430 Ga0495632_0054012
431 Ga0495665_0025231
432 Ga0495621_0026982
433 Ga0495611_0046472
434 Ga0495625_0000896
435 Ga0495625_0017045
436 Ga0495625_0163205
437 Ga0495649_0004910
438 Ga0495660_0031288
439 Ga0495581_0016476
440 Ga0495636_0081975
441 Ga0495685_016406
442 Ga0495626_0106854
443 Ga0496121_0004129
444 Ga0501032_0015947
445 Ga0501033_0001652
446 Ga0501033_0151447
447 Ga0501034_0082503
448 Ga0501036_0001669
449 Ga0501037_0040203
450 Ga0501037_0042429
451 Ga0501038_0043674
452 Ga0501043_0004134
453 Ga0501046_0010185
454 Ga0501046_0174008
455 Ga0501046_0198351
456 Ga0501047_0001038
457 Ga0501047_0183716
458 Ga0501035_0021541
459 Ga0501035_0206983
460 Ga0501044_0024356
461 nmdc:mga03683_1222_c1
462 nmdc:mga03683_38050_c1
463 nmdc:mga03683_5855_c1
464 nmdc:mga03683_9372_c1
465 nmdc:mga03n38_119422_c1
466 nmdc:mga03n38_29315_c1
467 nmdc:mga00v17_32223_c1
468 nmdc:mga00v17_37675_c1
469 nmdc:mga0yw44_114278_c1
470 nmdc:mga0yw44_20255_c1
471 nmdc:mga0k408_11411_c2
472 nmdc:mga0k408_138519_c1
473 nmdc:mga0k408_1652_c1
474 nmdc:mga0k408_5128_c1
475 nmdc:mga0k408_8366_c1
476 nmdc:mga0k408_83790_c1
477 nmdc:mga0k408_88397_c1
478 nmdc:mga0k408_93423_c1
479 nmdc:mga06z11_1107_c1
480 nmdc:mga07m45_127_c1
481 nmdc:mga07m45_1407_c1
482 nmdc:mga07m45_614_c1
483 nmdc:mga0sz30_40045_c1
484 Ga0500650_0006663
485 Ga0500593_000393
486 Ga0500658_0005005
487 Ga0500568_0002786
488 Ga0500590_027634
489 Ga0500634_0110060
490 Ga0500645_000426
491 Ga0500645_000739
492 2511244337
493 2881101436
494 2885195608
495 2902839937
496 2904479926
497 2919707343
498 2945948724

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

30

294

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ju2-assembly1.cif.gz_A crystal structure of protein smc04130 from sinorhizobium meliloti 1021 0.9293 10 291
7vpf-assembly1.cif.gz_B crystal structure of a novel putative sugar isomerase from the psychrophilic bacterium paenibacillus sp. r4 0.9292 1 292
7vpf-assembly1.cif.gz_B crystal structure of a novel putative sugar isomerase from the psychrophilic bacterium paenibacillus sp. r4 0.926 1 292
3ju2-assembly1.cif.gz_A crystal structure of protein smc04130 from sinorhizobium meliloti 1021 0.9066 10 291
1i6n-assembly1.cif.gz_A 1.8 a crystal structure of ioli protein with a binding zinc atom 0.8297 11 290
ID Description Score Start End Superfamily
3qc0A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9359 10 292 3.20.20.150
3qc0A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9224 10 292 3.20.20.150
1i60A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8457 11 290 3.20.20.150
1k77A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8167 10 265 3.20.20.150
1i60A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.814 11 290 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A519LGP0-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9469 1 170 GO:0016853
AF-A0A485D0L5-F1-model_v4 Hydroxypyruvate isomerase 0.9465 6 200 GO:0016853
AF-A0A6P0DVV6-F1-model_v4 TIM barrel protein 0.9383 29 151
AF-A0A212RD23-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9366 10 292 GO:0016853
AF-A0A519LGP0-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9362 1 170 GO:0016853

Map