F360973

General Info

Members Datasets Scaffolds Average Seq Length
249 150 498 500

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0020232|Ga0451576_0020232_3340_5013
Length 557
Sequence MQLSLDCCVKNLLVIYRNYFRILSISSKKTGHMSTLKRNRTILIVILCSVSGLFVSCKENQEKPAPRIFSPSFTSDFESFRQYEYPEWFRDAKFGIWAHWGPQAVPRQGDWYARKMYESDIRNRKTGEFTGESSREYLYHLEHYGHPSKFGYKDIIPLWKAERWDPDKLMALYKRVGAKYFVSMATHHDNFFLWDSKIHRWNSVKMGPMKDVVGLWQKAARNEGLRFGISEHLGASYTWFQPSHYADRKGPMKGIPFDGADPEFQDLYHKKTADNDMGWLTTDSANQQEWLSSITEVIDMYKPDLLYSDSEMPFGSVGRTMVSHFYNQDITKNNGRLEAVYTCKHFGSEGRWVSDIERGAMDSISPYPWQTDTSIGDWYYRTGQKYMTGLQVIQMLVDIVSKNGNLLLNVVQTPEGDLEQDVIDILEEVAAWTPVNGEGIYGTRPWKVYGEGPSTENQAKGTFGGVKDVRPYTSSDIRFTSKDNFLYAFLMDRPAGEIKIQSLGRNKGLTDKKIKNISMPGSEEKLKWEQGEEALSVMLPSELPDWNVIALKIEFRK

Samples

Sample ID Description Type Environment
1 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
9 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
38 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
39 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
45 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
46 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
47 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
48 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
49 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
52 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
53 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
77 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
78 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
79 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
80 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
81 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
82 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
83 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
84 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
85 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
86 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
87 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
88 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
89 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
90 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
91 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
94 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
95 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
96 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
97 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
98 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
99 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
100 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
101 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
102 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
103 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
104 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
105 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
106 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
107 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
108 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
109 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
110 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
111 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
112 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
113 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
114 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
115 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
116 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
117 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
118 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
119 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
120 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
121 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
122 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
123 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
124 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
125 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
126 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
127 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
128 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
129 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
130 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
132 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
133 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
134 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
135 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
136 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
137 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
138 2738541302 Pedobacter sp. CF074 Isolate Unclassified
139 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
140 2818991437 Pedobacter terrae 518 Isolate Unclassified
141 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
142 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
143 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
144 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
145 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
146 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
147 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
148 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
149 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
150 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.98
Metatranscriptomes 0.4
Isolates 5.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.23
Nodule 0
Rhizoplane 0.8
Rhizosphere 87.15
Stem 0
Stem Tuber 0
Unclassified 5.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451576_0020232 3300045051 Bacteria 7249
2 JGI24739J22299_10023631 3300001989 Bacteria 2170
3 JGI24737J22298_10000310 3300001990 Bacteria 16241
4 JGI24737J22298_10020750 3300001990 Bacteria 2096
5 JGI24735J21928_10000010 3300002067 Bacteria 237152
6 JGI25162J39368_1000005 3300002737 Bacteria 435925
7 rootH2_10153958 3300003320 Bacteria 2837
8 Ga0055526_1009446 3300003771 Bacteria 4686
9 Ga0055536_1000007 3300003781 Bacteria 345133
10 Ga0055530_10004536 3300003791 Bacteria 7098
11 Ga0065165_1000920 3300005262 Bacteria 37774
12 Ga0065714_10064434 3300005288 Bacteria 130989
13 Ga0070658_10017507 3300005327 Bacteria 5733
14 Ga0070658_10036402 3300005327 Unclassified 3967
15 Ga0070676_10003789 3300005328 Bacteria 7930
16 Ga0070680_100013159 3300005336 Bacteria 6441
17 Ga0068868_100019029 3300005338 Bacteria 5141
18 Ga0070660_100045596 3300005339 Bacteria 3357
19 Ga0070673_100001414 3300005364 Bacteria 14048
20 Ga0070659_100006931 3300005366 Bacteria 8204
21 Ga0070659_100019550 3300005366 Bacteria 5135
22 Ga0070663_100005641 3300005455 Bacteria 7455
23 Ga0070678_100012425 3300005456 Bacteria 5292
24 Ga0070662_100000145 3300005457 Bacteria 40435
25 Ga0070681_10113175 3300005458 Bacteria 2653
26 Ga0068867_100000856 3300005459 Bacteria 20531
27 Ga0070679_100000473 3300005530 Bacteria 34337
28 Ga0068855_100107992 3300005563 Bacteria 3197
29 Ga0068856_100021438 3300005614 Bacteria 6282
30 Ga0068852_100000306 3300005616 Bacteria 33010
31 Ga0068852_100004531 3300005616 Bacteria 9831
32 Ga0075366_10070681 3300006195 Bacteria 2079
33 Ga0097621_100000369 3300006237 Bacteria 31242
34 Ga0068871_100000513 3300006358 Bacteria 26609
35 Ga0068865_100000310 3300006881 Bacteria 26942
36 Ga0105240_10029281 3300009093 Bacteria 7178
37 Ga0105240_10225838 3300009093 Bacteria 2179
38 Ga0105241_10000251 3300009174 Bacteria 40576
39 Ga0105241_10001046 3300009174 Bacteria 21092
40 Ga0105241_10049509 3300009174 Unclassified 3200
41 Ga0105237_10000993 3300009545 Bacteria 38153
42 Ga0105238_10012070 3300009551 Bacteria 8705
43 Ga0105239_10000016 3300010375 Bacteria 293142
44 Ga0105239_10000032 3300010375 Bacteria 225528
45 Ga0105239_10009494 3300010375 Bacteria 10957
46 Ga0157373_10037892 3300013100 Bacteria 3455
47 Ga0157373_10040006 3300013100 Unclassified 3355
48 Ga0157373_10100055 3300013100 Bacteria 2040
49 Ga0157371_10000016 3300013102 Bacteria 330495
50 Ga0157371_10002379 3300013102 Bacteria 17992
51 Ga0157371_10013314 3300013102 Bacteria 6254
52 Ga0157371_10030370 3300013102 Bacteria 3899
53 Ga0157371_10062914 3300013102 Bacteria 2630
54 Ga0157371_10072567 3300013102 Bacteria 2437
55 Ga0157371_10086448 3300013102 Bacteria 2221
56 Ga0157370_10000144 3300013104 Bacteria 86782
57 Ga0157370_10000471 3300013104 Bacteria 50251
58 Ga0157370_10004387 3300013104 Bacteria 16197
59 Ga0157370_10009496 3300013104 Bacteria 10381
60 Ga0157370_10184896 3300013104 Bacteria 1935
61 Ga0157369_10000169 3300013105 Bacteria 91977
62 Ga0157369_10000500 3300013105 Bacteria 51847
63 Ga0157369_10062792 3300013105 Bacteria 4002
64 Ga0157369_10129869 3300013105 Bacteria 2671
65 Ga0157374_10000418 3300013296 Bacteria 38471
66 Ga0157374_10000599 3300013296 Bacteria 31938
67 Ga0157372_10000001 3300013307 Bacteria 791349
68 Ga0157372_10017858 3300013307 Bacteria 7621
69 Ga0157372_10057229 3300013307 Bacteria 4358
70 Ga0157372_10083634 3300013307 Bacteria 3615
71 Ga0157372_10085103 3300013307 Bacteria 3586
72 Ga0157372_10119505 3300013307 Bacteria 3025
73 Ga0157372_10121945 3300013307 Bacteria 2995
74 Ga0157375_10226933 3300013308 Bacteria 2026
75 Ga0182008_10006734 3300014497 Bacteria 6396
76 Ga0182006_1000190 3300015261 Bacteria 63313
77 Ga0182006_1000669 3300015261 Bacteria 24090
78 Ga0182007_10000197 3300015262 Bacteria 40291
79 Ga0183373_1001 3300015682 Bacteria 1410374
80 Ga0163161_10000170 3300017792 Bacteria 59576
81 Ga0163161_10000206 3300017792 Bacteria 54119
82 Ga0206351_11009503 3300020077 Bacteria 3535
83 Ga0209674_102086 3300025226 Bacteria 4552
84 Ga0209437_100043 3300025233 Bacteria 440454
85 Ga0209233_1001955 3300025261 Bacteria 7843
86 Ga0209676_1000058 3300025292 Bacteria 345185
87 Ga0209564_1003439 3300025295 Bacteria 10829
88 Ga0209050_1000054 3300025298 Bacteria 345186
89 Ga0207647_10000043 3300025904 Bacteria 91109
90 Ga0207647_10000302 3300025904 Bacteria 40592
91 Ga0207645_10001515 3300025907 Bacteria 18982
92 Ga0207705_10004963 3300025909 Bacteria 9987
93 Ga0207705_10012602 3300025909 Bacteria 6103
94 Ga0207654_10003079 3300025911 Bacteria 8450
95 Ga0207654_10026210 3300025911 Bacteria 3154
96 Ga0207695_10001921 3300025913 Bacteria 32318
97 Ga0207671_10015298 3300025914 Bacteria 6018
98 Ga0207657_10004855 3300025919 Bacteria 14159
99 Ga0207657_10034533 3300025919 Bacteria 4545
100 Ga0207652_10006858 3300025921 Bacteria 9178
101 Ga0207694_10019367 3300025924 Bacteria 5145
102 Ga0207690_10064291 3300025932 Bacteria 2505
103 Ga0207690_10080272 3300025932 Bacteria 2276
104 Ga0207706_10000538 3300025933 Bacteria 40240
105 Ga0207686_10050231 3300025934 Bacteria 2593
106 Ga0207704_10004968 3300025938 Bacteria 6118
107 Ga0207661_10083422 3300025944 Bacteria 2645
108 Ga0207667_10039937 3300025949 Bacteria 4997
109 Ga0207667_10088557 3300025949 Bacteria 3201
110 Ga0207667_10255593 3300025949 Bacteria 1792
111 Ga0207678_10012477 3300026067 Bacteria 7464
112 Ga0207702_10047973 3300026078 Bacteria 3600
113 Ga0207648_10002167 3300026089 Bacteria 21343
114 Ga0207683_10039363 3300026121 Bacteria 4124
115 Ga0207698_10000765 3300026142 Bacteria 18704
116 Ga0207698_10022150 3300026142 Bacteria 4409
117 Ga0207698_10072622 3300026142 Bacteria 2736
118 Ga0307511_10002393 3300030521 Bacteria 19619
119 Ga0316183_1180191 3300030742 Bacteria 65717
120 Ga0316181_1193130 3300030744 Bacteria 19541
121 Ga0265327_10074916 3300031251 Bacteria 1685
122 Ga0265316_10029994 3300031344 Bacteria 4464
123 Ga0307509_10046821 3300031507 Unclassified 4654
124 Ga0307405_10000025 3300031731 Bacteria 123095
125 Ga0307407_10000016 3300031903 Bacteria 141499
126 Ga0307416_100000009 3300032002 Bacteria 374271
127 Ga0307416_100000036 3300032002 Bacteria 141505
128 Ga0307414_10046645 3300032004 Bacteria 2976
129 Ga0307510_10000536 3300033180 Bacteria 37853
130 Ga0373937_0030586 3300036401 Bacteria 4876
131 Ga0395899_0000150 3300037312 Bacteria 105946
132 Ga0395899_0000474 3300037312 Bacteria 45411
133 Ga0395899_0001451 3300037312 Bacteria 20221
134 Ga0395899_0009948 3300037312 Bacteria 7295
135 Ga0395899_0085579 3300037312 Unclassified 2290
136 Ga0395900_0000413 3300037418 Bacteria 61555
137 Ga0395900_0000602 3300037418 Bacteria 49161
138 Ga0395898_0007319 3300037466 Bacteria 11721
139 Ga0395898_0036844 3300037466 Bacteria 4854
140 Ga0395898_0149345 3300037466 Unclassified 2236
141 Ga0395905_0000188 3300037471 Bacteria 98070
142 Ga0395905_0002933 3300037471 Bacteria 18555
143 Ga0395901_0000611 3300038443 Bacteria 41511
144 Ga0395901_0007030 3300038443 Bacteria 11373
145 Ga0439448_0015761 3300042005 Unclassified 2292
146 Ga0451577_0000048 3300042876 Bacteria 309377
147 Ga0451577_0000433 3300042876 Bacteria 74789
148 Ga0451577_0001478 3300042876 Bacteria 31145
149 Ga0451577_0003005 3300042876 Bacteria 19218
150 Ga0451577_0008779 3300042876 Bacteria 9793
151 Ga0451577_0031457 3300042876 Bacteria 4788
152 Ga0453683_0000055 3300044673 Bacteria 192588
153 Ga0453683_0000186 3300044673 Bacteria 86082
154 Ga0453683_0000214 3300044673 Bacteria 77233
155 Ga0453683_0001627 3300044673 Bacteria 18859
156 Ga0453683_0010787 3300044673 Bacteria 6048
157 Ga0453683_0086464 3300044673 Unclassified 1964
158 Ga0453683_0087979 3300044673 Unclassified 1947
159 Ga0466966_0001498 3300044684 Bacteria 14986
160 Ga0466966_0002353 3300044684 Bacteria 12343
161 Ga0466961_0001629 3300044693 Bacteria 13934
162 Ga0466961_0017935 3300044693 Bacteria 4551
163 Ga0453684_0000161 3300044712 Bacteria 298175
164 Ga0453684_0000570 3300044712 Bacteria 137760
165 Ga0453684_0000766 3300044712 Bacteria 111429
166 Ga0453684_0000995 3300044712 Bacteria 92458
167 Ga0453684_0015226 3300044712 Bacteria 12198
168 Ga0453684_0015469 3300044712 Bacteria 12062
169 Ga0453684_0021264 3300044712 Bacteria 9708
170 Ga0453684_0037425 3300044712 Bacteria 6660
171 Ga0453684_0051770 3300044712 Bacteria 5377
172 Ga0453684_0060134 3300044712 Bacteria 4891
173 Ga0453684_0062285 3300044712 Bacteria 4779
174 Ga0453684_0103927 3300044712 Bacteria 3469
175 Ga0453684_0121329 3300044712 Bacteria 3155
176 Ga0453684_0148770 3300044712 Bacteria 2786
177 Ga0453684_0194709 3300044712 Bacteria 2368
178 Ga0466971_0003181 3300044719 Bacteria 7007
179 Ga0466959_0000462 3300045049 Bacteria 23654
180 Ga0466959_0058462 3300045049 Unclassified 2808
181 Ga0466959_0082010 3300045049 Bacteria 2324
182 Ga0451576_0000059 3300045051 Bacteria 296795
183 Ga0451576_0000095 3300045051 Bacteria 223485
184 Ga0451576_0000504 3300045051 Bacteria 85668
185 Ga0451576_0000689 3300045051 Bacteria 68784
186 Ga0451576_0001819 3300045051 Bacteria 34710
187 Ga0451576_0004689 3300045051 Bacteria 17583
188 Ga0451576_0005256 3300045051 Bacteria 16343
189 Ga0451576_0008893 3300045051 Bacteria 11718
190 Ga0451576_0033587 3300045051 Bacteria 5453
191 Ga0451576_0101909 3300045051 Unclassified 2986
192 Ga0466958_0002398 3300045836 Bacteria 9387
193 Ga0466958_0018354 3300045836 Bacteria 4060
194 Ga0495638_0000086 3300046460 Bacteria 152781
195 Ga0495638_0014688 3300046460 Bacteria 5282
196 Ga0495650_0001594 3300046471 Bacteria 21229
197 Ga0495584_0001635 3300046491 Bacteria 13168
198 Ga0495596_0026799 3300046500 Unclassified 2321
199 Ga0495607_0022319 3300046501 Bacteria 3977
200 Ga0495583_0000456 3300046506 Bacteria 60762
201 Ga0495606_0008989 3300046507 Bacteria 8547
202 Ga0495606_0067080 3300046507 Bacteria 2273
203 Ga0495610_0000495 3300046512 Bacteria 40233
204 Ga0495616_0003315 3300046513 Bacteria 10341
205 Ga0495631_0005057 3300046518 Bacteria 6946
206 Ga0495643_0037542 3300046522 Bacteria 2656
207 Ga0495648_0000001 3300046524 Bacteria 696872
208 Ga0495666_0057760 3300046526 Bacteria 1857
209 Ga0495642_0000467 3300046528 Bacteria 21246
210 Ga0495609_0000030 3300046538 Bacteria 215885
211 Ga0495609_0000342 3300046538 Bacteria 41240
212 Ga0495622_0000094 3300046557 Bacteria 79405
213 Ga0495633_0000096 3300046558 Bacteria 118933
214 Ga0495633_0037495 3300046558 Bacteria 2319
215 Ga0495668_0000151 3300046616 Bacteria 105466
216 Ga0495611_0000182 3300046648 Bacteria 44769
217 Ga0495625_0000065 3300046660 Bacteria 173230
218 Ga0495661_0001850 3300046665 Bacteria 16904
219 Ga0495589_0000021 3300046794 Bacteria 197941
220 Ga0495683_0016821 3300047323 Bacteria 3795
221 Ga0495687_000360 3300047443 Bacteria 57082
222 Ga0495687_001909 3300047443 Bacteria 17895
223 Ga0495677_0000383 3300047445 Bacteria 18990
224 Ga0495626_0002942 3300048091 Bacteria 11337
225 Ga0496115_0104226 3300048918 Bacteria 2328
226 Ga0495678_000361 3300049459 Bacteria 46514
227 Ga0501034_0101886 3300049571 Unclassified 2865
228 Ga0501035_0124018 3300049822 Bacteria 2256
229 nmdc:mga0k408_34915_c1 3300050493 Bacteria 2881
230 nmdc:mga0k408_974_c2 3300050493 Bacteria 6264
231 Ga0500635_0000290 3300053080 Bacteria 18253
232 Ga0500608_005102 3300053122 Bacteria 5173
233 Ga0500608_016130 3300053122 Bacteria 3370
234 Ga0500622_0000547 3300053156 Bacteria 34632
235 Ga0466962_0004084 3300061719 Bacteria 6991
236 2599481060 2599185184 Bacteria 6430550
237 2738851731 2738541302 Bacteria 5944758
238 2776614469 2775506987 Bacteria 5373360
239 2819550028 2818991437 Bacteria 5805520
240 2819679180 2818991460 Bacteria 7595395
241 2842726743 2842722452 Bacteria 6263924
242 2842911585 2842909656 Bacteria 6185908
243 2849286147 2849281842 Bacteria 6065644
244 2904448609 2904445276 Bacteria 5310396
245 2928083067 2928078545 Bacteria 6534839
246 2928150088 2928147474 Bacteria 6512076
247 2932086892 2932082852 Bacteria 6563563
248 2946001930 2945997725 Bacteria 6404843
249 2954019812 2954016120 Bacteria 6446024
250 Ga0451576_0020232
251 JGI24739J22299_10023631
252 JGI24737J22298_10000310
253 JGI24737J22298_10020750
254 JGI24735J21928_10000010
255 JGI25162J39368_1000005
256 rootH2_10153958
257 Ga0055526_1009446
258 Ga0055536_1000007
259 Ga0055530_10004536
260 Ga0065165_1000920
261 Ga0065714_10064434
262 Ga0070658_10017507
263 Ga0070658_10036402
264 Ga0070676_10003789
265 Ga0070680_100013159
266 Ga0068868_100019029
267 Ga0070660_100045596
268 Ga0070673_100001414
269 Ga0070659_100006931
270 Ga0070659_100019550
271 Ga0070663_100005641
272 Ga0070678_100012425
273 Ga0070662_100000145
274 Ga0070681_10113175
275 Ga0068867_100000856
276 Ga0070679_100000473
277 Ga0068855_100107992
278 Ga0068856_100021438
279 Ga0068852_100000306
280 Ga0068852_100004531
281 Ga0075366_10070681
282 Ga0097621_100000369
283 Ga0068871_100000513
284 Ga0068865_100000310
285 Ga0105240_10029281
286 Ga0105240_10225838
287 Ga0105241_10000251
288 Ga0105241_10001046
289 Ga0105241_10049509
290 Ga0105237_10000993
291 Ga0105238_10012070
292 Ga0105239_10000016
293 Ga0105239_10000032
294 Ga0105239_10009494
295 Ga0157373_10037892
296 Ga0157373_10040006
297 Ga0157373_10100055
298 Ga0157371_10000016
299 Ga0157371_10002379
300 Ga0157371_10013314
301 Ga0157371_10030370
302 Ga0157371_10062914
303 Ga0157371_10072567
304 Ga0157371_10086448
305 Ga0157370_10000144
306 Ga0157370_10000471
307 Ga0157370_10004387
308 Ga0157370_10009496
309 Ga0157370_10184896
310 Ga0157369_10000169
311 Ga0157369_10000500
312 Ga0157369_10062792
313 Ga0157369_10129869
314 Ga0157374_10000418
315 Ga0157374_10000599
316 Ga0157372_10000001
317 Ga0157372_10017858
318 Ga0157372_10057229
319 Ga0157372_10083634
320 Ga0157372_10085103
321 Ga0157372_10119505
322 Ga0157372_10121945
323 Ga0157375_10226933
324 Ga0182008_10006734
325 Ga0182006_1000190
326 Ga0182006_1000669
327 Ga0182007_10000197
328 Ga0183373_1001
329 Ga0163161_10000170
330 Ga0163161_10000206
331 Ga0206351_11009503
332 Ga0209674_102086
333 Ga0209437_100043
334 Ga0209233_1001955
335 Ga0209676_1000058
336 Ga0209564_1003439
337 Ga0209050_1000054
338 Ga0207647_10000043
339 Ga0207647_10000302
340 Ga0207645_10001515
341 Ga0207705_10004963
342 Ga0207705_10012602
343 Ga0207654_10003079
344 Ga0207654_10026210
345 Ga0207695_10001921
346 Ga0207671_10015298
347 Ga0207657_10004855
348 Ga0207657_10034533
349 Ga0207652_10006858
350 Ga0207694_10019367
351 Ga0207690_10064291
352 Ga0207690_10080272
353 Ga0207706_10000538
354 Ga0207686_10050231
355 Ga0207704_10004968
356 Ga0207661_10083422
357 Ga0207667_10039937
358 Ga0207667_10088557
359 Ga0207667_10255593
360 Ga0207678_10012477
361 Ga0207702_10047973
362 Ga0207648_10002167
363 Ga0207683_10039363
364 Ga0207698_10000765
365 Ga0207698_10022150
366 Ga0207698_10072622
367 Ga0307511_10002393
368 Ga0316183_1180191
369 Ga0316181_1193130
370 Ga0265327_10074916
371 Ga0265316_10029994
372 Ga0307509_10046821
373 Ga0307405_10000025
374 Ga0307407_10000016
375 Ga0307416_100000009
376 Ga0307416_100000036
377 Ga0307414_10046645
378 Ga0307510_10000536
379 Ga0373937_0030586
380 Ga0395899_0000150
381 Ga0395899_0000474
382 Ga0395899_0001451
383 Ga0395899_0009948
384 Ga0395899_0085579
385 Ga0395900_0000413
386 Ga0395900_0000602
387 Ga0395898_0007319
388 Ga0395898_0036844
389 Ga0395898_0149345
390 Ga0395905_0000188
391 Ga0395905_0002933
392 Ga0395901_0000611
393 Ga0395901_0007030
394 Ga0439448_0015761
395 Ga0451577_0000048
396 Ga0451577_0000433
397 Ga0451577_0001478
398 Ga0451577_0003005
399 Ga0451577_0008779
400 Ga0451577_0031457
401 Ga0453683_0000055
402 Ga0453683_0000186
403 Ga0453683_0000214
404 Ga0453683_0001627
405 Ga0453683_0010787
406 Ga0453683_0086464
407 Ga0453683_0087979
408 Ga0466966_0001498
409 Ga0466966_0002353
410 Ga0466961_0001629
411 Ga0466961_0017935
412 Ga0453684_0000161
413 Ga0453684_0000570
414 Ga0453684_0000766
415 Ga0453684_0000995
416 Ga0453684_0015226
417 Ga0453684_0015469
418 Ga0453684_0021264
419 Ga0453684_0037425
420 Ga0453684_0051770
421 Ga0453684_0060134
422 Ga0453684_0062285
423 Ga0453684_0103927
424 Ga0453684_0121329
425 Ga0453684_0148770
426 Ga0453684_0194709
427 Ga0466971_0003181
428 Ga0466959_0000462
429 Ga0466959_0058462
430 Ga0466959_0082010
431 Ga0451576_0000059
432 Ga0451576_0000095
433 Ga0451576_0000504
434 Ga0451576_0000689
435 Ga0451576_0001819
436 Ga0451576_0004689
437 Ga0451576_0005256
438 Ga0451576_0008893
439 Ga0451576_0033587
440 Ga0451576_0101909
441 Ga0466958_0002398
442 Ga0466958_0018354
443 Ga0495638_0000086
444 Ga0495638_0014688
445 Ga0495650_0001594
446 Ga0495584_0001635
447 Ga0495596_0026799
448 Ga0495607_0022319
449 Ga0495583_0000456
450 Ga0495606_0008989
451 Ga0495606_0067080
452 Ga0495610_0000495
453 Ga0495616_0003315
454 Ga0495631_0005057
455 Ga0495643_0037542
456 Ga0495648_0000001
457 Ga0495666_0057760
458 Ga0495642_0000467
459 Ga0495609_0000030
460 Ga0495609_0000342
461 Ga0495622_0000094
462 Ga0495633_0000096
463 Ga0495633_0037495
464 Ga0495668_0000151
465 Ga0495611_0000182
466 Ga0495625_0000065
467 Ga0495661_0001850
468 Ga0495589_0000021
469 Ga0495683_0016821
470 Ga0495687_000360
471 Ga0495687_001909
472 Ga0495677_0000383
473 Ga0495626_0002942
474 Ga0496115_0104226
475 Ga0495678_000361
476 Ga0501034_0101886
477 Ga0501035_0124018
478 nmdc:mga0k408_34915_c1
479 nmdc:mga0k408_974_c2
480 Ga0500635_0000290
481 Ga0500608_005102
482 Ga0500608_016130
483 Ga0500622_0000547
484 Ga0466962_0004084
485 2599481060
486 2738851731
487 2776614469
488 2819550028
489 2819679180
490 2842726743
491 2842911585
492 2849286147
493 2904448609
494 2928083067
495 2928150088
496 2932086892
497 2946001930
498 2954019812

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01120

Alpha_L_fucos

Alpha-L-fucosidase

61

438

0.88

PF16757

Fucosidase_C

Alpha-L-fucosidase C-terminal domain

470

554

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7lk7-assembly1.cif.gz_A structure of the exo-alpha-l-galactosidase bpgh29 from bacteroides plebeius in complex with l-galactose 0.8641 31 489
7lnp-assembly2.cif.gz_C structure of the exo-alpha-l-galactosidase bpgh29 (d264n mutant) from bacteroides plebeius in complex with paranitrophenyl-alpha-l-galactopyranoside 0.8571 25 489
7snk-assembly1.cif.gz_A structure of bacple_01702, a gh29 family glycoside hydrolase 0.8484 33 489
7ljj-assembly1.cif.gz_A structure of the exo-alpha-l-galactosidase bpgh29 from bacteroides plebeius 0.8457 33 489
7lnp-assembly4.cif.gz_E structure of the exo-alpha-l-galactosidase bpgh29 (d264n mutant) from bacteroides plebeius in complex with paranitrophenyl-alpha-l-galactopyranoside 0.8456 30 489
ID Description Score Start End Superfamily
4pspA01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.7817 32 376 3.20.20.80
1hl9B01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.7668 34 376 3.20.20.80
1hl9B01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.7625 34 376 3.20.20.80
4pspA02 Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II 0.7498 378 489 2.60.40.1180
af_Q551C1_18_358_3.20.20.80 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.7496 32 372 3.20.20.80
ID Description Score Start End GO Terms
AF-A0A364WF27-F1-model_v4 deleted 0.965 24 491
AF-A0A7X9D8H1-F1-model_v4 Alpha-L-fucosidase 0.953 275 490 GO:0004560
GO:0005764
GO:0006004
GO:0016139
AF-A0A7V5U959-F1-model_v4 Alpha-L-fucosidase 0.9512 24 389 GO:0004560
GO:0005764
GO:0006004
GO:0016139
AF-A0A522SKP2-F1-model_v4 Alpha-L-fucosidase 0.9505 24 491 GO:0004560
GO:0005764
GO:0006004
GO:0016139
AF-A0A7V6BDQ5-F1-model_v4 Alpha-L-fucosidase 0.941 24 337 GO:0004560
GO:0005764
GO:0006004
GO:0016139

Map