F361237

General Info

Members Datasets Scaffolds Average Seq Length
250 174 500 276

Family's Representative Sequence

Representative Sequence 3300001990|JGI24737J22298_10043811|JGI24737J22298_100438112
Length 284
Sequence VNDPINPRASNWVRFAPGDPVLKGVNWGGLRTLYIKEVRRFFKVQMQTVWAPAITQLLYLIIFTVALGRGGRTVVVAPGVDVPFVNFLAPGLIVMAMIQNAFANSSFSLLVGKIQGNIVDYXMPPLSTGELIAGLVGASVTRAFFVGFALWFVMLFWPGVSVAVRRPELLIYFGLMGSLIMSFLGLLTSIWAXKFDHAAAVTNFVVTPLALLSGTFYSVHQLAPAVQKICYANPIFYVISGFRAGFLGVSDSPLWIGGIGLLALNLVLWGICYSVLNSGWKIKN

Samples

Sample ID Description Type Environment
1 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
101 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
102 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
103 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
104 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
105 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
106 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
107 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
108 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
109 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
110 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
111 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
112 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
113 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
114 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
115 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
116 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
117 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
118 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
119 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
120 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
121 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
122 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
123 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
124 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
125 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
126 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
127 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
128 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
129 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
130 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
131 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
132 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
133 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
134 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
135 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
136 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
137 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
138 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
139 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
140 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
141 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
142 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
143 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
144 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
149 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
150 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
151 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
152 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
153 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
154 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
155 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
156 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
157 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
158 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
159 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
160 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
161 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
162 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
163 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
164 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
166 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
167 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
168 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
169 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
170 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
171 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
172 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
173 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
174 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.8
Metatranscriptomes 0.4
Isolates 0.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.2
Nodule 0
Rhizoplane 6
Rhizosphere 88.4
Stem 0
Stem Tuber 0
Unclassified 0.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10043811 3300001990 Bacteria 1369
2 SwRhRL2b_contig_1637713 2162886007 Bacteria 1666
3 Ga0065704_10124642 3300005289 Bacteria 1714
4 Ga0065707_10089816 3300005295 Bacteria 4274
5 Ga0070658_10007078 3300005327 Bacteria 9052
6 Ga0070658_10054086 3300005327 Bacteria 3259
7 Ga0070676_10066768 3300005328 Bacteria 2149
8 Ga0070690_100005864 3300005330 Bacteria 6925
9 Ga0070670_100001111 3300005331 Bacteria 21391
10 Ga0070670_100087945 3300005331 Bacteria 2670
11 Ga0070666_10005968 3300005335 Bacteria 7479
12 Ga0070666_10177531 3300005335 Bacteria 1493
13 Ga0068868_100022642 3300005338 Bacteria 4746
14 Ga0068868_100032708 3300005338 Bacteria 4003
15 Ga0070661_100362857 3300005344 Bacteria 1139
16 Ga0070668_100000008 3300005347 Bacteria 137948
17 Ga0070668_100001008 3300005347 Bacteria 19751
18 Ga0070669_100001001 3300005353 Bacteria 20581
19 Ga0070671_100000064 3300005355 Bacteria 72180
20 Ga0070671_100000226 3300005355 Bacteria 37590
21 Ga0070674_100005043 3300005356 Bacteria 7588
22 Ga0070673_100005229 3300005364 Bacteria 8285
23 Ga0070659_100178568 3300005366 Bacteria 1741
24 Ga0070667_100000003 3300005367 Bacteria 447715
25 Ga0070667_100000098 3300005367 Bacteria 108706
26 Ga0070667_100010223 3300005367 Bacteria 7753
27 Ga0070667_100040062 3300005367 Bacteria 3928
28 Ga0070667_100051938 3300005367 Bacteria 3457
29 Ga0070663_100105252 3300005455 Bacteria 2112
30 Ga0070663_100430851 3300005455 Bacteria 1083
31 Ga0070678_100004038 3300005456 Bacteria 8263
32 Ga0070662_100124477 3300005457 Bacteria 1979
33 Ga0068867_100000783 3300005459 Bacteria 21489
34 Ga0068867_100435740 3300005459 Bacteria 1113
35 Ga0068853_100105991 3300005539 Bacteria 2491
36 Ga0070672_100011910 3300005543 Bacteria 6080
37 Ga0070665_100001682 3300005548 Bacteria 25487
38 Ga0070665_100009718 3300005548 Bacteria 9723
39 Ga0070664_100070192 3300005564 Bacteria 2999
40 Ga0068857_100052108 3300005577 Bacteria 3631
41 Ga0068854_100266314 3300005578 Bacteria 1374
42 Ga0068852_100069008 3300005616 Bacteria 3096
43 Ga0068859_100014399 3300005617 Bacteria 7936
44 Ga0068859_100017808 3300005617 Bacteria 7141
45 Ga0068859_100019900 3300005617 Bacteria 6737
46 Ga0068864_100000767 3300005618 Bacteria 26986
47 Ga0068864_100039669 3300005618 Bacteria 4024
48 Ga0068866_10024144 3300005718 Bacteria 2838
49 Ga0068851_10052198 3300005834 Bacteria 2079
50 Ga0068863_100007845 3300005841 Bacteria 10438
51 Ga0068863_100013904 3300005841 Bacteria 7760
52 Ga0068863_100015872 3300005841 Bacteria 7224
53 Ga0068863_100127487 3300005841 Bacteria 2429
54 Ga0068858_100008633 3300005842 Bacteria 9786
55 Ga0068858_100055478 3300005842 Bacteria 3663
56 Ga0068858_100395886 3300005842 Bacteria 1327
57 Ga0068860_100000045 3300005843 Bacteria 223252
58 Ga0068860_100000105 3300005843 Bacteria 134520
59 Ga0068860_100000164 3300005843 Bacteria 108706
60 Ga0068860_100000848 3300005843 Bacteria 34178
61 Ga0068860_100026768 3300005843 Bacteria 5558
62 Ga0068862_100000148 3300005844 Bacteria 79789
63 Ga0068862_100000449 3300005844 Bacteria 44685
64 Ga0068862_100004592 3300005844 Bacteria 11634
65 Ga0068862_100058619 3300005844 Bacteria 3303
66 Ga0097621_100016409 3300006237 Bacteria 5599
67 Ga0068871_100001656 3300006358 Bacteria 14987
68 Ga0068865_100010461 3300006881 Bacteria 5775
69 Ga0097620_100014399 3300006931 Bacteria 7936
70 Ga0097620_100017807 3300006931 Bacteria 7141
71 Ga0097620_100019900 3300006931 Bacteria 6737
72 Ga0105240_10326718 3300009093 Bacteria 1747
73 Ga0105245_10274730 3300009098 Bacteria 1645
74 Ga0105247_10015533 3300009101 Bacteria 4559
75 Ga0105243_10478571 3300009148 Bacteria 1175
76 Ga0105242_10008858 3300009176 Bacteria 7724
77 Ga0105248_10033079 3300009177 Bacteria 5775
78 Ga0105248_10146923 3300009177 Bacteria 2660
79 Ga0105238_10013411 3300009551 Bacteria 8274
80 Ga0105249_10000056 3300009553 Bacteria 160443
81 Ga0157326_1000227 3300012513 Bacteria 6475
82 Ga0157371_10064815 3300013102 Bacteria 2588
83 Ga0157371_10257928 3300013102 Bacteria 1256
84 Ga0157369_10055039 3300013105 Bacteria 4295
85 Ga0157374_10014592 3300013296 Bacteria 6877
86 Ga0157378_10031208 3300013297 Bacteria 4706
87 Ga0157378_10413426 3300013297 Bacteria 1332
88 Ga0163162_10026090 3300013306 Bacteria 5775
89 Ga0157372_10234014 3300013307 Bacteria 2130
90 Ga0157375_10015863 3300013308 Bacteria 6751
91 Ga0157375_10057787 3300013308 Bacteria 3836
92 Ga0163163_10071386 3300014325 Bacteria 3460
93 Ga0157380_10000333 3300014326 Bacteria 28335
94 Ga0157380_10451749 3300014326 Bacteria 1234
95 Ga0157377_10318152 3300014745 Bacteria 1033
96 Ga0157379_10013401 3300014968 Bacteria 7181
97 Ga0157376_10007441 3300014969 Bacteria 7819
98 Ga0207656_10029515 3300025321 Bacteria 2259
99 Ga0207713_1001913 3300025735 Bacteria 15769
100 Ga0207642_10077003 3300025899 Bacteria 1607
101 Ga0207710_10055494 3300025900 Bacteria 1786
102 Ga0207680_10050278 3300025903 Bacteria 2486
103 Ga0207645_10002803 3300025907 Bacteria 13547
104 Ga0207705_10007899 3300025909 Bacteria 7810
105 Ga0207705_10440139 3300025909 Bacteria 1010
106 Ga0207657_10068922 3300025919 Bacteria 3004
107 Ga0207657_10129277 3300025919 Bacteria 2072
108 Ga0207681_10001386 3300025923 Bacteria 15659
109 Ga0207650_10002404 3300025925 Bacteria 13042
110 Ga0207659_10032467 3300025926 Bacteria 3584
111 Ga0207687_10010841 3300025927 Bacteria 5958
112 Ga0207687_10021041 3300025927 Bacteria 4330
113 Ga0207644_10000078 3300025931 Bacteria 72212
114 Ga0207644_10004397 3300025931 Bacteria 9141
115 Ga0207690_10056665 3300025932 Bacteria 2644
116 Ga0207706_10007986 3300025933 Bacteria 9772
117 Ga0207686_10200974 3300025934 Bacteria 1427
118 Ga0207669_10004522 3300025937 Bacteria 6133
119 Ga0207704_10067024 3300025938 Bacteria 2256
120 Ga0207691_10011851 3300025940 Bacteria 8368
121 Ga0207711_10005036 3300025941 Bacteria 11206
122 Ga0207651_10000582 3300025960 Bacteria 15346
123 Ga0207712_10000015 3300025961 Bacteria 346689
124 Ga0207668_10000099 3300025972 Bacteria 61386
125 Ga0207668_10002931 3300025972 Bacteria 10012
126 Ga0207640_10025043 3300025981 Bacteria 3607
127 Ga0207640_10040985 3300025981 Bacteria 2942
128 Ga0207658_10000002 3300025986 Bacteria 1364188
129 Ga0207658_10000196 3300025986 Bacteria 63933
130 Ga0207658_10001896 3300025986 Bacteria 15652
131 Ga0207658_10006357 3300025986 Bacteria 8068
132 Ga0207658_10059016 3300025986 Bacteria 2857
133 Ga0207677_10004114 3300026023 Bacteria 7783
134 Ga0207677_10017753 3300026023 Bacteria 4252
135 Ga0207703_10000587 3300026035 Bacteria 37079
136 Ga0207678_10247726 3300026067 Bacteria 1526
137 Ga0207641_10000583 3300026088 Bacteria 40220
138 Ga0207641_10002981 3300026088 Bacteria 15313
139 Ga0207641_10005235 3300026088 Bacteria 11094
140 Ga0207641_10007060 3300026088 Bacteria 9381
141 Ga0207641_10009194 3300026088 Bacteria 8154
142 Ga0207648_10001433 3300026089 Bacteria 26248
143 Ga0207676_10002397 3300026095 Bacteria 13369
144 Ga0207676_10015996 3300026095 Bacteria 5428
145 Ga0207676_10046050 3300026095 Bacteria 3373
146 Ga0207674_10046281 3300026116 Bacteria 4468
147 Ga0207675_100043509 3300026118 Bacteria 4193
148 Ga0207683_10007160 3300026121 Bacteria 9565
149 Ga0268266_10001672 3300028379 Bacteria 25547
150 Ga0268266_10008151 3300028379 Bacteria 9354
151 Ga0268265_10000168 3300028380 Bacteria 79798
152 Ga0268265_10000684 3300028380 Bacteria 33416
153 Ga0268265_10002159 3300028380 Bacteria 15228
154 Ga0268265_10006285 3300028380 Bacteria 8043
155 Ga0268264_10000067 3300028381 Bacteria 284445
156 Ga0268264_10000101 3300028381 Bacteria 225109
157 Ga0268264_10000228 3300028381 Bacteria 108722
158 Ga0268264_10013788 3300028381 Bacteria 6647
159 Ga0268264_10018533 3300028381 Bacteria 5694
160 Ga0307408_100099609 3300031548 Bacteria 2212
161 Ga0307405_10156461 3300031731 Bacteria 1609
162 Ga0307413_10113262 3300031824 Bacteria 1820
163 Ga0307410_10017906 3300031852 Bacteria 4267
164 Ga0307407_10063216 3300031903 Bacteria 2171
165 Ga0307412_10001509 3300031911 Bacteria 12928
166 Ga0307412_10015940 3300031911 Bacteria 4465
167 Ga0307412_10150255 3300031911 Bacteria 1718
168 Ga0307409_100027986 3300031995 Bacteria 4006
169 Ga0307409_100397486 3300031995 Bacteria 1315
170 Ga0307416_100247866 3300032002 Bacteria 1731
171 Ga0307414_10015779 3300032004 Bacteria 4571
172 Ga0307414_10024536 3300032004 Bacteria 3847
173 Ga0307411_10432351 3300032005 Bacteria 1096
174 Ga0307415_100411540 3300032126 Bacteria 1157
175 Ga0316584_0058778 3300036712 Bacteria 2879
176 Ga0395905_0206422 3300037471 Unclassified 1841
177 Ga0495596_0000602 3300046500 Bacteria 22596
178 Ga0495616_0062628 3300046513 Bacteria 1821
179 Ga0495620_0037911 3300046515 Bacteria 2143
180 Ga0495643_0007402 3300046522 Bacteria 7087
181 Ga0495663_0006147 3300046525 Bacteria 3319
182 Ga0495654_0006107 3300046530 Bacteria 6901
183 Ga0495609_0002036 3300046538 Bacteria 12747
184 Ga0495621_0014981 3300046539 Bacteria 2465
185 Ga0495668_0010959 3300046616 Bacteria 5457
186 Ga0495668_0022399 3300046616 Bacteria 3612
187 Ga0495668_0053891 3300046616 Bacteria 2223
188 Ga0495625_0010487 3300046660 Bacteria 7663
189 Ga0495669_0007024 3300046684 Bacteria 4713
190 Ga0495669_0048177 3300046684 Bacteria 1905
191 Ga0496100_0004138 3300048903 Bacteria 7650
192 Ga0496100_0189822 3300048903 Bacteria 1491
193 Ga0496101_0004072 3300048904 Bacteria 9142
194 Ga0496103_0023817 3300048906 Bacteria 3693
195 Ga0496104_0027679 3300048907 Bacteria 5249
196 Ga0496105_0001976 3300048908 Bacteria 14753
197 Ga0496105_0098368 3300048908 Bacteria 2416
198 Ga0496107_0004353 3300048910 Bacteria 9588
199 Ga0496108_0000302 3300048911 Bacteria 42284
200 Ga0496108_0009504 3300048911 Bacteria 7874
201 Ga0496109_0012109 3300048912 Bacteria 7436
202 Ga0496110_0003782 3300048913 Bacteria 11655
203 Ga0496111_0003244 3300048914 Bacteria 10043
204 Ga0496112_0015410 3300048915 Bacteria 7133
205 Ga0496113_0003091 3300048916 Bacteria 9887
206 Ga0496117_0132902 3300048920 Bacteria 1505
207 Ga0496120_0178675 3300048923 Bacteria 1044
208 Ga0496121_0003516 3300048924 Bacteria 22258
209 Ga0496125_0007282 3300048928 Bacteria 11783
210 Ga0496126_0214704 3300048929 Bacteria 1618
211 Ga0501292_000034 3300049515 Bacteria 33996
212 Ga0501293_004090 3300049516 Bacteria 1143
213 Ga0501294_002826 3300049517 Bacteria 1642
214 Ga0501314_000885 3300049530 Bacteria 2013
215 Ga0501034_0010175 3300049571 Bacteria 9812
216 Ga0501046_0178207 3300049580 Bacteria 1591
217 Ga0501047_0001284 3300049581 Bacteria 24820
218 Ga0501067_0032998 3300049583 Bacteria 2874
219 Ga0501207_018510 3300049654 Bacteria 1096
220 Ga0501222_005650 3300049662 Bacteria 1683
221 Ga0501223_000317 3300049663 Bacteria 12000
222 Ga0501223_003836 3300049663 Bacteria 3247
223 Ga0501224_000076 3300049664 Bacteria 10275
224 Ga0501224_002866 3300049664 Bacteria 2376
225 Ga0501224_003436 3300049664 Bacteria 2209
226 Ga0501233_001645 3300049668 Bacteria 3843
227 Ga0501233_018868 3300049668 Bacteria 1455
228 Ga0501235_015024 3300049669 Bacteria 1707
229 Ga0501235_016986 3300049669 Bacteria 1609
230 Ga0501249_002090 3300049679 Bacteria 4068
231 Ga0501261_000132 3300049690 Bacteria 11098
232 Ga0501225_0001994 3300049705 Bacteria 6378
233 Ga0501234_000123 3300049707 Bacteria 10106
234 Ga0501268_006507 3300049765 Bacteria 1718
235 Ga0501279_000016 3300049775 Bacteria 64067
236 Ga0501280_000065 3300049776 Bacteria 30324
237 Ga0501281_00062 3300049777 Bacteria 12527
238 Ga0501282_000508 3300049778 Bacteria 4601
239 Ga0501044_0104054 3300049823 Bacteria 2853
240 Ga0501226_000183 3300049853 Bacteria 10218
241 nmdc:mga0k408_177187_c1 3300050493 Bacteria 1271
242 Ga0500643_000229 3300053087 Bacteria 52057
243 Ga0500592_001102 3300053116 Bacteria 4410
244 Ga0500588_0011484 3300053146 Bacteria 2169
245 Ga0500604_0061778 3300053151 Bacteria 1178
246 Ga0500622_0000046 3300053156 Bacteria 157615
247 Ga0500627_0000081 3300053158 Bacteria 34802
248 Ga0500627_0000784 3300053158 Bacteria 8467
249 2644038123 2643221605 Bacteria 4772303
250 2919139719 2919138771 Bacteria 5281312
251 JGI24737J22298_10043811
252 SwRhRL2b_contig_1637713
253 Ga0065704_10124642
254 Ga0065707_10089816
255 Ga0070658_10007078
256 Ga0070658_10054086
257 Ga0070676_10066768
258 Ga0070690_100005864
259 Ga0070670_100001111
260 Ga0070670_100087945
261 Ga0070666_10005968
262 Ga0070666_10177531
263 Ga0068868_100022642
264 Ga0068868_100032708
265 Ga0070661_100362857
266 Ga0070668_100000008
267 Ga0070668_100001008
268 Ga0070669_100001001
269 Ga0070671_100000064
270 Ga0070671_100000226
271 Ga0070674_100005043
272 Ga0070673_100005229
273 Ga0070659_100178568
274 Ga0070667_100000003
275 Ga0070667_100000098
276 Ga0070667_100010223
277 Ga0070667_100040062
278 Ga0070667_100051938
279 Ga0070663_100105252
280 Ga0070663_100430851
281 Ga0070678_100004038
282 Ga0070662_100124477
283 Ga0068867_100000783
284 Ga0068867_100435740
285 Ga0068853_100105991
286 Ga0070672_100011910
287 Ga0070665_100001682
288 Ga0070665_100009718
289 Ga0070664_100070192
290 Ga0068857_100052108
291 Ga0068854_100266314
292 Ga0068852_100069008
293 Ga0068859_100014399
294 Ga0068859_100017808
295 Ga0068859_100019900
296 Ga0068864_100000767
297 Ga0068864_100039669
298 Ga0068866_10024144
299 Ga0068851_10052198
300 Ga0068863_100007845
301 Ga0068863_100013904
302 Ga0068863_100015872
303 Ga0068863_100127487
304 Ga0068858_100008633
305 Ga0068858_100055478
306 Ga0068858_100395886
307 Ga0068860_100000045
308 Ga0068860_100000105
309 Ga0068860_100000164
310 Ga0068860_100000848
311 Ga0068860_100026768
312 Ga0068862_100000148
313 Ga0068862_100000449
314 Ga0068862_100004592
315 Ga0068862_100058619
316 Ga0097621_100016409
317 Ga0068871_100001656
318 Ga0068865_100010461
319 Ga0097620_100014399
320 Ga0097620_100017807
321 Ga0097620_100019900
322 Ga0105240_10326718
323 Ga0105245_10274730
324 Ga0105247_10015533
325 Ga0105243_10478571
326 Ga0105242_10008858
327 Ga0105248_10033079
328 Ga0105248_10146923
329 Ga0105238_10013411
330 Ga0105249_10000056
331 Ga0157326_1000227
332 Ga0157371_10064815
333 Ga0157371_10257928
334 Ga0157369_10055039
335 Ga0157374_10014592
336 Ga0157378_10031208
337 Ga0157378_10413426
338 Ga0163162_10026090
339 Ga0157372_10234014
340 Ga0157375_10015863
341 Ga0157375_10057787
342 Ga0163163_10071386
343 Ga0157380_10000333
344 Ga0157380_10451749
345 Ga0157377_10318152
346 Ga0157379_10013401
347 Ga0157376_10007441
348 Ga0207656_10029515
349 Ga0207713_1001913
350 Ga0207642_10077003
351 Ga0207710_10055494
352 Ga0207680_10050278
353 Ga0207645_10002803
354 Ga0207705_10007899
355 Ga0207705_10440139
356 Ga0207657_10068922
357 Ga0207657_10129277
358 Ga0207681_10001386
359 Ga0207650_10002404
360 Ga0207659_10032467
361 Ga0207687_10010841
362 Ga0207687_10021041
363 Ga0207644_10000078
364 Ga0207644_10004397
365 Ga0207690_10056665
366 Ga0207706_10007986
367 Ga0207686_10200974
368 Ga0207669_10004522
369 Ga0207704_10067024
370 Ga0207691_10011851
371 Ga0207711_10005036
372 Ga0207651_10000582
373 Ga0207712_10000015
374 Ga0207668_10000099
375 Ga0207668_10002931
376 Ga0207640_10025043
377 Ga0207640_10040985
378 Ga0207658_10000002
379 Ga0207658_10000196
380 Ga0207658_10001896
381 Ga0207658_10006357
382 Ga0207658_10059016
383 Ga0207677_10004114
384 Ga0207677_10017753
385 Ga0207703_10000587
386 Ga0207678_10247726
387 Ga0207641_10000583
388 Ga0207641_10002981
389 Ga0207641_10005235
390 Ga0207641_10007060
391 Ga0207641_10009194
392 Ga0207648_10001433
393 Ga0207676_10002397
394 Ga0207676_10015996
395 Ga0207676_10046050
396 Ga0207674_10046281
397 Ga0207675_100043509
398 Ga0207683_10007160
399 Ga0268266_10001672
400 Ga0268266_10008151
401 Ga0268265_10000168
402 Ga0268265_10000684
403 Ga0268265_10002159
404 Ga0268265_10006285
405 Ga0268264_10000067
406 Ga0268264_10000101
407 Ga0268264_10000228
408 Ga0268264_10013788
409 Ga0268264_10018533
410 Ga0307408_100099609
411 Ga0307405_10156461
412 Ga0307413_10113262
413 Ga0307410_10017906
414 Ga0307407_10063216
415 Ga0307412_10001509
416 Ga0307412_10015940
417 Ga0307412_10150255
418 Ga0307409_100027986
419 Ga0307409_100397486
420 Ga0307416_100247866
421 Ga0307414_10015779
422 Ga0307414_10024536
423 Ga0307411_10432351
424 Ga0307415_100411540
425 Ga0316584_0058778
426 Ga0395905_0206422
427 Ga0495596_0000602
428 Ga0495616_0062628
429 Ga0495620_0037911
430 Ga0495643_0007402
431 Ga0495663_0006147
432 Ga0495654_0006107
433 Ga0495609_0002036
434 Ga0495621_0014981
435 Ga0495668_0010959
436 Ga0495668_0022399
437 Ga0495668_0053891
438 Ga0495625_0010487
439 Ga0495669_0007024
440 Ga0495669_0048177
441 Ga0496100_0004138
442 Ga0496100_0189822
443 Ga0496101_0004072
444 Ga0496103_0023817
445 Ga0496104_0027679
446 Ga0496105_0001976
447 Ga0496105_0098368
448 Ga0496107_0004353
449 Ga0496108_0000302
450 Ga0496108_0009504
451 Ga0496109_0012109
452 Ga0496110_0003782
453 Ga0496111_0003244
454 Ga0496112_0015410
455 Ga0496113_0003091
456 Ga0496117_0132902
457 Ga0496120_0178675
458 Ga0496121_0003516
459 Ga0496125_0007282
460 Ga0496126_0214704
461 Ga0501292_000034
462 Ga0501293_004090
463 Ga0501294_002826
464 Ga0501314_000885
465 Ga0501034_0010175
466 Ga0501046_0178207
467 Ga0501047_0001284
468 Ga0501067_0032998
469 Ga0501207_018510
470 Ga0501222_005650
471 Ga0501223_000317
472 Ga0501223_003836
473 Ga0501224_000076
474 Ga0501224_002866
475 Ga0501224_003436
476 Ga0501233_001645
477 Ga0501233_018868
478 Ga0501235_015024
479 Ga0501235_016986
480 Ga0501249_002090
481 Ga0501261_000132
482 Ga0501225_0001994
483 Ga0501234_000123
484 Ga0501268_006507
485 Ga0501279_000016
486 Ga0501280_000065
487 Ga0501281_00062
488 Ga0501282_000508
489 Ga0501044_0104054
490 Ga0501226_000183
491 nmdc:mga0k408_177187_c1
492 Ga0500643_000229
493 Ga0500592_001102
494 Ga0500588_0011484
495 Ga0500604_0061778
496 Ga0500622_0000046
497 Ga0500627_0000081
498 Ga0500627_0000784
499 2644038123
500 2919139719

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01061

ABC2_membrane

ABC-2 type transporter

29

247

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ce1-assembly1.cif.gz_B cytochrome c maturation complex ccmabcd 0.6147 35 272
8ce1-assembly1.cif.gz_B cytochrome c maturation complex ccmabcd 0.6079 35 272
7o16-assembly1.cif.gz_D abc transporter nosdfy, nucleotide-free in lipid nanodisc, r-domain 3 0.5739 57 269
7o17-assembly1.cif.gz_D abc transporter nosdfy e154q, atp-bound in lipid nanodisc 0.5733 35 269
7o0z-assembly1.cif.gz_D abc transporter nosfy, nucleotide-free in gdn 0.5645 57 265
ID Description Score Start End Superfamily
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6578 86 263 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.5994 61 263 3.40.1710.10
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.5538 63 262 3.40.1710.10
af_Q8LKW0_1089_1247_1.10.357.90 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;Telomerase reverse transcriptase (TERT), thumb domain 0.5243 93 213 1.10.357.90
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.4604 61 263 3.40.1710.10
ID Description Score Start End GO Terms
AF-A0A2N3ATC0-F1-model_v4 Multidrug ABC transporter permease 0.8532 90 275 GO:0005886
GO:0140359
AF-A0A352S250-F1-model_v4 Metal-dependent hydrolase 0.844 57 227 GO:0016787
GO:0043190
GO:0140359
AF-A0A2V8GE45-F1-model_v4 ABC transporter permease 0.8337 84 217 GO:0005886
GO:0140359
AF-A8V4C4-F1-model_v4 ABC-2 0.8185 89 217 GO:0005886
GO:0140359
AF-A0A7V9C743-F1-model_v4 Transport permease protein 0.7939 53 269 GO:0043190
GO:0140359

Map