F360840

General Info

Members Datasets Scaffolds Average Seq Length
249 162 498 336

Family's Representative Sequence

Representative Sequence 3300031250|Ga0265331_10006062|Ga0265331_100060626
Length 368
Sequence MKALVTGATGFIGSAVARRLLAEGVGLRALVRPGSDRRNIAGLDVEIVEGDLGDAAALARGCQGCDALFHVAADYRLWARRPSEIYQTNVEGTRAVLKAAAEAGVGRVVYTSSVATLEPPDDGAPGDESKRARLEDIIGHYKRSKFMAEEVVRDFVDKGLAVVTVNPSAPVGPRDVKPTPTGRTILEAAAGRMPAYVETGLNIVHVDDVADGHWLAFQRGRVGETYVLGGANMTLREILTSIAELVGRAPPRVRLPYNLVLPIAHLSEAAARLTGKSPVATVEGVKLSKKMMFFSSEKARKELGYAARPPQPALEDAVRWFYDNGYLRQAPASRREQTTGGRFVRSPQRESAFPKSAERFAEKKMLDR

Samples

Sample ID Description Type Environment
1 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
33 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
82 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
83 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
84 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
85 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
86 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
87 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
88 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
89 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
90 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
91 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
92 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
93 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
94 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
95 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
96 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
97 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
98 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
99 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
100 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
101 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
102 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
103 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
104 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
105 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
106 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
107 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
108 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
109 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
110 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
111 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
112 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
113 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
114 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
115 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
116 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
117 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
118 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
119 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
120 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
121 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
134 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
135 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
136 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
137 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
138 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
139 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
140 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
141 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
142 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
143 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
144 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
145 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
146 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
147 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
149 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
150 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
151 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
152 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
153 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
154 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
155 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
156 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
157 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
158 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
159 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
160 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
161 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
162 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.61
Nodule 0
Rhizoplane 0.4
Rhizosphere 95.18
Stem 0
Stem Tuber 0
Unclassified 18.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265331_10006062 3300031250 Bacteria 7197
2 JGI24740J21852_10019442 3300001979 Bacteria 2392
3 rootH2_10194203 3300003320 Bacteria 5152
4 rootH1_10084797 3300003323 Bacteria 10811
5 rootH1_10318684 3300003323 Unclassified 2176
6 JGI25405J52794_10000046 3300003911 Bacteria 13311
7 Ga0065712_10141558 3300005290 Unclassified 1443
8 Ga0065715_10181082 3300005293 Unclassified 1475
9 Ga0070658_10159682 3300005327 Unclassified 1891
10 Ga0070670_100002892 3300005331 Bacteria 14211
11 Ga0070680_100004334 3300005336 Bacteria 10670
12 Ga0070682_100051706 3300005337 Bacteria 2569
13 Ga0070660_100199363 3300005339 Unclassified 1623
14 Ga0070671_100158967 3300005355 Unclassified 1910
15 Ga0070674_100083400 3300005356 Unclassified 2289
16 Ga0070674_100155993 3300005356 Bacteria 1728
17 Ga0070673_100051291 3300005364 Bacteria 3230
18 Ga0070673_100145207 3300005364 Bacteria 2005
19 Ga0070714_100264384 3300005435 Unclassified 1594
20 Ga0070708_100165660 3300005445 Bacteria 2062
21 Ga0070663_100077624 3300005455 Unclassified 2432
22 Ga0070681_10122675 3300005458 Bacteria 2531
23 Ga0070679_100004724 3300005530 Bacteria 12562
24 Ga0070679_100007711 3300005530 Bacteria 10076
25 Ga0070679_100027035 3300005530 Bacteria 5642
26 Ga0070697_100096953 3300005536 Unclassified 2447
27 Ga0070672_100176971 3300005543 Unclassified 1776
28 Ga0070695_100049363 3300005545 Bacteria 2694
29 Ga0070695_100117787 3300005545 Unclassified 1813
30 Ga0068855_100002715 3300005563 Bacteria 21824
31 Ga0068856_100033287 3300005614 Bacteria 5046
32 Ga0070702_100305037 3300005615 Unclassified 1103
33 Ga0068864_100142316 3300005618 Unclassified 2165
34 Ga0081455_10001389 3300005937 Bacteria 29896
35 Ga0081538_10001887 3300005981 Bacteria 21099
36 Ga0081538_10090325 3300005981 Bacteria 1586
37 Ga0075365_10002596 3300006038 Bacteria 8936
38 Ga0070712_100319980 3300006175 Unclassified 1261
39 Ga0075367_10053504 3300006178 Bacteria 2392
40 Ga0075369_10021372 3300006186 Bacteria 2659
41 Ga0097621_100287217 3300006237 Bacteria 1449
42 Ga0068871_100297437 3300006358 Unclassified 1416
43 Ga0075428_100026454 3300006844 Bacteria 6422
44 Ga0075428_100102088 3300006844 Bacteria 3127
45 Ga0075430_100097945 3300006846 Bacteria 2450
46 Ga0075430_100281309 3300006846 Bacteria 1376
47 Ga0075431_100005770 3300006847 Bacteria 12244
48 Ga0075431_100167192 3300006847 Bacteria 2260
49 Ga0075433_10018592 3300006852 Bacteria 5780
50 Ga0075434_100002390 3300006871 Bacteria 16476
51 Ga0075434_100027083 3300006871 Bacteria 5626
52 Ga0075434_100042795 3300006871 Bacteria 4491
53 Ga0075434_100129961 3300006871 Unclassified 2537
54 Ga0075434_100211672 3300006871 Unclassified 1958
55 Ga0075436_100002258 3300006914 Bacteria 13288
56 Ga0075436_100002465 3300006914 Bacteria 12738
57 Ga0075436_100102824 3300006914 Bacteria 1991
58 Ga0075435_100068756 3300007076 Bacteria 2886
59 Ga0075435_100109816 3300007076 Bacteria 2293
60 Ga0105240_10022777 3300009093 Bacteria 8298
61 Ga0111539_10048014 3300009094 Bacteria 5099
62 Ga0111539_10411960 3300009094 Bacteria 1574
63 Ga0105245_10060040 3300009098 Bacteria 3424
64 Ga0105245_10342465 3300009098 Unclassified 1479
65 Ga0114129_10033073 3300009147 Bacteria 7308
66 Ga0114129_10057238 3300009147 Bacteria 5457
67 Ga0114129_10064240 3300009147 Bacteria 5122
68 Ga0114129_10302930 3300009147 Unclassified 2129
69 Ga0114129_10412594 3300009147 Bacteria 1778
70 Ga0114129_10964570 3300009147 Bacteria 1076
71 Ga0105241_10006625 3300009174 Bacteria 8536
72 Ga0105241_10025836 3300009174 Bacteria 4366
73 Ga0157373_10103097 3300013100 Unclassified 2007
74 Ga0157369_10010901 3300013105 Bacteria 10354
75 Ga0157374_10173846 3300013296 Unclassified 2102
76 Ga0157378_10025047 3300013297 Bacteria 5256
77 Ga0163162_10044539 3300013306 Bacteria 4445
78 Ga0163162_10107320 3300013306 Unclassified 2887
79 Ga0157372_10007071 3300013307 Bacteria 11959
80 Ga0157372_10121757 3300013307 Bacteria 2997
81 Ga0157375_10205122 3300013308 Unclassified 2128
82 Ga0163163_10135029 3300014325 Bacteria 2508
83 Ga0157380_10232760 3300014326 Unclassified 1656
84 Ga0207682_10027648 3300025893 Unclassified 2260
85 Ga0207645_10003285 3300025907 Bacteria 12333
86 Ga0207654_10023661 3300025911 Bacteria 3293
87 Ga0207654_10050774 3300025911 Unclassified 2385
88 Ga0207707_10016224 3300025912 Bacteria 6498
89 Ga0207707_10052234 3300025912 Bacteria 3559
90 Ga0207695_10045907 3300025913 Bacteria 4633
91 Ga0207657_10030928 3300025919 Bacteria 4853
92 Ga0207652_10014728 3300025921 Bacteria 6338
93 Ga0207652_10018528 3300025921 Bacteria 5713
94 Ga0207652_10020151 3300025921 Bacteria 5491
95 Ga0207650_10000322 3300025925 Bacteria 46833
96 Ga0207687_10034771 3300025927 Bacteria 3424
97 Ga0207664_10158623 3300025929 Unclassified 1928
98 Ga0207644_10014119 3300025931 Bacteria 5342
99 Ga0207690_10051700 3300025932 Unclassified 2749
100 Ga0207706_10001740 3300025933 Bacteria 21407
101 Ga0207669_10144988 3300025937 Bacteria 1654
102 Ga0207691_10004167 3300025940 Bacteria 14051
103 Ga0207691_10004638 3300025940 Bacteria 13305
104 Ga0207667_10003288 3300025949 Bacteria 19942
105 Ga0207667_10006381 3300025949 Bacteria 14302
106 Ga0207651_10085345 3300025960 Unclassified 2290
107 Ga0207658_10164310 3300025986 Unclassified 1822
108 Ga0207702_10300403 3300026078 Unclassified 1523
109 Ga0207648_10141215 3300026089 Unclassified 2122
110 Ga0207683_10020405 3300026121 Bacteria 5669
111 Ga0209971_1014231 3300027682 Bacteria 1885
112 Ga0209998_10009543 3300027717 Bacteria 2015
113 Ga0209974_10002777 3300027876 Bacteria 6346
114 Ga0207428_10084523 3300027907 Bacteria 2473
115 Ga0265338_10070180 3300028800 Bacteria 3005
116 Ga0265338_10134076 3300028800 Unclassified 1950
117 Ga0265330_10004255 3300031235 Bacteria 7296
118 Ga0265340_10000024 3300031247 Bacteria 77206
119 Ga0265340_10015689 3300031247 Bacteria 3933
120 Ga0265340_10040251 3300031247 Bacteria 2303
121 Ga0265327_10021230 3300031251 Bacteria 3923
122 Ga0265327_10090416 3300031251 Bacteria 1494
123 Ga0265316_10004163 3300031344 Bacteria 14457
124 Ga0307408_100047672 3300031548 Bacteria 3070
125 Ga0265313_10002246 3300031595 Bacteria 16980
126 Ga0316575_10053230 3300031665 Bacteria 1612
127 Ga0265314_10052855 3300031711 Bacteria 2821
128 Ga0307405_10098166 3300031731 Bacteria 1957
129 Ga0307413_10187229 3300031824 Bacteria 1482
130 Ga0307413_10333975 3300031824 Bacteria 1163
131 Ga0307407_10190172 3300031903 Bacteria 1367
132 Ga0307409_100060064 3300031995 Bacteria 2962
133 Ga0307414_10102177 3300032004 Bacteria 2160
134 Ga0307411_10046125 3300032005 Bacteria 2807
135 Ga0307411_10222627 3300032005 Bacteria 1465
136 Ga0307415_100007084 3300032126 Bacteria 6105
137 Ga0373950_0000017 3300034818 Bacteria 271422
138 Ga0373945_0006740 3300035116 Bacteria 3712
139 Ga0373943_0023858 3300035170 Bacteria 2847
140 Ga0373935_0011260 3300035692 Bacteria 5372
141 Ga0373947_0011899 3300035725 Bacteria 4984
142 Ga0373947_0015080 3300035725 Bacteria 4436
143 Ga0373925_0017224 3300037068 Bacteria 5233
144 Ga0373925_0201987 3300037068 Bacteria 1581
145 Ga0395899_0029141 3300037312 Bacteria 4152
146 Ga0395900_0004975 3300037418 Bacteria 13973
147 Ga0395900_0023084 3300037418 Bacteria 6367
148 Ga0395898_0002794 3300037466 Bacteria 20029
149 Ga0395898_0075889 3300037466 Unclassified 3246
150 Ga0395905_0027999 3300037471 Bacteria 5312
151 Ga0395901_0004551 3300038443 Bacteria 13994
152 Ga0400483_034522 3300039062 Bacteria 11165
153 Ga0400483_063819 3300039062 Bacteria 2106
154 Ga0400483_195385 3300039062 Bacteria 42888
155 Ga0400483_251387 3300039062 Bacteria 12649
156 Ga0439448_0066552 3300042005 Unclassified 1196
157 Ga0451577_0271887 3300042876 Bacteria 1535
158 Ga0453683_0003137 3300044673 Bacteria 12331
159 Ga0466959_0017015 3300045049 Bacteria 5322
160 Ga0451576_0160757 3300045051 Bacteria 2344
161 Ga0451576_0200780 3300045051 Bacteria 2083
162 Ga0466958_0004281 3300045836 Bacteria 7514
163 Ga0495629_0296833 3300046459 Bacteria 1107
164 Ga0495580_0007741 3300046472 Bacteria 8611
165 Ga0495580_0104453 3300046472 Bacteria 1969
166 Ga0495582_0032888 3300046473 Bacteria 2850
167 Ga0495658_0013933 3300046683 Bacteria 4099
168 Ga0495658_0154668 3300046683 Unclassified 1411
169 Ga0496102_0360458 3300048905 Bacteria 1369
170 Ga0501033_0008561 3300049570 Bacteria 7915
171 Ga0501034_0000019 3300049571 Bacteria 282405
172 Ga0501036_0016349 3300049572 Bacteria 6199
173 Ga0501036_0032942 3300049572 Unclassified 4381
174 Ga0501037_0004421 3300049573 Bacteria 10211
175 Ga0501037_0082236 3300049573 Unclassified 2334
176 Ga0501038_0012923 3300049574 Bacteria 7617
177 Ga0501038_0030106 3300049574 Unclassified 4806
178 Ga0501039_0005757 3300049575 Bacteria 9381
179 Ga0501040_0000232 3300049576 Bacteria 32671
180 Ga0501041_0000042 3300049577 Bacteria 43628
181 Ga0501043_0000381 3300049579 Bacteria 40297
182 Ga0501046_0001352 3300049580 Bacteria 23738
183 Ga0501046_0009483 3300049580 Bacteria 8413
184 Ga0501046_0030451 3300049580 Bacteria 4380
185 Ga0501047_0000007 3300049581 Bacteria 443240
186 Ga0501047_0021854 3300049581 Bacteria 6143
187 Ga0501047_0113253 3300049581 Unclassified 2595
188 Ga0501048_0010142 3300049582 Bacteria 7045
189 Ga0501048_0048877 3300049582 Unclassified 3016
190 Ga0501067_0129629 3300049583 Bacteria 1403
191 Ga0501068_0000267 3300049584 Bacteria 25777
192 Ga0501069_0015931 3300049585 Bacteria 4031
193 Ga0501070_0006549 3300049586 Bacteria 9906
194 Ga0501070_0027903 3300049586 Bacteria 4736
195 Ga0501071_0000136 3300049587 Bacteria 29768
196 Ga0501071_0148753 3300049587 Bacteria 1746
197 Ga0501072_0000084 3300049588 Bacteria 69297
198 Ga0501072_0000529 3300049588 Bacteria 27442
199 Ga0501073_0002340 3300049589 Bacteria 14182
200 Ga0501074_0000069 3300049590 Bacteria 49518
201 Ga0501074_0058643 3300049590 Unclassified 2773
202 Ga0501075_0000390 3300049591 Bacteria 25376
203 Ga0501075_0083365 3300049591 Bacteria 2422
204 Ga0501076_0000314 3300049592 Bacteria 30142
205 Ga0501076_0402142 3300049592 Unclassified 1126
206 Ga0501076_0664792 3300049592 Bacteria 860
207 Ga0501077_0000163 3300049593 Bacteria 37629
208 Ga0501079_0000314 3300049741 Bacteria 30320
209 Ga0501079_0000556 3300049741 Bacteria 24458
210 Ga0501079_0640704 3300049741 Bacteria 837
211 Ga0501080_0004817 3300049742 Bacteria 12034
212 Ga0501080_0007061 3300049742 Bacteria 10143
213 Ga0501080_0032630 3300049742 Bacteria 4857
214 Ga0501080_0206198 3300049742 Bacteria 1803
215 Ga0501080_0240065 3300049742 Bacteria 1654
216 Ga0501081_0001135 3300049743 Bacteria 16058
217 Ga0501081_0190367 3300049743 Bacteria 1486
218 Ga0501044_0263876 3300049823 Bacteria 1660
219 Ga0501045_0006311 3300049824 Bacteria 8199
220 nmdc:mga0yw44_58971_c1 3300050492 Bacteria 2347
221 nmdc:mga05p37_3432_c1 3300050507 Bacteria 18488
222 nmdc:mga05p37_377284_c1 3300050507 Bacteria 1663
223 nmdc:mga05p37_38364_c1 3300050507 Bacteria 5876
224 nmdc:mga05p37_65820_c1 3300050507 Bacteria 4459
225 nmdc:mga09592_51100_c1 3300050508 Bacteria 3487
226 nmdc:mga0qj67_100817_c1 3300050509 Bacteria 2328
227 nmdc:mga0qj67_118013_c1 3300050509 Bacteria 2145
228 nmdc:mga0qj67_17790_c1 3300050509 Bacteria 5407
229 nmdc:mga0qj67_74525_c1 3300050509 Bacteria 2712
230 nmdc:mga06r32_132052_c1 3300050510 Bacteria 2470
231 nmdc:mga06r32_40696_c1 3300050510 Bacteria 4413
232 nmdc:mga08y16_44543_c1 3300050511 Bacteria 4649
233 nmdc:mga0n895_1514_c1 3300050512 Bacteria 17425
234 nmdc:mga0n895_467470_c1 3300050512 Unclassified 1272
235 nmdc:mga0n895_83344_c1 3300050512 Bacteria 3189
236 nmdc:mga0rr50_38251_c1 3300050513 Bacteria 3470
237 nmdc:mga0rr50_95765_c1 3300050513 Bacteria 2321
238 nmdc:mga08x19_239077_c1 3300050514 Unclassified 1251
239 nmdc:mga08x19_27015_c1 3300050514 Bacteria 3587
240 nmdc:mga08x19_50126_c1 3300050514 Bacteria 2678
241 nmdc:mga0a205_13317_c1 3300050515 Bacteria 7651
242 nmdc:mga0a205_134974_c1 3300050515 Bacteria 2368
243 nmdc:mga0a205_50370_c1 3300050515 Bacteria 4021
244 nmdc:mga0a205_98052_c1 3300050515 Bacteria 2829
245 Ga0495619_0006244 3300053085 Bacteria 7558
246 Ga0501084_0000043 3300054114 Bacteria 98202
247 Ga0501082_0000621 3300060353 Bacteria 31200
248 Ga0501082_0000697 3300060353 Bacteria 29625
249 Ga0530510_0002151 3300061734 Bacteria 13532
250 Ga0265331_10006062
251 JGI24740J21852_10019442
252 rootH2_10194203
253 rootH1_10084797
254 rootH1_10318684
255 JGI25405J52794_10000046
256 Ga0065712_10141558
257 Ga0065715_10181082
258 Ga0070658_10159682
259 Ga0070670_100002892
260 Ga0070680_100004334
261 Ga0070682_100051706
262 Ga0070660_100199363
263 Ga0070671_100158967
264 Ga0070674_100083400
265 Ga0070674_100155993
266 Ga0070673_100051291
267 Ga0070673_100145207
268 Ga0070714_100264384
269 Ga0070708_100165660
270 Ga0070663_100077624
271 Ga0070681_10122675
272 Ga0070679_100004724
273 Ga0070679_100007711
274 Ga0070679_100027035
275 Ga0070697_100096953
276 Ga0070672_100176971
277 Ga0070695_100049363
278 Ga0070695_100117787
279 Ga0068855_100002715
280 Ga0068856_100033287
281 Ga0070702_100305037
282 Ga0068864_100142316
283 Ga0081455_10001389
284 Ga0081538_10001887
285 Ga0081538_10090325
286 Ga0075365_10002596
287 Ga0070712_100319980
288 Ga0075367_10053504
289 Ga0075369_10021372
290 Ga0097621_100287217
291 Ga0068871_100297437
292 Ga0075428_100026454
293 Ga0075428_100102088
294 Ga0075430_100097945
295 Ga0075430_100281309
296 Ga0075431_100005770
297 Ga0075431_100167192
298 Ga0075433_10018592
299 Ga0075434_100002390
300 Ga0075434_100027083
301 Ga0075434_100042795
302 Ga0075434_100129961
303 Ga0075434_100211672
304 Ga0075436_100002258
305 Ga0075436_100002465
306 Ga0075436_100102824
307 Ga0075435_100068756
308 Ga0075435_100109816
309 Ga0105240_10022777
310 Ga0111539_10048014
311 Ga0111539_10411960
312 Ga0105245_10060040
313 Ga0105245_10342465
314 Ga0114129_10033073
315 Ga0114129_10057238
316 Ga0114129_10064240
317 Ga0114129_10302930
318 Ga0114129_10412594
319 Ga0114129_10964570
320 Ga0105241_10006625
321 Ga0105241_10025836
322 Ga0157373_10103097
323 Ga0157369_10010901
324 Ga0157374_10173846
325 Ga0157378_10025047
326 Ga0163162_10044539
327 Ga0163162_10107320
328 Ga0157372_10007071
329 Ga0157372_10121757
330 Ga0157375_10205122
331 Ga0163163_10135029
332 Ga0157380_10232760
333 Ga0207682_10027648
334 Ga0207645_10003285
335 Ga0207654_10023661
336 Ga0207654_10050774
337 Ga0207707_10016224
338 Ga0207707_10052234
339 Ga0207695_10045907
340 Ga0207657_10030928
341 Ga0207652_10014728
342 Ga0207652_10018528
343 Ga0207652_10020151
344 Ga0207650_10000322
345 Ga0207687_10034771
346 Ga0207664_10158623
347 Ga0207644_10014119
348 Ga0207690_10051700
349 Ga0207706_10001740
350 Ga0207669_10144988
351 Ga0207691_10004167
352 Ga0207691_10004638
353 Ga0207667_10003288
354 Ga0207667_10006381
355 Ga0207651_10085345
356 Ga0207658_10164310
357 Ga0207702_10300403
358 Ga0207648_10141215
359 Ga0207683_10020405
360 Ga0209971_1014231
361 Ga0209998_10009543
362 Ga0209974_10002777
363 Ga0207428_10084523
364 Ga0265338_10070180
365 Ga0265338_10134076
366 Ga0265330_10004255
367 Ga0265340_10000024
368 Ga0265340_10015689
369 Ga0265340_10040251
370 Ga0265327_10021230
371 Ga0265327_10090416
372 Ga0265316_10004163
373 Ga0307408_100047672
374 Ga0265313_10002246
375 Ga0316575_10053230
376 Ga0265314_10052855
377 Ga0307405_10098166
378 Ga0307413_10187229
379 Ga0307413_10333975
380 Ga0307407_10190172
381 Ga0307409_100060064
382 Ga0307414_10102177
383 Ga0307411_10046125
384 Ga0307411_10222627
385 Ga0307415_100007084
386 Ga0373950_0000017
387 Ga0373945_0006740
388 Ga0373943_0023858
389 Ga0373935_0011260
390 Ga0373947_0011899
391 Ga0373947_0015080
392 Ga0373925_0017224
393 Ga0373925_0201987
394 Ga0395899_0029141
395 Ga0395900_0004975
396 Ga0395900_0023084
397 Ga0395898_0002794
398 Ga0395898_0075889
399 Ga0395905_0027999
400 Ga0395901_0004551
401 Ga0400483_034522
402 Ga0400483_063819
403 Ga0400483_195385
404 Ga0400483_251387
405 Ga0439448_0066552
406 Ga0451577_0271887
407 Ga0453683_0003137
408 Ga0466959_0017015
409 Ga0451576_0160757
410 Ga0451576_0200780
411 Ga0466958_0004281
412 Ga0495629_0296833
413 Ga0495580_0007741
414 Ga0495580_0104453
415 Ga0495582_0032888
416 Ga0495658_0013933
417 Ga0495658_0154668
418 Ga0496102_0360458
419 Ga0501033_0008561
420 Ga0501034_0000019
421 Ga0501036_0016349
422 Ga0501036_0032942
423 Ga0501037_0004421
424 Ga0501037_0082236
425 Ga0501038_0012923
426 Ga0501038_0030106
427 Ga0501039_0005757
428 Ga0501040_0000232
429 Ga0501041_0000042
430 Ga0501043_0000381
431 Ga0501046_0001352
432 Ga0501046_0009483
433 Ga0501046_0030451
434 Ga0501047_0000007
435 Ga0501047_0021854
436 Ga0501047_0113253
437 Ga0501048_0010142
438 Ga0501048_0048877
439 Ga0501067_0129629
440 Ga0501068_0000267
441 Ga0501069_0015931
442 Ga0501070_0006549
443 Ga0501070_0027903
444 Ga0501071_0000136
445 Ga0501071_0148753
446 Ga0501072_0000084
447 Ga0501072_0000529
448 Ga0501073_0002340
449 Ga0501074_0000069
450 Ga0501074_0058643
451 Ga0501075_0000390
452 Ga0501075_0083365
453 Ga0501076_0000314
454 Ga0501076_0402142
455 Ga0501076_0664792
456 Ga0501077_0000163
457 Ga0501079_0000314
458 Ga0501079_0000556
459 Ga0501079_0640704
460 Ga0501080_0004817
461 Ga0501080_0007061
462 Ga0501080_0032630
463 Ga0501080_0206198
464 Ga0501080_0240065
465 Ga0501081_0001135
466 Ga0501081_0190367
467 Ga0501044_0263876
468 Ga0501045_0006311
469 nmdc:mga0yw44_58971_c1
470 nmdc:mga05p37_3432_c1
471 nmdc:mga05p37_377284_c1
472 nmdc:mga05p37_38364_c1
473 nmdc:mga05p37_65820_c1
474 nmdc:mga09592_51100_c1
475 nmdc:mga0qj67_100817_c1
476 nmdc:mga0qj67_118013_c1
477 nmdc:mga0qj67_17790_c1
478 nmdc:mga0qj67_74525_c1
479 nmdc:mga06r32_132052_c1
480 nmdc:mga06r32_40696_c1
481 nmdc:mga08y16_44543_c1
482 nmdc:mga0n895_1514_c1
483 nmdc:mga0n895_467470_c1
484 nmdc:mga0n895_83344_c1
485 nmdc:mga0rr50_38251_c1
486 nmdc:mga0rr50_95765_c1
487 nmdc:mga08x19_239077_c1
488 nmdc:mga08x19_27015_c1
489 nmdc:mga08x19_50126_c1
490 nmdc:mga0a205_13317_c1
491 nmdc:mga0a205_134974_c1
492 nmdc:mga0a205_50370_c1
493 nmdc:mga0a205_98052_c1
494 Ga0495619_0006244
495 Ga0501084_0000043
496 Ga0501082_0000621
497 Ga0501082_0000697
498 Ga0530510_0002151

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

3

229

0.92

PF05368

NmrA

NmrA-like family

3

122

0.92

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

4

223

0.86

PF07993

NAD_binding_4

Male sterility protein

5

211

0.84

PF13460

NAD_binding_10

NAD(P)H-binding

7

192

0.82

PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

3

121

0.8

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

4

311

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
3wj7-assembly1.cif.gz_C crystal structure of gox2253 0.9089 6 334
3wj7-assembly1.cif.gz_C crystal structure of gox2253 0.9041 6 334
2x4g-assembly1.cif.gz_A-2 crystal structure of pa4631, a nucleoside-diphosphate-sugar epimerase from pseudomonas aeruginosa 0.8806 7 334
2x4g-assembly1.cif.gz_A-2 crystal structure of pa4631, a nucleoside-diphosphate-sugar epimerase from pseudomonas aeruginosa 0.8723 7 334
3m2p-assembly3.cif.gz_D the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus 0.8598 7 328
ID Description Score Start End Superfamily
af_P96816_2_332_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9275 8 331 3.40.50.720
af_Q869N3_132_238_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9214 6 36 3.90.180.10
af_Q94HG6_1_340_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.921 8 334 3.40.50.720
af_P96816_2_332_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9061 8 331 3.40.50.720
3wj7B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9027 6 334 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2N7QN71-F1-model_v4 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase 0.982 5 330 GO:0004029
GO:0005737
GO:0016853
AF-A0A519YQ22-F1-model_v4 deleted 0.9808 5 194
AF-A0A7V3H4J9-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9797 8 333 GO:0004029
GO:0005737
AF-A0A849S643-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9741 8 201 GO:0004029
GO:0005737
AF-A0A662EJR4-F1-model_v4 NAD-dependent dehydratase 0.9722 8 333 GO:0004029
GO:0005737

Map