F360972

General Info

Members Datasets Scaffolds Average Seq Length
249 193 498 333

Family's Representative Sequence

Representative Sequence 3300045049|Ga0466959_0260366|Ga0466959_0260366_56_1180
Length 374
Sequence MASARNDLLTAATARILDKCPLGSHIFQPTREENRMRKDHNLPEGTVHSLWIESDCLKGNLLGDPSRRRIDVYVPADHDGRGLPLLVDLVGYTSGGPGHTNWKNYGENVPERLDRLIGTGAMPPVVVVFPDCFTRLGGNQYLDSAAMGPWETFLTGEMLPFVEERFGCGGAGRRGVFGKSSGGYGSLIHALRHGGSVWSAAASHSGDAGFEYLYHLGEFANALRHLSEHGMSIEAFLRKFEEGPKAKDKDWHTLMILAQAASFDPDPSVFCGIRLPVDVETCELIEERWANWLRWDPLRMADNALCQENLRKLKAFYFDCGDIDQYNIVYGSRLLHRKLEAAGVPHTYEEFHDNHSSVDYRMDVSLPLLAKALS

Samples

Sample ID Description Type Environment
1 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
33 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
58 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
59 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
60 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
61 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
62 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
63 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
90 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
92 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
93 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
94 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
95 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
96 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
97 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
98 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
99 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
100 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
101 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
102 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
103 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
104 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
105 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
106 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
107 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
108 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
109 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
110 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
111 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
112 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
113 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
114 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
116 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
117 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
118 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
119 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
120 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
121 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
122 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
123 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
124 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
125 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
126 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
127 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
128 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
129 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
130 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
131 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
132 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
133 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
134 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
135 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
136 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
137 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
138 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
139 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
140 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
141 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
142 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
143 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
144 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
145 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
146 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
147 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
148 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
149 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
150 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
156 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
157 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
158 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
159 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
160 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
161 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
162 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
163 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
164 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
167 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
168 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
169 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
170 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
171 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
172 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
173 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
174 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
175 2508501050 Microvirga lupini Lut6 Isolate Nodule
176 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
177 2643221591 Devosia sp. Root685 Isolate Unclassified
178 2643221618 Ensifer sp. Root231 Isolate Unclassified
179 2643221626 Ensifer sp. Root31 Isolate Unclassified
180 2643221655 Ensifer sp. Root1252 Isolate Unclassified
181 2643221659 Ensifer sp. Root127 Isolate Unclassified
182 2643221698 Ensifer sp. Root142 Isolate Unclassified
183 2643221712 Ensifer sp. Root258 Isolate Unclassified
184 2773857925 Microvirga vignae BR3299 Isolate Unclassified
185 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
186 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
187 2844163670 Ensifer sp. 1H6 Isolate Unclassified
188 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
189 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
190 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
191 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
192 2932401849 Devosia sp. 2618 Isolate Rhizosphere
193 2941499720 Ensifer sp. 4252 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.37
Metatranscriptomes 0
Isolates 7.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.21
Nodule 1.61
Rhizoplane 0.8
Rhizosphere 85.94
Stem 0
Stem Tuber 0
Unclassified 2.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466959_0260366 3300045049 Bacteria 1194
2 JGI25151J46595_10001179 3300003187 Bacteria 18799
3 rootL2_10009133 3300003322 Bacteria 1331
4 JGI25160J50197_1003424 3300003354 Bacteria 7107
5 Ga0065165_1037613 3300005262 Bacteria 1466
6 Ga0065707_10103182 3300005295 Bacteria 2762
7 Ga0070666_10003051 3300005335 Bacteria 10169
8 Ga0070680_100000080 3300005336 Bacteria 52683
9 Ga0070691_10000167 3300005341 Bacteria 21441
10 Ga0070661_100000043 3300005344 Bacteria 98908
11 Ga0070668_100323640 3300005347 Bacteria 1299
12 Ga0070667_100100848 3300005367 Bacteria 2493
13 Ga0070703_10029301 3300005406 Bacteria 1651
14 Ga0070709_10018500 3300005434 Bacteria 4013
15 Ga0070714_100064606 3300005435 Bacteria 3151
16 Ga0070713_100000001 3300005436 Bacteria 257984
17 Ga0070681_10000002 3300005458 Bacteria 821814
18 Ga0070698_100042752 3300005471 Bacteria 4648
19 Ga0070679_100033058 3300005530 Bacteria 5119
20 Ga0068853_100001702 3300005539 Bacteria 16115
21 Ga0068853_100028779 3300005539 Bacteria 4676
22 Ga0070693_100138823 3300005547 Bacteria 1528
23 Ga0068855_100001071 3300005563 Bacteria 33976
24 Ga0070664_100046745 3300005564 Bacteria 3657
25 Ga0068857_100000460 3300005577 Bacteria 28997
26 Ga0068856_100000945 3300005614 Bacteria 31113
27 Ga0068856_100125710 3300005614 Bacteria 2567
28 Ga0068852_100046179 3300005616 Bacteria 3710
29 Ga0068852_100059077 3300005616 Bacteria 3325
30 Ga0068852_100061525 3300005616 Bacteria 3263
31 Ga0068866_10009726 3300005718 Bacteria 4094
32 Ga0068861_100114593 3300005719 Bacteria 2165
33 Ga0068858_100016810 3300005842 Bacteria 6871
34 Ga0068860_100212202 3300005843 Bacteria 1878
35 Ga0068862_100105649 3300005844 Bacteria 2468
36 Ga0081538_10014917 3300005981 Bacteria 6051
37 Ga0081540_1031256 3300005983 Bacteria 2932
38 Ga0070712_100000051 3300006175 Bacteria 62931
39 Ga0070712_100000572 3300006175 Bacteria 21422
40 Ga0097621_100028771 3300006237 Bacteria 4383
41 Ga0068871_100284988 3300006358 Bacteria 1446
42 Ga0075436_100000024 3300006914 Bacteria 115057
43 Ga0075436_100121646 3300006914 Bacteria 1827
44 Ga0105240_10005616 3300009093 Bacteria 18619
45 Ga0105240_10010593 3300009093 Bacteria 12955
46 Ga0105240_10025095 3300009093 Bacteria 7843
47 Ga0105240_10102493 3300009093 Bacteria 3478
48 Ga0111539_10000273 3300009094 Bacteria 61676
49 Ga0105247_10035645 3300009101 Bacteria 3033
50 Ga0114129_10077517 3300009147 Bacteria 4622
51 Ga0105241_10021122 3300009174 Bacteria 4813
52 Ga0105248_10000015 3300009177 Bacteria 322959
53 Ga0105237_10013522 3300009545 Bacteria 8552
54 Ga0105238_10001006 3300009551 Bacteria 28764
55 Ga0105238_10003071 3300009551 Bacteria 16643
56 Ga0105249_10156712 3300009553 Bacteria 2197
57 Ga0105239_10003777 3300010375 Bacteria 18426
58 Ga0105239_10031234 3300010375 Bacteria 5859
59 Ga0105239_10053406 3300010375 Bacteria 4433
60 Ga0105239_10080148 3300010375 Bacteria 3592
61 Ga0157373_10007945 3300013100 Bacteria 7888
62 Ga0157370_10016413 3300013104 Bacteria 7496
63 Ga0157369_10019820 3300013105 Bacteria 7526
64 Ga0157378_10096182 3300013297 Bacteria 2699
65 Ga0163162_10083251 3300013306 Bacteria 3273
66 Ga0157372_10059590 3300013307 Bacteria 4270
67 Ga0157380_10003638 3300014326 Bacteria 10600
68 Ga0157380_10158919 3300014326 Bacteria 1962
69 Ga0157379_10000442 3300014968 Bacteria 33636
70 Ga0157379_10053435 3300014968 Bacteria 3608
71 Ga0157376_10408307 3300014969 Bacteria 1315
72 Ga0213874_10012219 3300021377 Bacteria 2197
73 Ga0213876_10000435 3300021384 Bacteria 34197
74 Ga0209130_1007229 3300025284 Bacteria 3464
75 Ga0209025_1000552 3300025294 Bacteria 69909
76 Ga0209758_1000787 3300025297 Bacteria 45400
77 Ga0207426_1000133 3300025302 Bacteria 206783
78 Ga0207653_10034160 3300025885 Bacteria 1651
79 Ga0207692_10155065 3300025898 Bacteria 1315
80 Ga0207710_10045504 3300025900 Bacteria 1957
81 Ga0207680_10007590 3300025903 Bacteria 5295
82 Ga0207699_10000633 3300025906 Bacteria 17034
83 Ga0207707_10000002 3300025912 Bacteria 1142054
84 Ga0207695_10000004 3300025913 Bacteria 1288665
85 Ga0207695_10077571 3300025913 Bacteria 3374
86 Ga0207671_10183632 3300025914 Bacteria 1629
87 Ga0207693_10000052 3300025915 Bacteria 98125
88 Ga0207660_10000010 3300025917 Bacteria 92859
89 Ga0207657_10048439 3300025919 Bacteria 3710
90 Ga0207649_10000381 3300025920 Bacteria 33129
91 Ga0207649_10045483 3300025920 Bacteria 2692
92 Ga0207649_10053221 3300025920 Bacteria 2515
93 Ga0207652_10011682 3300025921 Bacteria 7085
94 Ga0207694_10000015 3300025924 Bacteria 363898
95 Ga0207694_10171357 3300025924 Bacteria 1757
96 Ga0207700_10000014 3300025928 Bacteria 229475
97 Ga0207664_10048979 3300025929 Bacteria 3325
98 Ga0207711_10000003 3300025941 Bacteria 1042791
99 Ga0207711_10000005 3300025941 Bacteria 822972
100 Ga0207711_10000009 3300025941 Bacteria 580864
101 Ga0207679_10229324 3300025945 Bacteria 1567
102 Ga0207667_10000226 3300025949 Bacteria 79075
103 Ga0207668_10312671 3300025972 Bacteria 1301
104 Ga0207703_10017456 3300026035 Bacteria 5602
105 Ga0207639_10003249 3300026041 Bacteria 10938
106 Ga0207639_10095376 3300026041 Bacteria 2391
107 Ga0207702_10000011 3300026078 Bacteria 284514
108 Ga0207702_10022993 3300026078 Bacteria 5171
109 Ga0207702_10131518 3300026078 Bacteria 2253
110 Ga0207674_10000002 3300026116 Bacteria 279738
111 Ga0207675_100033275 3300026118 Bacteria 4804
112 Ga0207698_10002329 3300026142 Bacteria 11247
113 Ga0207698_10022361 3300026142 Bacteria 4392
114 Ga0207698_10031433 3300026142 Bacteria 3832
115 Ga0207428_10000053 3300027907 Bacteria 175238
116 Ga0268265_10031447 3300028380 Bacteria 3833
117 Ga0265334_10022600 3300028573 Bacteria 2561
118 Ga0265338_10000007 3300028800 Bacteria 498229
119 Ga0265338_10008470 3300028800 Bacteria 12483
120 Ga0265332_10007589 3300031238 Bacteria 4901
121 Ga0265325_10000001 3300031241 Bacteria 726814
122 Ga0265325_10000454 3300031241 Bacteria 29581
123 Ga0265325_10000845 3300031241 Bacteria 22173
124 Ga0265340_10001853 3300031247 Bacteria 12067
125 Ga0265339_10000291 3300031249 Bacteria 40638
126 Ga0265339_10000697 3300031249 Bacteria 26023
127 Ga0265339_10002506 3300031249 Bacteria 13117
128 Ga0265331_10000037 3300031250 Bacteria 197251
129 Ga0265331_10001004 3300031250 Bacteria 22109
130 Ga0265331_10001143 3300031250 Bacteria 20243
131 Ga0265327_10004361 3300031251 Bacteria 12574
132 Ga0265316_10020294 3300031344 Bacteria 5662
133 Ga0307408_100071517 3300031548 Bacteria 2565
134 Ga0265313_10000650 3300031595 Bacteria 35724
135 Ga0265313_10001574 3300031595 Bacteria 21173
136 Ga0265314_10002173 3300031711 Bacteria 20530
137 Ga0265314_10015053 3300031711 Bacteria 6156
138 Ga0265314_10017399 3300031711 Bacteria 5644
139 Ga0265314_10024525 3300031711 Bacteria 4571
140 Ga0265342_10003120 3300031712 Bacteria 13848
141 Ga0265342_10004748 3300031712 Bacteria 10567
142 Ga0265342_10146926 3300031712 Bacteria 1312
143 Ga0307413_10195376 3300031824 Bacteria 1456
144 Ga0307409_100045592 3300031995 Bacteria 3311
145 Ga0307416_100069173 3300032002 Bacteria 2920
146 Ga0373923_0107990 3300035111 Bacteria 1233
147 Ga0373955_0046382 3300035172 Bacteria 2349
148 Ga0373924_0126099 3300035410 Unclassified 1113
149 Ga0373931_0174443 3300035691 Bacteria 1269
150 Ga0373935_0402232 3300035692 Bacteria 984
151 Ga0373927_0110754 3300035695 Unclassified 1789
152 Ga0373933_0133934 3300035724 Bacteria 1560
153 Ga0373937_0007557 3300036401 Bacteria 9412
154 Ga0373937_0015135 3300036401 Bacteria 6816
155 Ga0373937_0462217 3300036401 Bacteria 1205
156 Ga0373937_0598378 3300036401 Bacteria 1047
157 Ga0436364_0313462 3300037853 Bacteria 2626
158 Ga0436365_0741489 3300039437 Bacteria 13833
159 Ga0436365_1797404 3300039437 Bacteria 129057
160 Ga0436360_0152403 3300039438 Unclassified 1147
161 Ga0436360_0444147 3300039438 Bacteria 1369
162 Ga0436361_0482778 3300039447 Bacteria 4054
163 Ga0436363_1154058 3300039450 Bacteria 7036
164 Ga0466967_0419030 3300045976 Bacteria 1305
165 Ga0495653_0038947 3300046463 Bacteria 3728
166 Ga0495580_0236970 3300046472 Bacteria 1252
167 Ga0495584_0006001 3300046491 Bacteria 6399
168 Ga0495585_0045759 3300046492 Bacteria 2442
169 Ga0495585_0102849 3300046492 Bacteria 1526
170 Ga0495596_0003476 3300046500 Bacteria 7954
171 Ga0495596_0007460 3300046500 Bacteria 4932
172 Ga0495583_0001092 3300046506 Bacteria 30064
173 Ga0495583_0051217 3300046506 Bacteria 1883
174 Ga0495610_0006972 3300046512 Bacteria 7648
175 Ga0495616_0023994 3300046513 Bacteria 3276
176 Ga0495632_0041569 3300046519 Bacteria 2310
177 Ga0495643_0001891 3300046522 Bacteria 17714
178 Ga0495648_0109533 3300046524 Bacteria 1506
179 Ga0495642_0038070 3300046528 Bacteria 1948
180 Ga0495652_0107340 3300046529 Bacteria 2253
181 Ga0495587_0044269 3300046536 Bacteria 2648
182 Ga0495597_0001002 3300046542 Bacteria 21656
183 Ga0495645_0242098 3300046543 Bacteria 1203
184 Ga0495668_0035788 3300046616 Bacteria 2782
185 Ga0495669_0048081 3300046684 Bacteria 1907
186 Ga0495671_0005982 3300046692 Bacteria 7071
187 Ga0495649_0000885 3300046694 Bacteria 23904
188 Ga0495672_0059175 3300047320 Bacteria 2218
189 Ga0495677_0000209 3300047445 Bacteria 26831
190 Ga0495677_0061525 3300047445 Bacteria 1392
191 Ga0495602_0001822 3300048088 Bacteria 21298
192 Ga0495626_0001850 3300048091 Bacteria 15889
193 Ga0495626_0014250 3300048091 Bacteria 4105
194 Ga0495626_0016039 3300048091 Bacteria 3817
195 Ga0495626_0083037 3300048091 Bacteria 1420
196 Ga0496104_0274779 3300048907 Bacteria 1598
197 Ga0496111_0013634 3300048914 Bacteria 5537
198 Ga0496116_0100233 3300048919 Bacteria 1732
199 Ga0496125_0000129 3300048928 Bacteria 163342
200 Ga0495682_0001698 3300049460 Bacteria 11195
201 Ga0501033_0289955 3300049570 Bacteria 1154
202 Ga0501034_0031435 3300049571 Bacteria 5391
203 Ga0501034_0194714 3300049571 Bacteria 1988
204 Ga0501046_0008018 3300049580 Bacteria 9232
205 Ga0501046_0037803 3300049580 Bacteria 3878
206 Ga0501047_0024013 3300049581 Bacteria 5854
207 Ga0501048_0049974 3300049582 Unclassified 2979
208 Ga0501067_0042582 3300049583 Bacteria 2521
209 Ga0501068_0024267 3300049584 Bacteria 3561
210 Ga0501070_0059382 3300049586 Bacteria 3170
211 Ga0501073_0069566 3300049589 Bacteria 2452
212 Ga0501073_0305347 3300049589 Bacteria 1098
213 Ga0501074_0059488 3300049590 Bacteria 2752
214 Ga0501075_0105724 3300049591 Bacteria 2139
215 Ga0501077_0012345 3300049593 Bacteria 5351
216 Ga0501079_0105453 3300049741 Bacteria 2187
217 Ga0501080_0045550 3300049742 Bacteria 4083
218 Ga0501035_0017846 3300049822 Bacteria 6546
219 Ga0501035_0093350 3300049822 Bacteria 2648
220 Ga0501044_0055418 3300049823 Bacteria 4072
221 Ga0501045_0113104 3300049824 Bacteria 2013
222 nmdc:mga08y16_30_c1 3300050511 Bacteria 197110
223 nmdc:mga0n895_95314_c1 3300050512 Bacteria 2980
224 nmdc:mga0n895_98897_c1 3300050512 Bacteria 2925
225 nmdc:mga0rr50_9530_c1 3300050513 Bacteria 6110
226 nmdc:mga08x19_86_c1 3300050514 Bacteria 83486
227 Ga0500616_0037354 3300053153 Bacteria 2630
228 Ga0501084_0000074 3300054114 Bacteria 72522
229 Ga0590071_007416 3300059421 Unclassified 2593
230 Ga0501082_0188782 3300060353 Bacteria 1793
231 2508733603 2508501050 Bacteria 9633614
232 2509079660 2508501114 Bacteria 7082538
233 2643965697 2643221591 Bacteria 4397626
234 2644105313 2643221618 Bacteria 7717186
235 2644147280 2643221626 Bacteria 8069654
236 2644309800 2643221655 Bacteria 7722067
237 2644333315 2643221659 Bacteria 7890716
238 2644543458 2643221698 Bacteria 7756764
239 2644614373 2643221712 Bacteria 7729434
240 2774874215 2773857925 Bacteria 6472445
241 2776261506 2775506901 Bacteria 9631051
242 2835317910 2835312727 Bacteria 7413381
243 2844166518 2844163670 Bacteria 7266046
244 2844537128 2844533157 Bacteria 7517899
245 2882461600 2882456835 Bacteria 6863978
246 2884299434 2884298095 Bacteria 3823049
247 2894236898 2894232714 Bacteria 8834183
248 2932401968 2932401849 Bacteria 4262978
249 2941502610 2941499720 Bacteria 7599444
250 Ga0466959_0260366
251 JGI25151J46595_10001179
252 rootL2_10009133
253 JGI25160J50197_1003424
254 Ga0065165_1037613
255 Ga0065707_10103182
256 Ga0070666_10003051
257 Ga0070680_100000080
258 Ga0070691_10000167
259 Ga0070661_100000043
260 Ga0070668_100323640
261 Ga0070667_100100848
262 Ga0070703_10029301
263 Ga0070709_10018500
264 Ga0070714_100064606
265 Ga0070713_100000001
266 Ga0070681_10000002
267 Ga0070698_100042752
268 Ga0070679_100033058
269 Ga0068853_100001702
270 Ga0068853_100028779
271 Ga0070693_100138823
272 Ga0068855_100001071
273 Ga0070664_100046745
274 Ga0068857_100000460
275 Ga0068856_100000945
276 Ga0068856_100125710
277 Ga0068852_100046179
278 Ga0068852_100059077
279 Ga0068852_100061525
280 Ga0068866_10009726
281 Ga0068861_100114593
282 Ga0068858_100016810
283 Ga0068860_100212202
284 Ga0068862_100105649
285 Ga0081538_10014917
286 Ga0081540_1031256
287 Ga0070712_100000051
288 Ga0070712_100000572
289 Ga0097621_100028771
290 Ga0068871_100284988
291 Ga0075436_100000024
292 Ga0075436_100121646
293 Ga0105240_10005616
294 Ga0105240_10010593
295 Ga0105240_10025095
296 Ga0105240_10102493
297 Ga0111539_10000273
298 Ga0105247_10035645
299 Ga0114129_10077517
300 Ga0105241_10021122
301 Ga0105248_10000015
302 Ga0105237_10013522
303 Ga0105238_10001006
304 Ga0105238_10003071
305 Ga0105249_10156712
306 Ga0105239_10003777
307 Ga0105239_10031234
308 Ga0105239_10053406
309 Ga0105239_10080148
310 Ga0157373_10007945
311 Ga0157370_10016413
312 Ga0157369_10019820
313 Ga0157378_10096182
314 Ga0163162_10083251
315 Ga0157372_10059590
316 Ga0157380_10003638
317 Ga0157380_10158919
318 Ga0157379_10000442
319 Ga0157379_10053435
320 Ga0157376_10408307
321 Ga0213874_10012219
322 Ga0213876_10000435
323 Ga0209130_1007229
324 Ga0209025_1000552
325 Ga0209758_1000787
326 Ga0207426_1000133
327 Ga0207653_10034160
328 Ga0207692_10155065
329 Ga0207710_10045504
330 Ga0207680_10007590
331 Ga0207699_10000633
332 Ga0207707_10000002
333 Ga0207695_10000004
334 Ga0207695_10077571
335 Ga0207671_10183632
336 Ga0207693_10000052
337 Ga0207660_10000010
338 Ga0207657_10048439
339 Ga0207649_10000381
340 Ga0207649_10045483
341 Ga0207649_10053221
342 Ga0207652_10011682
343 Ga0207694_10000015
344 Ga0207694_10171357
345 Ga0207700_10000014
346 Ga0207664_10048979
347 Ga0207711_10000003
348 Ga0207711_10000005
349 Ga0207711_10000009
350 Ga0207679_10229324
351 Ga0207667_10000226
352 Ga0207668_10312671
353 Ga0207703_10017456
354 Ga0207639_10003249
355 Ga0207639_10095376
356 Ga0207702_10000011
357 Ga0207702_10022993
358 Ga0207702_10131518
359 Ga0207674_10000002
360 Ga0207675_100033275
361 Ga0207698_10002329
362 Ga0207698_10022361
363 Ga0207698_10031433
364 Ga0207428_10000053
365 Ga0268265_10031447
366 Ga0265334_10022600
367 Ga0265338_10000007
368 Ga0265338_10008470
369 Ga0265332_10007589
370 Ga0265325_10000001
371 Ga0265325_10000454
372 Ga0265325_10000845
373 Ga0265340_10001853
374 Ga0265339_10000291
375 Ga0265339_10000697
376 Ga0265339_10002506
377 Ga0265331_10000037
378 Ga0265331_10001004
379 Ga0265331_10001143
380 Ga0265327_10004361
381 Ga0265316_10020294
382 Ga0307408_100071517
383 Ga0265313_10000650
384 Ga0265313_10001574
385 Ga0265314_10002173
386 Ga0265314_10015053
387 Ga0265314_10017399
388 Ga0265314_10024525
389 Ga0265342_10003120
390 Ga0265342_10004748
391 Ga0265342_10146926
392 Ga0307413_10195376
393 Ga0307409_100045592
394 Ga0307416_100069173
395 Ga0373923_0107990
396 Ga0373955_0046382
397 Ga0373924_0126099
398 Ga0373931_0174443
399 Ga0373935_0402232
400 Ga0373927_0110754
401 Ga0373933_0133934
402 Ga0373937_0007557
403 Ga0373937_0015135
404 Ga0373937_0462217
405 Ga0373937_0598378
406 Ga0436364_0313462
407 Ga0436365_0741489
408 Ga0436365_1797404
409 Ga0436360_0152403
410 Ga0436360_0444147
411 Ga0436361_0482778
412 Ga0436363_1154058
413 Ga0466967_0419030
414 Ga0495653_0038947
415 Ga0495580_0236970
416 Ga0495584_0006001
417 Ga0495585_0045759
418 Ga0495585_0102849
419 Ga0495596_0003476
420 Ga0495596_0007460
421 Ga0495583_0001092
422 Ga0495583_0051217
423 Ga0495610_0006972
424 Ga0495616_0023994
425 Ga0495632_0041569
426 Ga0495643_0001891
427 Ga0495648_0109533
428 Ga0495642_0038070
429 Ga0495652_0107340
430 Ga0495587_0044269
431 Ga0495597_0001002
432 Ga0495645_0242098
433 Ga0495668_0035788
434 Ga0495669_0048081
435 Ga0495671_0005982
436 Ga0495649_0000885
437 Ga0495672_0059175
438 Ga0495677_0000209
439 Ga0495677_0061525
440 Ga0495602_0001822
441 Ga0495626_0001850
442 Ga0495626_0014250
443 Ga0495626_0016039
444 Ga0495626_0083037
445 Ga0496104_0274779
446 Ga0496111_0013634
447 Ga0496116_0100233
448 Ga0496125_0000129
449 Ga0495682_0001698
450 Ga0501033_0289955
451 Ga0501034_0031435
452 Ga0501034_0194714
453 Ga0501046_0008018
454 Ga0501046_0037803
455 Ga0501047_0024013
456 Ga0501048_0049974
457 Ga0501067_0042582
458 Ga0501068_0024267
459 Ga0501070_0059382
460 Ga0501073_0069566
461 Ga0501073_0305347
462 Ga0501074_0059488
463 Ga0501075_0105724
464 Ga0501077_0012345
465 Ga0501079_0105453
466 Ga0501080_0045550
467 Ga0501035_0017846
468 Ga0501035_0093350
469 Ga0501044_0055418
470 Ga0501045_0113104
471 nmdc:mga08y16_30_c1
472 nmdc:mga0n895_95314_c1
473 nmdc:mga0n895_98897_c1
474 nmdc:mga0rr50_9530_c1
475 nmdc:mga08x19_86_c1
476 Ga0500616_0037354
477 Ga0501084_0000074
478 Ga0590071_007416
479 Ga0501082_0188782
480 2508733603
481 2509079660
482 2643965697
483 2644105313
484 2644147280
485 2644309800
486 2644333315
487 2644543458
488 2644614373
489 2774874215
490 2776261506
491 2835317910
492 2844166518
493 2844537128
494 2882461600
495 2884299434
496 2894236898
497 2932401968
498 2941502610

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00756

Esterase

Putative esterase

65

366

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
3wyd-assembly1.cif.gz_B c-terminal esterase domain of lc-est1 0.8276 35 332
5vol-assembly2.cif.gz_H bacint_04212 ferulic acid esterase 0.8042 9 333
5vol-assembly2.cif.gz_G bacint_04212 ferulic acid esterase 0.8015 9 333
7b6b-assembly1.cif.gz_A the carbohydrate binding module family 48 (cbm48) and carboxy-terminal carbohydrate esterase family 1 (ce1) domains of the multidomain esterase dmce1b from dysgonomonas mossii in complex with methyl ferulate 0.8009 4 336
3wyd-assembly1.cif.gz_B c-terminal esterase domain of lc-est1 0.7995 35 332
ID Description Score Start End Superfamily
3wydB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8276 35 332 3.40.50.1820
3wydB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7995 35 332 3.40.50.1820
af_A4HYV9_156_416_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7712 5 336 3.40.50.1820
5cxuA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7616 3 334 3.40.50.1820
af_Q2FUY3_1_252_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7607 11 331 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A827M2G1-F1-model_v4 deleted 0.9896 43 336
AF-A0A1I5D7G9-F1-model_v4 Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase 0.9884 1 336 GO:0016020
GO:0016757
AF-A0A3C0MI37-F1-model_v4 Enterochelin esterase 0.9871 95 292
AF-A0A827M2G1-F1-model_v4 deleted 0.9863 43 336
AF-A0A2D8W6M8-F1-model_v4 deleted 0.9859 1 281

Map