F360802

General Info

Members Datasets Scaffolds Average Seq Length
249 164 498 273

Family's Representative Sequence

Representative Sequence 3300025934|Ga0207686_10128430|Ga0207686_101284302
Length 297
Sequence MPDQTSTARWRFRTRLAPVKVHHLNCGSLCPHGRRLLNGEGGLLEKGHIVCHCLAIETGEGLVLVDTGFGIEDARNPRQLGAIFGLMNAEPKVETTALKQLEALGFGADDVRQVVVTHLDPDHSGGLPDFPNAEVHVLSTELDAALQPSLKDKLRYPDAHWKHGPRWVRHDKGGDDWFGFESVRILPGLDAEVLLIPLFGHSRGHTGVALRTGEGWLLHCGDAYFNHGEIETPASCPPGLRFFQLLNADDGKARRRNRDRLQELAVRHGEEITLLCSHDPHELAREQAKAGAATPTG

Samples

Sample ID Description Type Environment
1 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
32 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
49 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
78 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
79 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
80 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
81 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
82 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
83 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
84 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
85 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
86 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
87 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
88 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
89 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
90 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
91 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
92 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
93 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
94 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
95 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
96 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
97 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
98 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
99 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
100 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
101 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
102 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
103 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
104 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
105 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
106 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
107 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
108 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
109 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
110 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
111 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
112 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
113 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
114 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
115 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
116 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
117 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
118 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
119 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
120 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
121 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
122 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
123 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
124 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
125 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
126 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
127 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
128 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
129 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
130 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
131 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
132 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
133 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
134 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
135 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
136 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
137 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
138 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
139 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
140 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
141 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
142 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
143 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
144 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
145 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
146 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
147 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
148 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
151 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
152 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
153 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
154 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
155 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
156 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
157 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
158 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
159 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
160 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
161 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
162 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
163 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
164 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.8
Metatranscriptomes 0
Isolates 1.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.8
Nodule 0
Rhizoplane 12.45
Rhizosphere 84.34
Stem 0
Stem Tuber 0
Unclassified 1.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207686_10128430 3300025934 Bacteria 1735
2 JGI24034J26672_10000135 3300002239 Bacteria 10896
3 JGI24742J22300_10005289 3300002244 Bacteria 2121
4 Ga0070683_100040043 3300005329 Bacteria 4306
5 Ga0070683_100041215 3300005329 Bacteria 4246
6 Ga0070677_10000103 3300005333 Bacteria 27983
7 Ga0070682_100000099 3300005337 Bacteria 77574
8 Ga0068868_100086998 3300005338 Bacteria 2513
9 Ga0070691_10000330 3300005341 Bacteria 16763
10 Ga0070674_100000017 3300005356 Bacteria 90884
11 Ga0070674_100000090 3300005356 Bacteria 42115
12 Ga0070674_100518174 3300005356 Bacteria 996
13 Ga0070703_10011314 3300005406 Bacteria 2518
14 Ga0070714_100055958 3300005435 Bacteria 3373
15 Ga0070714_100616346 3300005435 Bacteria 1043
16 Ga0070711_100204237 3300005439 Bacteria 1527
17 Ga0070694_100530442 3300005444 Bacteria 940
18 Ga0070662_100000004 3300005457 Bacteria 195534
19 Ga0068867_100038374 3300005459 Bacteria 3487
20 Ga0070698_100000296 3300005471 Bacteria 50713
21 Ga0070679_100000243 3300005530 Bacteria 45435
22 Ga0070684_100003063 3300005535 Bacteria 12476
23 Ga0070684_100041448 3300005535 Bacteria 3969
24 Ga0070684_100068335 3300005535 Bacteria 3123
25 Ga0068853_100536550 3300005539 Bacteria 1107
26 Ga0070693_100001714 3300005547 Bacteria 9964
27 Ga0070665_100000138 3300005548 Bacteria 136562
28 Ga0070704_100153378 3300005549 Bacteria 1814
29 Ga0070664_100077230 3300005564 Bacteria 2863
30 Ga0068856_100014979 3300005614 Bacteria 7489
31 Ga0068864_100000053 3300005618 Bacteria 133049
32 Ga0068866_10000001 3300005718 Bacteria 519680
33 Ga0068866_10005814 3300005718 Bacteria 5117
34 Ga0068861_100104824 3300005719 Bacteria 2257
35 Ga0068863_100000342 3300005841 Bacteria 47536
36 Ga0068858_100000009 3300005842 Bacteria 237748
37 Ga0068858_100000065 3300005842 Bacteria 108233
38 Ga0068860_100007463 3300005843 Bacteria 10936
39 Ga0075363_100000912 3300006048 Bacteria 10417
40 Ga0070715_10000001 3300006163 Bacteria 693690
41 Ga0070712_100001933 3300006175 Bacteria 12678
42 Ga0075433_10000597 3300006852 Bacteria 23988
43 Ga0075429_100064363 3300006880 Unclassified 3194
44 Ga0075435_100171420 3300007076 Bacteria 1831
45 Ga0105240_10335500 3300009093 Bacteria 1719
46 Ga0111539_10732515 3300009094 Bacteria 1151
47 Ga0105245_10000020 3300009098 Bacteria 181774
48 Ga0105245_10013222 3300009098 Bacteria 7191
49 Ga0105243_10000127 3300009148 Bacteria 86196
50 Ga0105243_10275657 3300009148 Bacteria 1512
51 Ga0105242_10019161 3300009176 Bacteria 5360
52 Ga0105238_10000011 3300009551 Bacteria 261080
53 Ga0105249_10000080 3300009553 Bacteria 138080
54 Ga0157370_10004542 3300013104 Bacteria 15899
55 Ga0157374_10001066 3300013296 Bacteria 23793
56 Ga0157374_10119000 3300013296 Bacteria 2548
57 Ga0157375_10001213 3300013308 Bacteria 22205
58 Ga0157375_10036791 3300013308 Bacteria 4686
59 Ga0157375_10158692 3300013308 Bacteria 2403
60 Ga0157380_10000798 3300014326 Bacteria 19808
61 Ga0163161_10000021 3300017792 Bacteria 208779
62 Ga0207653_10058687 3300025885 Bacteria 1294
63 Ga0207682_10000005 3300025893 Bacteria 95617
64 Ga0207692_10009557 3300025898 Bacteria 4056
65 Ga0207642_10000002 3300025899 Bacteria 658166
66 Ga0207642_10000525 3300025899 Bacteria 11747
67 Ga0207685_10000005 3300025905 Bacteria 289944
68 Ga0207693_10000735 3300025915 Bacteria 29546
69 Ga0207652_10000907 3300025921 Bacteria 27991
70 Ga0207694_10000004 3300025924 Bacteria 967075
71 Ga0207687_10000013 3300025927 Bacteria 299826
72 Ga0207687_10014235 3300025927 Bacteria 5203
73 Ga0207700_10040786 3300025928 Bacteria 3391
74 Ga0207664_10121623 3300025929 Bacteria 2185
75 Ga0207664_10191963 3300025929 Bacteria 1759
76 Ga0207706_10000012 3300025933 Bacteria 195475
77 Ga0207709_10000176 3300025935 Bacteria 86175
78 Ga0207669_10000001 3300025937 Bacteria 377747
79 Ga0207669_10000096 3300025937 Bacteria 44213
80 Ga0207665_10093280 3300025939 Bacteria 2090
81 Ga0207661_10062244 3300025944 Bacteria 3018
82 Ga0207661_10155502 3300025944 Bacteria 1980
83 Ga0207661_10194831 3300025944 Bacteria 1778
84 Ga0207679_10057126 3300025945 Bacteria 2885
85 Ga0207712_10000007 3300025961 Bacteria 539589
86 Ga0207677_10000674 3300026023 Bacteria 20270
87 Ga0207703_10000018 3300026035 Bacteria 271377
88 Ga0207703_10000023 3300026035 Bacteria 222018
89 Ga0207702_10002267 3300026078 Bacteria 18444
90 Ga0207641_10000238 3300026088 Bacteria 71152
91 Ga0207648_10004426 3300026089 Bacteria 14414
92 Ga0207676_10000195 3300026095 Bacteria 52951
93 Ga0207675_100164190 3300026118 Bacteria 2120
94 Ga0207683_10162636 3300026121 Bacteria 2019
95 Ga0268266_10000047 3300028379 Bacteria 310996
96 Ga0268264_10005373 3300028381 Bacteria 10850
97 Ga0307509_10298682 3300031507 Bacteria 1360
98 Ga0373953_0022127 3300035117 Bacteria 2394
99 Ga0373954_0096096 3300035118 Bacteria 1427
100 Ga0373955_0256798 3300035172 Bacteria 1048
101 Ga0373937_0052146 3300036401 Bacteria 3750
102 Ga0395899_0000004 3300037312 Bacteria 874267
103 Ga0436364_0659506 3300037853 Bacteria 3008
104 Ga0451853_2719552 3300041512 Bacteria 1391
105 Ga0466963_0000105 3300044694 Bacteria 30285
106 Ga0466971_0121487 3300044719 Bacteria 1209
107 Ga0466960_0023447 3300044901 Bacteria 2771
108 Ga0466959_0002516 3300045049 Bacteria 11751
109 Ga0495592_0000899 3300046454 Bacteria 20622
110 Ga0495592_0101449 3300046454 Bacteria 2051
111 Ga0495592_0102068 3300046454 Bacteria 2043
112 Ga0495603_0006970 3300046455 Bacteria 6781
113 Ga0495603_0015040 3300046455 Bacteria 4678
114 Ga0495629_0043355 3300046459 Bacteria 3159
115 Ga0495629_0122724 3300046459 Bacteria 1810
116 Ga0495629_0179064 3300046459 Bacteria 1470
117 Ga0495641_0000228 3300046461 Bacteria 43671
118 Ga0495653_0034655 3300046463 Bacteria 3989
119 Ga0495653_0119109 3300046463 Bacteria 1885
120 Ga0495653_0136596 3300046463 Bacteria 1729
121 Ga0495653_0145548 3300046463 Bacteria 1661
122 Ga0495653_0247143 3300046463 Bacteria 1186
123 Ga0495582_0000726 3300046473 Bacteria 18153
124 Ga0495662_0000349 3300046476 Bacteria 20239
125 Ga0495608_0000222 3300046511 Bacteria 41114
126 Ga0495608_0049369 3300046511 Bacteria 2794
127 Ga0495608_0118695 3300046511 Bacteria 1697
128 Ga0495608_0142848 3300046511 Bacteria 1527
129 Ga0495608_0207807 3300046511 Bacteria 1232
130 Ga0495618_0000008 3300046514 Bacteria 204578
131 Ga0495618_0233108 3300046514 Bacteria 1159
132 Ga0495620_0000995 3300046515 Bacteria 17517
133 Ga0495628_0009129 3300046516 Bacteria 8480
134 Ga0495628_0036380 3300046516 Bacteria 3952
135 Ga0495628_0039581 3300046516 Bacteria 3770
136 Ga0495628_0124338 3300046516 Bacteria 1977
137 Ga0495630_0000121 3300046517 Bacteria 61852
138 Ga0495630_0210922 3300046517 Bacteria 1482
139 Ga0495644_0000630 3300046523 Bacteria 14753
140 Ga0495652_0044654 3300046529 Bacteria 3814
141 Ga0495652_0186715 3300046529 Bacteria 1586
142 Ga0495652_0202189 3300046529 Bacteria 1507
143 Ga0495640_0039945 3300046533 Bacteria 3289
144 Ga0495586_0015966 3300046535 Bacteria 3995
145 Ga0495598_0004147 3300046537 Bacteria 3121
146 Ga0495645_0007267 3300046543 Bacteria 7706
147 Ga0495645_0175653 3300046543 Bacteria 1471
148 Ga0495633_0061262 3300046558 Bacteria 1762
149 Ga0495667_0086465 3300046559 Bacteria 2033
150 Ga0495656_0001289 3300046615 Bacteria 8153
151 Ga0495634_0000059 3300046642 Bacteria 88314
152 Ga0495634_0000962 3300046642 Bacteria 27234
153 Ga0495634_0026327 3300046642 Bacteria 4060
154 Ga0495634_0075754 3300046642 Bacteria 2209
155 Ga0495634_0147889 3300046642 Bacteria 1487
156 Ga0495635_0000062 3300046663 Bacteria 65631
157 Ga0495635_0021212 3300046663 Bacteria 4528
158 Ga0495635_0079604 3300046663 Bacteria 2242
159 Ga0495635_0130226 3300046663 Bacteria 1715
160 Ga0495657_0007440 3300046675 Bacteria 8459
161 Ga0495599_0002873 3300046678 Bacteria 10033
162 Ga0495599_0087189 3300046678 Bacteria 1949
163 Ga0495646_0132874 3300046680 Bacteria 1400
164 Ga0495658_0000034 3300046683 Bacteria 69176
165 Ga0495658_0158439 3300046683 Bacteria 1395
166 Ga0495669_0000310 3300046684 Bacteria 26921
167 Ga0495613_0000124 3300046689 Bacteria 75971
168 Ga0495613_0124638 3300046689 Bacteria 1848
169 Ga0495624_0028013 3300046690 Bacteria 3684
170 Ga0495670_0100473 3300046691 Bacteria 1489
171 Ga0495649_0001983 3300046694 Bacteria 14839
172 Ga0495600_0001066 3300046809 Bacteria 14880
173 Ga0495600_0108934 3300046809 Bacteria 1804
174 Ga0495600_0199805 3300046809 Bacteria 1284
175 Ga0495604_0000055 3300047317 Bacteria 100430
176 Ga0495604_0337617 3300047317 Bacteria 1004
177 Ga0495672_0052097 3300047320 Bacteria 2406
178 Ga0495676_0020018 3300047321 Bacteria 5878
179 Ga0495680_0000550 3300047322 Bacteria 42291
180 Ga0495680_0006596 3300047322 Bacteria 10768
181 Ga0495680_0016732 3300047322 Bacteria 6288
182 Ga0495680_0020516 3300047322 Bacteria 5558
183 Ga0495680_0126760 3300047322 Bacteria 1879
184 Ga0495680_0184048 3300047322 Bacteria 1506
185 Ga0495679_052561 3300047446 Bacteria 1218
186 Ga0495685_012883 3300047447 Bacteria 2834
187 Ga0495684_0008411 3300047471 Bacteria 7993
188 Ga0495684_0162845 3300047471 Bacteria 1663
189 Ga0495593_0207491 3300047673 Bacteria 984
190 Ga0495602_0164455 3300048088 Bacteria 1729
191 Ga0495602_0430600 3300048088 Bacteria 935
192 Ga0495614_0022504 3300048089 Bacteria 2720
193 Ga0495614_0212296 3300048089 Bacteria 878
194 Ga0496100_0000002 3300048903 Bacteria 489057
195 Ga0496101_0000001 3300048904 Bacteria 489057
196 Ga0496104_0000009 3300048907 Bacteria 488055
197 Ga0496104_0294495 3300048907 Bacteria 1535
198 Ga0496105_0000007 3300048908 Bacteria 339658
199 Ga0496106_0000084 3300048909 Bacteria 74135
200 Ga0496106_0000151 3300048909 Bacteria 51430
201 Ga0496107_0000003 3300048910 Bacteria 304038
202 Ga0496108_0000001 3300048911 Bacteria 919044
203 Ga0496108_0000587 3300048911 Bacteria 28462
204 Ga0496108_0039282 3300048911 Bacteria 3945
205 Ga0496109_0000004 3300048912 Bacteria 404818
206 Ga0496109_0003107 3300048912 Bacteria 13848
207 Ga0496110_0028120 3300048913 Bacteria 4826
208 Ga0496110_0039511 3300048913 Bacteria 4109
209 Ga0496110_0410411 3300048913 Bacteria 1235
210 Ga0496110_0415161 3300048913 Bacteria 1227
211 Ga0496111_0002911 3300048914 Bacteria 10458
212 Ga0496111_0086714 3300048914 Bacteria 2291
213 Ga0496111_0142207 3300048914 Bacteria 1778
214 Ga0496112_0000006 3300048915 Bacteria 365227
215 Ga0496112_0049307 3300048915 Bacteria 4127
216 Ga0496112_0070023 3300048915 Bacteria 3466
217 Ga0496113_0035986 3300048916 Bacteria 3625
218 Ga0496113_0056089 3300048916 Bacteria 2956
219 Ga0496113_0474866 3300048916 Unclassified 1005
220 Ga0496113_0501748 3300048916 Bacteria 974
221 Ga0496113_0675152 3300048916 Bacteria 825
222 Ga0496114_0067222 3300048917 Bacteria 3006
223 Ga0496114_0335101 3300048917 Bacteria 1338
224 Ga0496115_0159697 3300048918 Bacteria 1863
225 Ga0496122_0000090 3300048925 Bacteria 205886
226 Ga0496122_0000564 3300048925 Bacteria 75907
227 Ga0496123_0008265 3300048926 Bacteria 9595
228 Ga0501042_0018304 3300049578 Bacteria 4848
229 Ga0501047_0004470 3300049581 Bacteria 13159
230 Ga0501075_0001068 3300049591 Bacteria 17616
231 Ga0501198_003291 3300049649 Bacteria 2203
232 Ga0501081_0158202 3300049743 Bacteria 1631
233 Ga0501035_0063785 3300049822 Bacteria 3276
234 nmdc:mga06r32_227675_c1 3300050510 Bacteria 1852
235 nmdc:mga0rr50_777450_c1 3300050513 Unclassified 817
236 Ga0495601_0000035 3300053077 Bacteria 92903
237 Ga0495601_0049256 3300053077 Bacteria 2656
238 Ga0495612_0001652 3300053078 Bacteria 9176
239 Ga0495612_0006638 3300053078 Bacteria 4745
240 Ga0495595_0092836 3300053084 Bacteria 1450
241 Ga0495619_0000025 3300053085 Bacteria 167905
242 Ga0495619_0000157 3300053085 Bacteria 49848
243 Ga0495619_0010051 3300053085 Bacteria 5956
244 Ga0495619_0034250 3300053085 Bacteria 3301
245 Ga0500614_000486 3300053123 Bacteria 10332
246 Ga0466962_0018252 3300061719 Bacteria 3375
247 2587679761 2585428045 Bacteria 5203023
248 2590601070 2588254255 Bacteria 5014294
249 2772607329 2772190705 Bacteria 4666226
250 Ga0207686_10128430
251 JGI24034J26672_10000135
252 JGI24742J22300_10005289
253 Ga0070683_100040043
254 Ga0070683_100041215
255 Ga0070677_10000103
256 Ga0070682_100000099
257 Ga0068868_100086998
258 Ga0070691_10000330
259 Ga0070674_100000017
260 Ga0070674_100000090
261 Ga0070674_100518174
262 Ga0070703_10011314
263 Ga0070714_100055958
264 Ga0070714_100616346
265 Ga0070711_100204237
266 Ga0070694_100530442
267 Ga0070662_100000004
268 Ga0068867_100038374
269 Ga0070698_100000296
270 Ga0070679_100000243
271 Ga0070684_100003063
272 Ga0070684_100041448
273 Ga0070684_100068335
274 Ga0068853_100536550
275 Ga0070693_100001714
276 Ga0070665_100000138
277 Ga0070704_100153378
278 Ga0070664_100077230
279 Ga0068856_100014979
280 Ga0068864_100000053
281 Ga0068866_10000001
282 Ga0068866_10005814
283 Ga0068861_100104824
284 Ga0068863_100000342
285 Ga0068858_100000009
286 Ga0068858_100000065
287 Ga0068860_100007463
288 Ga0075363_100000912
289 Ga0070715_10000001
290 Ga0070712_100001933
291 Ga0075433_10000597
292 Ga0075429_100064363
293 Ga0075435_100171420
294 Ga0105240_10335500
295 Ga0111539_10732515
296 Ga0105245_10000020
297 Ga0105245_10013222
298 Ga0105243_10000127
299 Ga0105243_10275657
300 Ga0105242_10019161
301 Ga0105238_10000011
302 Ga0105249_10000080
303 Ga0157370_10004542
304 Ga0157374_10001066
305 Ga0157374_10119000
306 Ga0157375_10001213
307 Ga0157375_10036791
308 Ga0157375_10158692
309 Ga0157380_10000798
310 Ga0163161_10000021
311 Ga0207653_10058687
312 Ga0207682_10000005
313 Ga0207692_10009557
314 Ga0207642_10000002
315 Ga0207642_10000525
316 Ga0207685_10000005
317 Ga0207693_10000735
318 Ga0207652_10000907
319 Ga0207694_10000004
320 Ga0207687_10000013
321 Ga0207687_10014235
322 Ga0207700_10040786
323 Ga0207664_10121623
324 Ga0207664_10191963
325 Ga0207706_10000012
326 Ga0207709_10000176
327 Ga0207669_10000001
328 Ga0207669_10000096
329 Ga0207665_10093280
330 Ga0207661_10062244
331 Ga0207661_10155502
332 Ga0207661_10194831
333 Ga0207679_10057126
334 Ga0207712_10000007
335 Ga0207677_10000674
336 Ga0207703_10000018
337 Ga0207703_10000023
338 Ga0207702_10002267
339 Ga0207641_10000238
340 Ga0207648_10004426
341 Ga0207676_10000195
342 Ga0207675_100164190
343 Ga0207683_10162636
344 Ga0268266_10000047
345 Ga0268264_10005373
346 Ga0307509_10298682
347 Ga0373953_0022127
348 Ga0373954_0096096
349 Ga0373955_0256798
350 Ga0373937_0052146
351 Ga0395899_0000004
352 Ga0436364_0659506
353 Ga0451853_2719552
354 Ga0466963_0000105
355 Ga0466971_0121487
356 Ga0466960_0023447
357 Ga0466959_0002516
358 Ga0495592_0000899
359 Ga0495592_0101449
360 Ga0495592_0102068
361 Ga0495603_0006970
362 Ga0495603_0015040
363 Ga0495629_0043355
364 Ga0495629_0122724
365 Ga0495629_0179064
366 Ga0495641_0000228
367 Ga0495653_0034655
368 Ga0495653_0119109
369 Ga0495653_0136596
370 Ga0495653_0145548
371 Ga0495653_0247143
372 Ga0495582_0000726
373 Ga0495662_0000349
374 Ga0495608_0000222
375 Ga0495608_0049369
376 Ga0495608_0118695
377 Ga0495608_0142848
378 Ga0495608_0207807
379 Ga0495618_0000008
380 Ga0495618_0233108
381 Ga0495620_0000995
382 Ga0495628_0009129
383 Ga0495628_0036380
384 Ga0495628_0039581
385 Ga0495628_0124338
386 Ga0495630_0000121
387 Ga0495630_0210922
388 Ga0495644_0000630
389 Ga0495652_0044654
390 Ga0495652_0186715
391 Ga0495652_0202189
392 Ga0495640_0039945
393 Ga0495586_0015966
394 Ga0495598_0004147
395 Ga0495645_0007267
396 Ga0495645_0175653
397 Ga0495633_0061262
398 Ga0495667_0086465
399 Ga0495656_0001289
400 Ga0495634_0000059
401 Ga0495634_0000962
402 Ga0495634_0026327
403 Ga0495634_0075754
404 Ga0495634_0147889
405 Ga0495635_0000062
406 Ga0495635_0021212
407 Ga0495635_0079604
408 Ga0495635_0130226
409 Ga0495657_0007440
410 Ga0495599_0002873
411 Ga0495599_0087189
412 Ga0495646_0132874
413 Ga0495658_0000034
414 Ga0495658_0158439
415 Ga0495669_0000310
416 Ga0495613_0000124
417 Ga0495613_0124638
418 Ga0495624_0028013
419 Ga0495670_0100473
420 Ga0495649_0001983
421 Ga0495600_0001066
422 Ga0495600_0108934
423 Ga0495600_0199805
424 Ga0495604_0000055
425 Ga0495604_0337617
426 Ga0495672_0052097
427 Ga0495676_0020018
428 Ga0495680_0000550
429 Ga0495680_0006596
430 Ga0495680_0016732
431 Ga0495680_0020516
432 Ga0495680_0126760
433 Ga0495680_0184048
434 Ga0495679_052561
435 Ga0495685_012883
436 Ga0495684_0008411
437 Ga0495684_0162845
438 Ga0495593_0207491
439 Ga0495602_0164455
440 Ga0495602_0430600
441 Ga0495614_0022504
442 Ga0495614_0212296
443 Ga0496100_0000002
444 Ga0496101_0000001
445 Ga0496104_0000009
446 Ga0496104_0294495
447 Ga0496105_0000007
448 Ga0496106_0000084
449 Ga0496106_0000151
450 Ga0496107_0000003
451 Ga0496108_0000001
452 Ga0496108_0000587
453 Ga0496108_0039282
454 Ga0496109_0000004
455 Ga0496109_0003107
456 Ga0496110_0028120
457 Ga0496110_0039511
458 Ga0496110_0410411
459 Ga0496110_0415161
460 Ga0496111_0002911
461 Ga0496111_0086714
462 Ga0496111_0142207
463 Ga0496112_0000006
464 Ga0496112_0049307
465 Ga0496112_0070023
466 Ga0496113_0035986
467 Ga0496113_0056089
468 Ga0496113_0474866
469 Ga0496113_0501748
470 Ga0496113_0675152
471 Ga0496114_0067222
472 Ga0496114_0335101
473 Ga0496115_0159697
474 Ga0496122_0000090
475 Ga0496122_0000564
476 Ga0496123_0008265
477 Ga0501042_0018304
478 Ga0501047_0004470
479 Ga0501075_0001068
480 Ga0501198_003291
481 Ga0501081_0158202
482 Ga0501035_0063785
483 nmdc:mga06r32_227675_c1
484 nmdc:mga0rr50_777450_c1
485 Ga0495601_0000035
486 Ga0495601_0049256
487 Ga0495612_0001652
488 Ga0495612_0006638
489 Ga0495595_0092836
490 Ga0495619_0000025
491 Ga0495619_0000157
492 Ga0495619_0010051
493 Ga0495619_0034250
494 Ga0500614_000486
495 Ga0466962_0018252
496 2587679761
497 2590601070
498 2772607329

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

47

266

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
2br6-assembly1.cif.gz_A crystal structure of quorum-quenching n-acyl homoserine lactone lactonase 0.8399 3 265
4j5h-assembly1.cif.gz_A crystal structure of b. thuringiensis aiia mutant f107w with n-decanoyl-l-homoserine bound at the active site 0.8232 3 268
3dha-assembly1.cif.gz_A an ultral high resolution structure of n-acyl homoserine lactone hydrolase with the product n-hexanoyl-l-homoserine bound at an alternative site 0.8208 3 267
5eh9-assembly1.cif.gz_A indirect contributions of mutations underlie optimization of new enzyme function 0.8198 3 267
5eht-assembly1.cif.gz_A indirect contributions of mutations underlie optimization of new enzyme function 0.8187 3 268
ID Description Score Start End Superfamily
af_P9WLD7_51_309_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9478 1 271 3.60.15.10
af_P9WLD7_51_309_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9407 1 271 3.60.15.10
5ehtA01 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8247 2 265 3.60.15.10
5ehtA01 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.7937 2 265 3.60.15.10
3eshC01 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.7809 2 263 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A507W876-F1-model_v4 MBL fold metallo-hydrolase 0.9905 2 268 GO:0016787
AF-A0A4R6RQZ9-F1-model_v4 Glyoxylase-like metal-dependent hydrolase (Beta-lactamase superfamily II) 0.9848 2 281 GO:0016787
AF-A0A1Y5GVN2-F1-model_v4 Metallo-beta-lactamase domain-containing protein 0.9774 2 270
AF-A0A6M2BRX8-F1-model_v4 MBL fold metallo-hydrolase 0.9771 1 271 GO:0016787
AF-A0A4R6RQZ9-F1-model_v4 Glyoxylase-like metal-dependent hydrolase (Beta-lactamase superfamily II) 0.9745 2 281 GO:0016787

Map