F360877

General Info

Members Datasets Scaffolds Average Seq Length
249 185 498 325

Family's Representative Sequence

Representative Sequence 3300032126|Ga0307415_100026125|Ga0307415_1000261252
Length 360
Sequence VSFPVTMFMSSPGTVFLSVGLATVFAMTDAIVAEALVKTYGSVRALDGIDLRVPEGTVLGLLGPNGAGKTTCVRILTTLLRPDSGRVRVRDIDVLAQPQQVREIIGLSGQNAAIDEYLTGYENLEMIGRLYHIGAKQARQRAHELLERFDLTDAANRPAKTYSGGMRRRLDLAGALVTSPPVIFLDEPTTGLDPRSRLGMWEIIAERVHSGATLLLTTQYLEEADRLCDNVMVIDHGRSIAEGTPDELKRQVGGERVEVVVAEKADLDTASGVLKEVTGEPPTVDEDTLTLSAPAAGGAKTLIDAVRRLDAAGIEMSDIGIHRATLDDVFLALTGQAVTEEPEKDEEAGSVGGRRGGTKR

Samples

Sample ID Description Type Environment
1 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
25 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
26 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
43 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
44 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
45 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
65 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
66 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
67 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
68 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
69 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
70 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
71 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
72 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
73 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
74 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
75 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
76 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
77 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
78 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
79 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
80 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
81 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
82 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
83 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
84 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
85 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
86 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
87 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
88 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
89 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
90 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
91 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
92 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
93 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
94 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
95 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
96 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
97 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
98 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
99 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
100 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
101 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
102 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
103 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
104 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
105 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
106 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
107 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
108 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
109 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
110 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
111 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
112 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
113 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
114 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
115 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
116 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
117 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
118 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
119 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
120 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
121 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
122 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
123 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
124 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
125 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
126 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
127 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
128 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
129 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
130 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
131 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
132 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
133 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
134 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
135 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
136 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
137 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
138 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
139 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
140 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
141 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
156 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
157 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
158 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
159 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
160 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
161 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
162 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
163 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
164 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
165 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
166 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
167 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
169 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
170 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
171 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
172 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
173 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
174 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
175 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
176 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
177 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
178 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
179 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
180 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
181 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
182 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
183 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
184 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
185 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.19
Metatranscriptomes 0.8
Isolates 2.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.2
Nodule 0
Rhizoplane 3.61
Rhizosphere 91.97
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307415_100026125 3300032126 Bacteria 3678
2 JGI25406J46586_10023065 3300003203 Bacteria 2466
3 Ga0070658_10000387 3300005327 Bacteria 38330
4 Ga0070683_100011351 3300005329 Bacteria 7696
5 Ga0070683_100069989 3300005329 Bacteria 3272
6 Ga0070670_100025812 3300005331 Bacteria 5056
7 Ga0070680_100008398 3300005336 Bacteria 7907
8 Ga0068868_100211637 3300005338 Bacteria 1620
9 Ga0070668_100020569 3300005347 Bacteria 4982
10 Ga0070668_100047126 3300005347 Bacteria 3313
11 Ga0070675_100011843 3300005354 Bacteria 6832
12 Ga0070659_100132562 3300005366 Bacteria 2025
13 Ga0070709_10138383 3300005434 Bacteria 1670
14 Ga0070714_100000012 3300005435 Bacteria 226258
15 Ga0070714_100003434 3300005435 Bacteria 11803
16 Ga0070710_10032992 3300005437 Bacteria 2809
17 Ga0070663_100005664 3300005455 Bacteria 7443
18 Ga0070662_100004579 3300005457 Bacteria 8755
19 Ga0070681_10008190 3300005458 Bacteria 10231
20 Ga0070707_100002639 3300005468 Bacteria 17058
21 Ga0070679_100002689 3300005530 Bacteria 16194
22 Ga0070684_100007006 3300005535 Bacteria 8758
23 Ga0070684_100194254 3300005535 Bacteria 1848
24 Ga0070672_100082828 3300005543 Bacteria 2574
25 Ga0070665_100006041 3300005548 Bacteria 12373
26 Ga0070665_100079495 3300005548 Bacteria 3285
27 Ga0070664_100010653 3300005564 Bacteria 7450
28 Ga0068859_100243453 3300005617 Bacteria 1888
29 Ga0068862_100025969 3300005844 Bacteria 4921
30 Ga0081538_10006344 3300005981 Bacteria 10436
31 Ga0081538_10010788 3300005981 Bacteria 7466
32 Ga0081540_1011595 3300005983 Bacteria 5883
33 Ga0081540_1027339 3300005983 Bacteria 3235
34 Ga0081539_10000381 3300005985 Bacteria 96399
35 Ga0081539_10000989 3300005985 Bacteria 52873
36 Ga0081539_10001469 3300005985 Bacteria 39964
37 Ga0081539_10003015 3300005985 Bacteria 21894
38 Ga0081539_10029467 3300005985 Bacteria 3427
39 Ga0070717_10047529 3300006028 Bacteria 3517
40 Ga0070717_10097282 3300006028 Bacteria 2494
41 Ga0070712_100024169 3300006175 Bacteria 4023
42 Ga0075431_100487621 3300006847 Bacteria 1225
43 Ga0075434_100018042 3300006871 Bacteria 6809
44 Ga0097620_100243448 3300006931 Bacteria 1888
45 Ga0111539_10007578 3300009094 Bacteria 13872
46 Ga0105245_10005393 3300009098 Bacteria 11239
47 Ga0114129_10000903 3300009147 Bacteria 38604
48 Ga0105248_10035545 3300009177 Bacteria 5574
49 Ga0105249_10009571 3300009553 Bacteria 8492
50 Ga0157378_10457229 3300013297 Bacteria 1268
51 Ga0163162_10028524 3300013306 Bacteria 5524
52 Ga0157372_10436461 3300013307 Bacteria 1526
53 Ga0157375_10073996 3300013308 Bacteria 3427
54 Ga0157377_10058195 3300014745 Bacteria 2200
55 Ga0157379_10082082 3300014968 Bacteria 2888
56 Ga0157379_10305569 3300014968 Bacteria 1450
57 Ga0157376_10063665 3300014969 Bacteria 3108
58 Ga0206354_10055929 3300020081 Bacteria 5758
59 Ga0206353_10617730 3300020082 Bacteria 25573
60 Ga0207692_10015242 3300025898 Bacteria 3378
61 Ga0207699_10151543 3300025906 Bacteria 1535
62 Ga0207705_10003007 3300025909 Bacteria 12865
63 Ga0207707_10003033 3300025912 Bacteria 14929
64 Ga0207707_10127686 3300025912 Bacteria 2224
65 Ga0207693_10032854 3300025915 Bacteria 4095
66 Ga0207663_10000440 3300025916 Bacteria 18042
67 Ga0207663_10196204 3300025916 Bacteria 1453
68 Ga0207660_10005146 3300025917 Bacteria 8505
69 Ga0207652_10001367 3300025921 Bacteria 21685
70 Ga0207646_10012870 3300025922 Bacteria 8019
71 Ga0207687_10068975 3300025927 Bacteria 2520
72 Ga0207664_10000003 3300025929 Bacteria 510966
73 Ga0207664_10011317 3300025929 Bacteria 6331
74 Ga0207664_10125764 3300025929 Bacteria 2152
75 Ga0207706_10004676 3300025933 Bacteria 12831
76 Ga0207691_10098503 3300025940 Bacteria 2611
77 Ga0207679_10034393 3300025945 Bacteria 3575
78 Ga0207668_10042942 3300025972 Bacteria 3065
79 Ga0207678_10012913 3300026067 Bacteria 7331
80 Ga0207676_10047835 3300026095 Bacteria 3317
81 Ga0207428_10026804 3300027907 Bacteria 4803
82 Ga0307515_10196277 3300028794 Bacteria 1909
83 Ga0265338_10002541 3300028800 Bacteria 27050
84 Ga0316182_1087561 3300030745 Bacteria 10056
85 Ga0307513_10002200 3300031456 Bacteria 27236
86 Ga0316576_10019838 3300031727 Bacteria 4612
87 Ga0316576_10031311 3300031727 Bacteria 3773
88 Ga0316576_10199910 3300031727 Bacteria 1506
89 Ga0316578_10001556 3300031728 Bacteria 9438
90 Ga0316577_10021171 3300031733 Bacteria 3607
91 Ga0307406_10070764 3300031901 Bacteria 2285
92 Ga0307416_100019173 3300032002 Bacteria 4843
93 Ga0307416_100048640 3300032002 Bacteria 3366
94 Ga0307416_100140834 3300032002 Bacteria 2192
95 Ga0307415_100020938 3300032126 Bacteria 4006
96 Ga0307415_100047726 3300032126 Bacteria 2884
97 Ga0307415_100077764 3300032126 Bacteria 2357
98 Ga0307415_100475944 3300032126 Bacteria 1086
99 Ga0373934_0017950 3300035086 Bacteria 2704
100 Ga0373923_0023015 3300035111 Bacteria 2447
101 Ga0373936_0023629 3300035113 Bacteria 2396
102 Ga0373953_0010111 3300035117 Bacteria 3271
103 Ga0373954_0050346 3300035118 Bacteria 1954
104 Ga0373956_0006737 3300035119 Bacteria 4606
105 Ga0373957_0003921 3300035120 Bacteria 4469
106 Ga0373943_0164472 3300035170 Bacteria 1210
107 Ga0373924_0011997 3300035410 Bacteria 3228
108 Ga0373935_0009705 3300035692 Bacteria 5762
109 Ga0373933_0088533 3300035724 Bacteria 1907
110 Ga0373937_0000310 3300036401 Bacteria 46040
111 Ga0373937_0017529 3300036401 Bacteria 6383
112 Ga0316582_0011722 3300036647 Bacteria 4860
113 Ga0316584_0016400 3300036712 Bacteria 5310
114 Ga0373925_0035601 3300037068 Bacteria 3674
115 Ga0395900_0078628 3300037418 Bacteria 3389
116 Ga0395898_0141964 3300037466 Bacteria 2299
117 Ga0395898_0247035 3300037466 Bacteria 1702
118 Ga0395901_0050332 3300038443 Bacteria 4329
119 Ga0400485_04221 3300038735 Bacteria 54088
120 Ga0400486_29215 3300038742 Bacteria 140932
121 Ga0400489_42093 3300039093 Bacteria 1526
122 Ga0439455_0024240 3300042012 Bacteria 1467
123 Ga0466966_0081595 3300044684 Bacteria 2013
124 Ga0466961_0017630 3300044693 Bacteria 4587
125 Ga0466961_0147523 3300044693 Bacteria 1470
126 Ga0466958_0077440 3300045836 Bacteria 2042
127 Ga0495592_0000065 3300046454 Bacteria 95955
128 Ga0495592_0168083 3300046454 Bacteria 1503
129 Ga0495629_0284750 3300046459 Bacteria 1133
130 Ga0495641_0037270 3300046461 Bacteria 2280
131 Ga0495641_0053007 3300046461 Bacteria 1847
132 Ga0495651_0000001 3300046462 Bacteria 210544
133 Ga0495651_0033414 3300046462 Bacteria 4012
134 Ga0495653_0001056 3300046463 Bacteria 21204
135 Ga0495653_0108007 3300046463 Bacteria 2004
136 Ga0495582_0040788 3300046473 Bacteria 2557
137 Ga0495639_0022025 3300046475 Bacteria 2793
138 Ga0495662_0009836 3300046476 Bacteria 4698
139 Ga0495664_0034650 3300046477 Bacteria 2970
140 Ga0495608_0016574 3300046511 Bacteria 5100
141 Ga0495618_0009239 3300046514 Bacteria 5951
142 Ga0495618_0081641 3300046514 Bacteria 2064
143 Ga0495628_0000172 3300046516 Bacteria 56702
144 Ga0495628_0066019 3300046516 Bacteria 2828
145 Ga0495630_0089484 3300046517 Bacteria 2325
146 Ga0495652_0000015 3300046529 Bacteria 222624
147 Ga0495652_0092011 3300046529 Bacteria 2478
148 Ga0495665_0039224 3300046531 Bacteria 2523
149 Ga0495665_0091738 3300046531 Bacteria 1596
150 Ga0495586_0059383 3300046535 Bacteria 2078
151 Ga0495587_0000036 3300046536 Bacteria 117570
152 Ga0495587_0068839 3300046536 Bacteria 2061
153 Ga0495645_0000036 3300046543 Bacteria 100735
154 Ga0495667_0076487 3300046559 Bacteria 2177
155 Ga0495634_0013053 3300046642 Bacteria 6008
156 Ga0495657_0008473 3300046675 Bacteria 7864
157 Ga0495657_0029502 3300046675 Bacteria 3846
158 Ga0495599_0025794 3300046678 Bacteria 3681
159 Ga0495623_0000011 3300046679 Bacteria 120974
160 Ga0495646_0010892 3300046680 Bacteria 5776
161 Ga0495646_0016274 3300046680 Bacteria 4720
162 Ga0495613_0095734 3300046689 Bacteria 2147
163 Ga0495624_0030399 3300046690 Bacteria 3519
164 Ga0495600_0161440 3300046809 Bacteria 1448
165 Ga0495581_0028542 3300047315 Bacteria 3234
166 Ga0495604_0000004 3300047317 Bacteria 456385
167 Ga0495676_0223543 3300047321 Bacteria 1296
168 Ga0495680_0079266 3300047322 Bacteria 2483
169 Ga0495675_0000018 3300047444 Bacteria 115435
170 Ga0495675_0029099 3300047444 Bacteria 3521
171 Ga0495593_0022232 3300047673 Bacteria 3537
172 Ga0495602_0000207 3300048088 Bacteria 54864
173 Ga0495602_0105372 3300048088 Bacteria 2304
174 Ga0496101_0217436 3300048904 Bacteria 1482
175 Ga0496102_0000324 3300048905 Bacteria 59699
176 Ga0496103_0144585 3300048906 Bacteria 1522
177 Ga0496104_0118600 3300048907 Bacteria 2541
178 Ga0496109_0150252 3300048912 Bacteria 2181
179 Ga0496109_0319256 3300048912 Bacteria 1466
180 Ga0496109_0325965 3300048912 Bacteria 1450
181 Ga0496110_0036590 3300048913 Bacteria 4263
182 Ga0496115_0130853 3300048918 Bacteria 2068
183 Ga0496126_0070501 3300048929 Bacteria 3114
184 Ga0501031_0001089 3300049568 Bacteria 16526
185 Ga0501032_0024432 3300049569 Bacteria 4173
186 Ga0501033_0039305 3300049570 Bacteria 3534
187 Ga0501036_0000766 3300049572 Bacteria 23850
188 Ga0501037_0044888 3300049573 Bacteria 3245
189 Ga0501038_0002249 3300049574 Bacteria 17937
190 Ga0501038_0201806 3300049574 Bacteria 1596
191 Ga0501039_0001541 3300049575 Bacteria 16941
192 Ga0501040_0001686 3300049576 Bacteria 14148
193 Ga0501041_0031390 3300049577 Bacteria 3209
194 Ga0501042_0000385 3300049578 Bacteria 22431
195 Ga0501042_0110604 3300049578 Bacteria 1978
196 Ga0501043_0023869 3300049579 Bacteria 4797
197 Ga0501046_0005806 3300049580 Bacteria 11012
198 Ga0501047_0087033 3300049581 Bacteria 3002
199 Ga0501047_0147315 3300049581 Bacteria 2230
200 Ga0501048_0002708 3300049582 Bacteria 13518
201 Ga0501068_0115936 3300049584 Bacteria 1668
202 Ga0501069_0000122 3300049585 Bacteria 34479
203 Ga0501069_0023425 3300049585 Bacteria 3367
204 Ga0501070_0012785 3300049586 Bacteria 7075
205 Ga0501070_0107660 3300049586 Bacteria 2304
206 Ga0501070_0302099 3300049586 Bacteria 1304
207 Ga0501072_0001055 3300049588 Bacteria 20413
208 Ga0501072_0046867 3300049588 Bacteria 3403
209 Ga0501072_0216534 3300049588 Bacteria 1526
210 Ga0501073_0188680 3300049589 Bacteria 1426
211 Ga0501074_0000284 3300049590 Bacteria 29197
212 Ga0501075_0021309 3300049591 Bacteria 4723
213 Ga0501075_0072174 3300049591 Bacteria 2609
214 Ga0501076_0285351 3300049592 Bacteria 1352
215 Ga0501077_0001511 3300049593 Bacteria 14034
216 Ga0501077_0031372 3300049593 Bacteria 3381
217 Ga0501079_0017723 3300049741 Bacteria 5441
218 Ga0501079_0075324 3300049741 Bacteria 2609
219 Ga0501080_0002626 3300049742 Bacteria 15735
220 Ga0501080_0002858 3300049742 Bacteria 15181
221 Ga0501080_0305620 3300049742 Bacteria 1442
222 Ga0501083_0034856 3300049744 Bacteria 3440
223 Ga0501035_0020703 3300049822 Bacteria 6045
224 Ga0501035_0136394 3300049822 Bacteria 2136
225 Ga0501045_0017832 3300049824 Bacteria 5042
226 Ga0501045_0063543 3300049824 Bacteria 2709
227 nmdc:mga00v17_253897_c1 3300050491 Bacteria 1140
228 nmdc:mga06z11_76342_c1 3300050494 Bacteria 1786
229 nmdc:mga05p37_3694_c1 3300050507 Bacteria 17901
230 nmdc:mga08y16_23550_c1 3300050511 Bacteria 6505
231 Ga0495601_0000130 3300053077 Bacteria 42801
232 Ga0495601_0005807 3300053077 Bacteria 7195
233 Ga0495601_0056651 3300053077 Bacteria 2482
234 Ga0495612_0033506 3300053078 Bacteria 2078
235 Ga0495595_0004392 3300053084 Bacteria 5674
236 Ga0495619_0001651 3300053085 Bacteria 14725
237 Ga0495619_0087838 3300053085 Bacteria 2102
238 Ga0500616_0002005 3300053153 Bacteria 18030
239 Ga0501084_0014236 3300054114 Bacteria 6587
240 Ga0501084_0017658 3300054114 Bacteria 5935
241 Ga0501084_0066907 3300054114 Bacteria 3007
242 Ga0501082_0003935 3300060353 Bacteria 12960
243 Ga0501082_0038354 3300060353 Bacteria 4133
244 Ga0530510_0001527 3300061734 Bacteria 15590
245 2827632758 2827628540 Bacteria 6858585
246 2891396598 2891395885 Bacteria 9251614
247 2891555766 2891554331 Bacteria 8812224
248 8048133553 8048127548 Bacteria 11053136
249 8053953295 8053945823 Bacteria 8962862
250 Ga0307415_100026125
251 JGI25406J46586_10023065
252 Ga0070658_10000387
253 Ga0070683_100011351
254 Ga0070683_100069989
255 Ga0070670_100025812
256 Ga0070680_100008398
257 Ga0068868_100211637
258 Ga0070668_100020569
259 Ga0070668_100047126
260 Ga0070675_100011843
261 Ga0070659_100132562
262 Ga0070709_10138383
263 Ga0070714_100000012
264 Ga0070714_100003434
265 Ga0070710_10032992
266 Ga0070663_100005664
267 Ga0070662_100004579
268 Ga0070681_10008190
269 Ga0070707_100002639
270 Ga0070679_100002689
271 Ga0070684_100007006
272 Ga0070684_100194254
273 Ga0070672_100082828
274 Ga0070665_100006041
275 Ga0070665_100079495
276 Ga0070664_100010653
277 Ga0068859_100243453
278 Ga0068862_100025969
279 Ga0081538_10006344
280 Ga0081538_10010788
281 Ga0081540_1011595
282 Ga0081540_1027339
283 Ga0081539_10000381
284 Ga0081539_10000989
285 Ga0081539_10001469
286 Ga0081539_10003015
287 Ga0081539_10029467
288 Ga0070717_10047529
289 Ga0070717_10097282
290 Ga0070712_100024169
291 Ga0075431_100487621
292 Ga0075434_100018042
293 Ga0097620_100243448
294 Ga0111539_10007578
295 Ga0105245_10005393
296 Ga0114129_10000903
297 Ga0105248_10035545
298 Ga0105249_10009571
299 Ga0157378_10457229
300 Ga0163162_10028524
301 Ga0157372_10436461
302 Ga0157375_10073996
303 Ga0157377_10058195
304 Ga0157379_10082082
305 Ga0157379_10305569
306 Ga0157376_10063665
307 Ga0206354_10055929
308 Ga0206353_10617730
309 Ga0207692_10015242
310 Ga0207699_10151543
311 Ga0207705_10003007
312 Ga0207707_10003033
313 Ga0207707_10127686
314 Ga0207693_10032854
315 Ga0207663_10000440
316 Ga0207663_10196204
317 Ga0207660_10005146
318 Ga0207652_10001367
319 Ga0207646_10012870
320 Ga0207687_10068975
321 Ga0207664_10000003
322 Ga0207664_10011317
323 Ga0207664_10125764
324 Ga0207706_10004676
325 Ga0207691_10098503
326 Ga0207679_10034393
327 Ga0207668_10042942
328 Ga0207678_10012913
329 Ga0207676_10047835
330 Ga0207428_10026804
331 Ga0307515_10196277
332 Ga0265338_10002541
333 Ga0316182_1087561
334 Ga0307513_10002200
335 Ga0316576_10019838
336 Ga0316576_10031311
337 Ga0316576_10199910
338 Ga0316578_10001556
339 Ga0316577_10021171
340 Ga0307406_10070764
341 Ga0307416_100019173
342 Ga0307416_100048640
343 Ga0307416_100140834
344 Ga0307415_100020938
345 Ga0307415_100047726
346 Ga0307415_100077764
347 Ga0307415_100475944
348 Ga0373934_0017950
349 Ga0373923_0023015
350 Ga0373936_0023629
351 Ga0373953_0010111
352 Ga0373954_0050346
353 Ga0373956_0006737
354 Ga0373957_0003921
355 Ga0373943_0164472
356 Ga0373924_0011997
357 Ga0373935_0009705
358 Ga0373933_0088533
359 Ga0373937_0000310
360 Ga0373937_0017529
361 Ga0316582_0011722
362 Ga0316584_0016400
363 Ga0373925_0035601
364 Ga0395900_0078628
365 Ga0395898_0141964
366 Ga0395898_0247035
367 Ga0395901_0050332
368 Ga0400485_04221
369 Ga0400486_29215
370 Ga0400489_42093
371 Ga0439455_0024240
372 Ga0466966_0081595
373 Ga0466961_0017630
374 Ga0466961_0147523
375 Ga0466958_0077440
376 Ga0495592_0000065
377 Ga0495592_0168083
378 Ga0495629_0284750
379 Ga0495641_0037270
380 Ga0495641_0053007
381 Ga0495651_0000001
382 Ga0495651_0033414
383 Ga0495653_0001056
384 Ga0495653_0108007
385 Ga0495582_0040788
386 Ga0495639_0022025
387 Ga0495662_0009836
388 Ga0495664_0034650
389 Ga0495608_0016574
390 Ga0495618_0009239
391 Ga0495618_0081641
392 Ga0495628_0000172
393 Ga0495628_0066019
394 Ga0495630_0089484
395 Ga0495652_0000015
396 Ga0495652_0092011
397 Ga0495665_0039224
398 Ga0495665_0091738
399 Ga0495586_0059383
400 Ga0495587_0000036
401 Ga0495587_0068839
402 Ga0495645_0000036
403 Ga0495667_0076487
404 Ga0495634_0013053
405 Ga0495657_0008473
406 Ga0495657_0029502
407 Ga0495599_0025794
408 Ga0495623_0000011
409 Ga0495646_0010892
410 Ga0495646_0016274
411 Ga0495613_0095734
412 Ga0495624_0030399
413 Ga0495600_0161440
414 Ga0495581_0028542
415 Ga0495604_0000004
416 Ga0495676_0223543
417 Ga0495680_0079266
418 Ga0495675_0000018
419 Ga0495675_0029099
420 Ga0495593_0022232
421 Ga0495602_0000207
422 Ga0495602_0105372
423 Ga0496101_0217436
424 Ga0496102_0000324
425 Ga0496103_0144585
426 Ga0496104_0118600
427 Ga0496109_0150252
428 Ga0496109_0319256
429 Ga0496109_0325965
430 Ga0496110_0036590
431 Ga0496115_0130853
432 Ga0496126_0070501
433 Ga0501031_0001089
434 Ga0501032_0024432
435 Ga0501033_0039305
436 Ga0501036_0000766
437 Ga0501037_0044888
438 Ga0501038_0002249
439 Ga0501038_0201806
440 Ga0501039_0001541
441 Ga0501040_0001686
442 Ga0501041_0031390
443 Ga0501042_0000385
444 Ga0501042_0110604
445 Ga0501043_0023869
446 Ga0501046_0005806
447 Ga0501047_0087033
448 Ga0501047_0147315
449 Ga0501048_0002708
450 Ga0501068_0115936
451 Ga0501069_0000122
452 Ga0501069_0023425
453 Ga0501070_0012785
454 Ga0501070_0107660
455 Ga0501070_0302099
456 Ga0501072_0001055
457 Ga0501072_0046867
458 Ga0501072_0216534
459 Ga0501073_0188680
460 Ga0501074_0000284
461 Ga0501075_0021309
462 Ga0501075_0072174
463 Ga0501076_0285351
464 Ga0501077_0001511
465 Ga0501077_0031372
466 Ga0501079_0017723
467 Ga0501079_0075324
468 Ga0501080_0002626
469 Ga0501080_0002858
470 Ga0501080_0305620
471 Ga0501083_0034856
472 Ga0501035_0020703
473 Ga0501035_0136394
474 Ga0501045_0017832
475 Ga0501045_0063543
476 nmdc:mga00v17_253897_c1
477 nmdc:mga06z11_76342_c1
478 nmdc:mga05p37_3694_c1
479 nmdc:mga08y16_23550_c1
480 Ga0495601_0000130
481 Ga0495601_0005807
482 Ga0495601_0056651
483 Ga0495612_0033506
484 Ga0495595_0004392
485 Ga0495619_0001651
486 Ga0495619_0087838
487 Ga0500616_0002005
488 Ga0501084_0014236
489 Ga0501084_0017658
490 Ga0501084_0066907
491 Ga0501082_0003935
492 Ga0501082_0038354
493 Ga0530510_0001527
494 2827632758
495 2891396598
496 2891555766
497 8048133553
498 8053953295

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

46

190

0.98

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

80

223

0.86

PF13732

DUF4162

Domain of unknown function (DUF4162)

243

334

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
8eop-assembly1.cif.gz_A cryo-em structure of nanodisc reconstituted human abca7 eq mutant in atp bound closed state 0.9452 17 239
4p33-assembly1.cif.gz_A crystal structure of e. coli lptb-e163q in complex with atp-sodium 0.9406 19 238
6xgz-assembly4.cif.gz_G crystal structure of e. coli mlafb abc transport subunits in the monomeric state 0.9342 17 237
7ahd-assembly1.cif.gz_D opua (e190q) occluded 0.934 18 236
7z16-assembly1.cif.gz_J e. coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation 0.933 16 237
ID Description Score Start End Superfamily
af_Q0E8Q7_1247_1483_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9726 17 239 3.40.50.300
af_P0A9U1_321_563_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9709 16 240 3.40.50.300
af_O33189_10_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.967 14 241 3.40.50.300
af_P78363_1926_2175_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9665 15 239 3.40.50.300
af_A0A0R0KIK5_1390_1640_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9655 17 241 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A3D5HYS6-F1-model_v4 Lysozyme 0.9737 15 103 GO:0005524
GO:0016887
AF-A0A7C6CAI4-F1-model_v4 ABC transporter ATP-binding protein 0.9635 16 239 GO:0005524
GO:0016887
AF-A0A4Q3AX05-F1-model_v4 ATP-binding cassette domain-containing protein 0.963 15 226 GO:0005524
GO:0016887
AF-A0A1I2M2I1-F1-model_v4 ABC-2 type transport system ATP-binding protein/oleandomycin transport system ATP-binding protein 0.962 16 232 GO:0005524
GO:0016887
AF-A0A1Q7QZQ6-F1-model_v4 ABC transporter domain-containing protein 0.9608 16 242 GO:0005524
GO:0016887

Map