F361995

General Info

Members Datasets Scaffolds Average Seq Length
250 179 500 244

Family's Representative Sequence

Representative Sequence 3300053730|Ga0500645_003721|Ga0500645_003721_3620_4441
Length 273
Sequence VRNTEQAGSSKEIGRDVGILDNFEKGLERAVNGAFAKTFRSGLQPVEISSALKRELDTKAAVVSRDRILVPNSFRVLLAPSDYQRMTGIGQTLLDDLNQIVVQHAAQQGFQFAGPVTIDLVNDTKLTTGVIQIDSSNEQGNVSWVPVLDVAGKRHPITKSRTIIGRGSDADITIDDTGTSRKHVEILWDGTHAQARDLGSTNGSKLNGQTFQRANIEPDSVIQIGRTNIVFRVVAQSKPAARGYADSRGGAPTTRMPSHDPDRPPLDPGGFWR

Samples

Sample ID Description Type Environment
1 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
9 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
10 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
11 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
12 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
13 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
14 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
15 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
21 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
22 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
23 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
24 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
25 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
26 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
27 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
28 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
31 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
32 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
33 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
34 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
35 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
36 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
37 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
38 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
46 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
47 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
49 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
52 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
63 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
64 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
65 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
66 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
67 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
68 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
69 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
70 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
71 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
72 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
73 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
74 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
75 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
76 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
77 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
78 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
79 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
80 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
81 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
82 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
83 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
84 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
85 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
86 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
87 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
88 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
89 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
90 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
91 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
92 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
93 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
94 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
95 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
96 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
97 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
98 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
99 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
100 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
101 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
102 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
103 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
104 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
105 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
106 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
107 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
108 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
109 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
110 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
111 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
112 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
113 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
114 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
115 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
116 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
130 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
131 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
132 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
133 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
136 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
137 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
138 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
139 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
140 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
141 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
142 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
143 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
144 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
145 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
146 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
147 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
148 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
149 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
150 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
151 2643221566 Microbacterium sp. Root166 Isolate Unclassified
152 2643221572 Leifsonia sp. Root60 Isolate Unclassified
153 2643221597 Microbacterium sp. Root180 Isolate Unclassified
154 2643221616 Leifsonia sp. Root227 Isolate Unclassified
155 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
156 2643221649 Leifsonia sp. Root4 Isolate Unclassified
157 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
158 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
159 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
160 2808606372 Agromyces sp. 23-23 Isolate Unclassified
161 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
162 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
163 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
164 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
165 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
166 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
167 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
168 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
169 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
170 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
171 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
172 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
173 2928153084 Leifsonia sp. 563 Isolate Unclassified
174 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
175 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
176 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
177 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere
178 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
179 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.6
Metatranscriptomes 2
Isolates 12.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.4
Nodule 0
Rhizoplane 8.8
Rhizosphere 53.2
Stem 0
Stem Tuber 0.4
Unclassified 0.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500645_003721 3300053730 Bacteria 6079
2 JGI24740J21852_10051688 3300001979 Bacteria 1174
3 JGI24739J22299_10066713 3300001989 Bacteria 1126
4 JGI24737J22298_10006176 3300001990 Bacteria 4101
5 JGI24735J21928_10003573 3300002067 Bacteria 5285
6 JGI25165J46597_1000005 3300003214 Bacteria 623702
7 rootH1_10055620 3300003323 Bacteria 1323
8 Ga0006562J51391_1022457 3300003578 Bacteria 12640
9 Ga0006562J51391_1022459 3300003578 Bacteria 5280
10 Ga0055539_1000060 3300003752 Bacteria 146006
11 Ga0055533_1000002 3300003756 Bacteria 1196393
12 Ga0055525_1000683 3300003759 Bacteria 12751
13 Ga0055527_1000004 3300003760 Bacteria 570634
14 Ga0055542_1000019 3300003762 Bacteria 341174
15 Ga0055529_1000008 3300003763 Bacteria 394786
16 Ga0065714_10087711 3300005288 Bacteria 2046
17 Ga0070658_10119350 3300005327 Bacteria 2191
18 Ga0070658_10345960 3300005327 Bacteria 1272
19 Ga0070661_100473038 3300005344 Bacteria 1000
20 Ga0070668_100065061 3300005347 Bacteria 2828
21 Ga0070662_100255541 3300005457 Bacteria 1410
22 Ga0070702_100332314 3300005615 Bacteria 1063
23 Ga0068861_100057074 3300005719 Bacteria 2982
24 Ga0075365_10003305 3300006038 Bacteria 8275
25 Ga0075365_10003606 3300006038 Bacteria 8015
26 Ga0075363_100144267 3300006048 Bacteria 1342
27 Ga0075364_10002885 3300006051 Bacteria 9691
28 Ga0075364_10004873 3300006051 Bacteria 7773
29 Ga0075367_10043674 3300006178 Bacteria 2625
30 Ga0075369_10007538 3300006186 Bacteria 4151
31 Ga0075369_10018257 3300006186 Bacteria 2854
32 Ga0075370_10007096 3300006353 Bacteria 5688
33 Ga0105244_10013921 3300009036 Bacteria 4674
34 Ga0105244_10162263 3300009036 Bacteria 1067
35 Ga0111539_10180902 3300009094 Bacteria 2462
36 Ga0105249_10080735 3300009553 Bacteria 3022
37 Ga0157370_10051914 3300013104 Bacteria 3915
38 Ga0157369_10000615 3300013105 Bacteria 46292
39 Ga0157369_10006070 3300013105 Bacteria 14021
40 Ga0157369_10019835 3300013105 Bacteria 7523
41 Ga0157369_10047907 3300013105 Bacteria 4639
42 Ga0157369_10343688 3300013105 Bacteria 1550
43 Ga0157369_10402365 3300013105 Bacteria 1420
44 Ga0171462_1005 3300013250 Bacteria 598379
45 Ga0157372_10182723 3300013307 Bacteria 2428
46 Ga0163163_10464893 3300014325 Bacteria 1325
47 Ga0157380_10036744 3300014326 Bacteria 3792
48 Ga0157377_10104477 3300014745 Bacteria 1694
49 Ga0206354_11240761 3300020081 Bacteria 1958
50 Ga0206353_10448527 3300020082 Bacteria 3238
51 Ga0209566_100013 3300025225 Bacteria 474033
52 Ga0209674_100001 3300025226 Bacteria 4013750
53 Ga0209672_100011 3300025228 Bacteria 856297
54 Ga0209147_100367 3300025229 Bacteria 32060
55 Ga0209563_100001 3300025230 Bacteria 4013775
56 Ga0209563_100158 3300025230 Bacteria 60951
57 Ga0207427_100024 3300025231 Bacteria 438403
58 Ga0209437_100243 3300025233 Bacteria 88712
59 Ga0209258_101652 3300025242 Bacteria 7171
60 Ga0209646_1022353 3300025246 Bacteria 902
61 Ga0209677_100001 3300025253 Bacteria 4013787
62 Ga0209677_100247 3300025253 Bacteria 37002
63 Ga0209148_1000023 3300025254 Bacteria 680511
64 Ga0209233_1000001 3300025261 Bacteria 2992747
65 Ga0209455_1000023 3300025272 Bacteria 680449
66 Ga0207647_10197550 3300025904 Bacteria 1164
67 Ga0207705_10041524 3300025909 Bacteria 3300
68 Ga0207681_10500039 3300025923 Bacteria 995
69 Ga0207659_10227423 3300025926 Bacteria 1503
70 Ga0207709_10022437 3300025935 Bacteria 3582
71 Ga0207668_10130802 3300025972 Bacteria 1916
72 Ga0207678_10670244 3300026067 Bacteria 912
73 Ga0207675_100159744 3300026118 Bacteria 2149
74 Ga0207683_10167311 3300026121 Bacteria 1990
75 Ga0207428_10420248 3300027907 Bacteria 977
76 Ga0307413_10300908 3300031824 Bacteria 1216
77 Ga0307406_10044967 3300031901 Bacteria 2769
78 Ga0307406_10059348 3300031901 Bacteria 2462
79 Ga0307406_10141828 3300031901 Bacteria 1702
80 Ga0307412_10145355 3300031911 Bacteria 1742
81 Ga0307409_100096421 3300031995 Bacteria 2440
82 Ga0307409_100401222 3300031995 Bacteria 1310
83 Ga0307416_100431297 3300032002 Bacteria 1365
84 Ga0307416_100892538 3300032002 Bacteria 989
85 Ga0307414_10108821 3300032004 Bacteria 2104
86 Ga0307411_10075980 3300032005 Bacteria 2295
87 Ga0307415_100047537 3300032126 Bacteria 2889
88 Ga0307415_100158637 3300032126 Bacteria 1751
89 Ga0395899_0011857 3300037312 Bacteria 6673
90 Ga0395900_0007175 3300037418 Bacteria 11550
91 Ga0395900_0148087 3300037418 Bacteria 2400
92 Ga0395900_0150223 3300037418 Bacteria 2380
93 Ga0395898_0000355 3300037466 Bacteria 101003
94 Ga0395898_0048379 3300037466 Bacteria 4171
95 Ga0395901_0047268 3300038443 Bacteria 4469
96 Ga0395901_0113066 3300038443 Bacteria 2851
97 Ga0439465_0039114 3300041413 Bacteria 1530
98 Ga0439451_017664 3300042009 Bacteria 1439
99 Ga0450907_028355 3300042146 Bacteria 950
100 Ga0466972_0117123 3300044658 Bacteria 1257
101 Ga0466965_0039021 3300044683 Bacteria 2333
102 Ga0466965_0092287 3300044683 Bacteria 1541
103 Ga0466965_0101166 3300044683 Bacteria 1474
104 Ga0466965_0314188 3300044683 Bacteria 852
105 Ga0466961_0075667 3300044693 Bacteria 2134
106 Ga0466961_0449082 3300044693 Bacteria 780
107 Ga0466968_0083064 3300044735 Bacteria 1410
108 Ga0466970_0022397 3300044765 Bacteria 3297
109 Ga0466970_0057183 3300044765 Bacteria 2085
110 Ga0466970_0175168 3300044765 Bacteria 1189
111 Ga0466960_0171858 3300044901 Bacteria 1170
112 Ga0466960_0203229 3300044901 Bacteria 1083
113 Ga0466959_0093591 3300045049 Bacteria 2156
114 Ga0466959_0143126 3300045049 Bacteria 1688
115 Ga0466958_0262653 3300045836 Bacteria 1105
116 Ga0466967_0400291 3300045976 Bacteria 1336
117 Ga0466967_0440484 3300045976 Bacteria 1272
118 Ga0495620_0137789 3300046515 Bacteria 955
119 Ga0495645_0025853 3300046543 Bacteria 4262
120 Ga0495633_0191614 3300046558 Bacteria 940
121 Ga0495656_0107677 3300046615 Bacteria 1299
122 Ga0495625_0351440 3300046660 Bacteria 932
123 Ga0496100_0048907 3300048903 Bacteria 2731
124 Ga0496101_0041787 3300048904 Bacteria 3271
125 Ga0496102_0093519 3300048905 Bacteria 2785
126 Ga0496102_0104548 3300048905 Bacteria 2634
127 Ga0496102_0535000 3300048905 Bacteria 1094
128 Ga0496103_0077309 3300048906 Bacteria 2089
129 Ga0496104_0020241 3300048907 Bacteria 6097
130 Ga0496105_0009689 3300048908 Bacteria 7541
131 Ga0496105_0213605 3300048908 Bacteria 1572
132 Ga0496107_0046697 3300048910 Bacteria 3117
133 Ga0496108_0139200 3300048911 Bacteria 2091
134 Ga0496109_0276038 3300048912 Bacteria 1584
135 Ga0496110_0093337 3300048913 Bacteria 2694
136 Ga0496110_0121258 3300048913 Bacteria 2356
137 Ga0496111_0355000 3300048914 Bacteria 1085
138 Ga0496113_0049998 3300048916 Bacteria 3115
139 Ga0496113_0076370 3300048916 Bacteria 2559
140 Ga0496114_0059436 3300048917 Bacteria 3193
141 Ga0496114_0085821 3300048917 Bacteria 2666
142 Ga0496114_0158039 3300048917 Bacteria 1969
143 Ga0496115_0022642 3300048918 Bacteria 4870
144 Ga0496115_0270038 3300048918 Bacteria 1397
145 Ga0496116_0080715 3300048919 Bacteria 2019
146 Ga0496117_0000239 3300048920 Bacteria 104054
147 Ga0496117_0000856 3300048920 Bacteria 47069
148 Ga0496117_0005437 3300048920 Bacteria 13377
149 Ga0496117_0034296 3300048920 Bacteria 3825
150 Ga0496118_0002061 3300048921 Bacteria 28314
151 Ga0496118_0009674 3300048921 Bacteria 9688
152 Ga0496118_0029298 3300048921 Bacteria 4620
153 Ga0496118_0193135 3300048921 Bacteria 1215
154 Ga0496119_0000988 3300048922 Bacteria 36561
155 Ga0496119_0002623 3300048922 Bacteria 19519
156 Ga0496119_0020923 3300048922 Bacteria 4746
157 Ga0496119_0045654 3300048922 Bacteria 2744
158 Ga0496120_0006377 3300048923 Bacteria 9070
159 Ga0496121_0069481 3300048924 Bacteria 2842
160 Ga0496122_0000270 3300048925 Bacteria 116104
161 Ga0496122_0000760 3300048925 Bacteria 62340
162 Ga0496122_0005910 3300048925 Bacteria 14332
163 Ga0496123_0000036 3300048926 Bacteria 265722
164 Ga0496123_0001441 3300048926 Bacteria 33143
165 Ga0496123_0013505 3300048926 Bacteria 6846
166 Ga0496124_0003035 3300048927 Bacteria 20982
167 Ga0496126_0031148 3300048929 Bacteria 5044
168 Ga0501310_009052 3300049130 Bacteria 1091
169 Ga0501031_0010026 3300049568 Bacteria 6170
170 Ga0501032_0076257 3300049569 Bacteria 2232
171 Ga0501033_0010903 3300049570 Bacteria 6967
172 Ga0501033_0020231 3300049570 Bacteria 5031
173 Ga0501034_0430385 3300049571 Bacteria 1239
174 Ga0501036_0066597 3300049572 Bacteria 3047
175 Ga0501037_0065840 3300049573 Bacteria 2639
176 Ga0501037_0326382 3300049573 Bacteria 1062
177 Ga0501038_0124309 3300049574 Bacteria 2124
178 Ga0501039_0014066 3300049575 Bacteria 6125
179 Ga0501039_0219665 3300049575 Bacteria 1494
180 Ga0501043_0009374 3300049579 Bacteria 7689
181 Ga0501043_0165404 3300049579 Bacteria 1727
182 Ga0501046_0006161 3300049580 Bacteria 10653
183 Ga0501047_0046084 3300049581 Bacteria 4214
184 Ga0501047_0360612 3300049581 Bacteria 1289
185 Ga0501048_0019985 3300049582 Bacteria 4911
186 Ga0501069_0190895 3300049585 Bacteria 1185
187 Ga0501070_0000269 3300049586 Bacteria 49060
188 Ga0501070_0314544 3300049586 Bacteria 1274
189 Ga0501073_0104357 3300049589 Bacteria 1967
190 Ga0501074_0048142 3300049590 Bacteria 3079
191 Ga0501035_0018913 3300049822 Bacteria 6346
192 Ga0501035_0250834 3300049822 Bacteria 1503
193 Ga0501035_0388707 3300049822 Bacteria 1162
194 Ga0501044_0030594 3300049823 Bacteria 5672
195 Ga0501044_0093677 3300049823 Bacteria 3028
196 Ga0501044_0176464 3300049823 Bacteria 2105
197 Ga0501045_0051854 3300049824 Bacteria 2994
198 nmdc:mga00v17_66309_c1 3300050491 Bacteria 2229
199 nmdc:mga00v17_7787_c1 3300050491 Bacteria 5740
200 nmdc:mga0yw44_6035_c1 3300050492 Bacteria 5804
201 nmdc:mga0yw44_636_c1 3300050492 Bacteria 12761
202 nmdc:mga0sz30_14232_c2 3300050516 Bacteria 2508
203 nmdc:mga0sz30_18382_c1 3300050516 Bacteria 2796
204 Ga0500635_0000066 3300053080 Bacteria 69274
205 Ga0500643_000176 3300053087 Bacteria 63098
206 Ga0500650_0001109 3300053098 Bacteria 7782
207 Ga0500556_0000008 3300053104 Bacteria 304943
208 Ga0500568_0000003 3300053139 Bacteria 863587
209 Ga0500573_0016936 3300053140 Bacteria 4143
210 Ga0500573_0106491 3300053140 Bacteria 1573
211 Ga0500573_0139913 3300053140 Bacteria 1334
212 Ga0500573_0154783 3300053140 Bacteria 1252
213 Ga0500573_0186905 3300053140 Bacteria 1109
214 Ga0500573_0240821 3300053140 Unclassified 938
215 Ga0500577_0061843 3300053142 Bacteria 1442
216 Ga0500616_0000010 3300053153 Bacteria 761410
217 Ga0500616_0007317 3300053153 Bacteria 7036
218 Ga0501084_0182273 3300054114 Bacteria 1773
219 Ga0466962_0134662 3300061719 Bacteria 1195
220 2587862013 2585428094 Bacteria 3604039
221 2588107557 2585428157 Bacteria 3018951
222 2643847382 2643221566 Bacteria 3460379
223 2643877177 2643221572 Bacteria 3614809
224 2643997372 2643221597 Bacteria 3347721
225 2644097370 2643221616 Bacteria 4066575
226 2644181806 2643221632 Bacteria 3406696
227 2644280131 2643221649 Bacteria 3867359
228 2644384232 2643221669 Bacteria 3611286
229 2723640063 2721755702 Bacteria 4373124
230 2774397440 2773857763 Bacteria 4180068
231 2808899871 2808606372 Bacteria 4649509
232 2812325221 2811994872 Bacteria 4121241
233 2821271876 2821268502 Bacteria 3750023
234 2844844361 2844841374 Bacteria 3917147
235 2844853656 2844852863 Bacteria 3849151
236 2857730894 2857729791 Bacteria 4040535
237 2870625336 2870622029 Bacteria 3643329
238 2884763426 2884763398 Bacteria 4091164
239 2895662033 2895660088 Bacteria 3782833
240 2919056312 2919055335 Bacteria 3875751
241 2919444662 2919443155 Bacteria 4072969
242 2919526314 2919523602 Bacteria 3788128
243 2928122529 2928121344 Bacteria 3972376
244 2928154444 2928153084 Bacteria 4020257
245 2935412474 2935409751 Bacteria 4179611
246 2966926090 2966924647 Bacteria 3268643
247 8045833235 8045830549 Bacteria 4444727
248 8046354614 8046352972 Bacteria 3613806
249 8056040452 8056037122 Bacteria 3854319
250 8057346648 8057345674 Bacteria 4160394
251 Ga0500645_003721
252 JGI24740J21852_10051688
253 JGI24739J22299_10066713
254 JGI24737J22298_10006176
255 JGI24735J21928_10003573
256 JGI25165J46597_1000005
257 rootH1_10055620
258 Ga0006562J51391_1022457
259 Ga0006562J51391_1022459
260 Ga0055539_1000060
261 Ga0055533_1000002
262 Ga0055525_1000683
263 Ga0055527_1000004
264 Ga0055542_1000019
265 Ga0055529_1000008
266 Ga0065714_10087711
267 Ga0070658_10119350
268 Ga0070658_10345960
269 Ga0070661_100473038
270 Ga0070668_100065061
271 Ga0070662_100255541
272 Ga0070702_100332314
273 Ga0068861_100057074
274 Ga0075365_10003305
275 Ga0075365_10003606
276 Ga0075363_100144267
277 Ga0075364_10002885
278 Ga0075364_10004873
279 Ga0075367_10043674
280 Ga0075369_10007538
281 Ga0075369_10018257
282 Ga0075370_10007096
283 Ga0105244_10013921
284 Ga0105244_10162263
285 Ga0111539_10180902
286 Ga0105249_10080735
287 Ga0157370_10051914
288 Ga0157369_10000615
289 Ga0157369_10006070
290 Ga0157369_10019835
291 Ga0157369_10047907
292 Ga0157369_10343688
293 Ga0157369_10402365
294 Ga0171462_1005
295 Ga0157372_10182723
296 Ga0163163_10464893
297 Ga0157380_10036744
298 Ga0157377_10104477
299 Ga0206354_11240761
300 Ga0206353_10448527
301 Ga0209566_100013
302 Ga0209674_100001
303 Ga0209672_100011
304 Ga0209147_100367
305 Ga0209563_100001
306 Ga0209563_100158
307 Ga0207427_100024
308 Ga0209437_100243
309 Ga0209258_101652
310 Ga0209646_1022353
311 Ga0209677_100001
312 Ga0209677_100247
313 Ga0209148_1000023
314 Ga0209233_1000001
315 Ga0209455_1000023
316 Ga0207647_10197550
317 Ga0207705_10041524
318 Ga0207681_10500039
319 Ga0207659_10227423
320 Ga0207709_10022437
321 Ga0207668_10130802
322 Ga0207678_10670244
323 Ga0207675_100159744
324 Ga0207683_10167311
325 Ga0207428_10420248
326 Ga0307413_10300908
327 Ga0307406_10044967
328 Ga0307406_10059348
329 Ga0307406_10141828
330 Ga0307412_10145355
331 Ga0307409_100096421
332 Ga0307409_100401222
333 Ga0307416_100431297
334 Ga0307416_100892538
335 Ga0307414_10108821
336 Ga0307411_10075980
337 Ga0307415_100047537
338 Ga0307415_100158637
339 Ga0395899_0011857
340 Ga0395900_0007175
341 Ga0395900_0148087
342 Ga0395900_0150223
343 Ga0395898_0000355
344 Ga0395898_0048379
345 Ga0395901_0047268
346 Ga0395901_0113066
347 Ga0439465_0039114
348 Ga0439451_017664
349 Ga0450907_028355
350 Ga0466972_0117123
351 Ga0466965_0039021
352 Ga0466965_0092287
353 Ga0466965_0101166
354 Ga0466965_0314188
355 Ga0466961_0075667
356 Ga0466961_0449082
357 Ga0466968_0083064
358 Ga0466970_0022397
359 Ga0466970_0057183
360 Ga0466970_0175168
361 Ga0466960_0171858
362 Ga0466960_0203229
363 Ga0466959_0093591
364 Ga0466959_0143126
365 Ga0466958_0262653
366 Ga0466967_0400291
367 Ga0466967_0440484
368 Ga0495620_0137789
369 Ga0495645_0025853
370 Ga0495633_0191614
371 Ga0495656_0107677
372 Ga0495625_0351440
373 Ga0496100_0048907
374 Ga0496101_0041787
375 Ga0496102_0093519
376 Ga0496102_0104548
377 Ga0496102_0535000
378 Ga0496103_0077309
379 Ga0496104_0020241
380 Ga0496105_0009689
381 Ga0496105_0213605
382 Ga0496107_0046697
383 Ga0496108_0139200
384 Ga0496109_0276038
385 Ga0496110_0093337
386 Ga0496110_0121258
387 Ga0496111_0355000
388 Ga0496113_0049998
389 Ga0496113_0076370
390 Ga0496114_0059436
391 Ga0496114_0085821
392 Ga0496114_0158039
393 Ga0496115_0022642
394 Ga0496115_0270038
395 Ga0496116_0080715
396 Ga0496117_0000239
397 Ga0496117_0000856
398 Ga0496117_0005437
399 Ga0496117_0034296
400 Ga0496118_0002061
401 Ga0496118_0009674
402 Ga0496118_0029298
403 Ga0496118_0193135
404 Ga0496119_0000988
405 Ga0496119_0002623
406 Ga0496119_0020923
407 Ga0496119_0045654
408 Ga0496120_0006377
409 Ga0496121_0069481
410 Ga0496122_0000270
411 Ga0496122_0000760
412 Ga0496122_0005910
413 Ga0496123_0000036
414 Ga0496123_0001441
415 Ga0496123_0013505
416 Ga0496124_0003035
417 Ga0496126_0031148
418 Ga0501310_009052
419 Ga0501031_0010026
420 Ga0501032_0076257
421 Ga0501033_0010903
422 Ga0501033_0020231
423 Ga0501034_0430385
424 Ga0501036_0066597
425 Ga0501037_0065840
426 Ga0501037_0326382
427 Ga0501038_0124309
428 Ga0501039_0014066
429 Ga0501039_0219665
430 Ga0501043_0009374
431 Ga0501043_0165404
432 Ga0501046_0006161
433 Ga0501047_0046084
434 Ga0501047_0360612
435 Ga0501048_0019985
436 Ga0501069_0190895
437 Ga0501070_0000269
438 Ga0501070_0314544
439 Ga0501073_0104357
440 Ga0501074_0048142
441 Ga0501035_0018913
442 Ga0501035_0250834
443 Ga0501035_0388707
444 Ga0501044_0030594
445 Ga0501044_0093677
446 Ga0501044_0176464
447 Ga0501045_0051854
448 nmdc:mga00v17_66309_c1
449 nmdc:mga00v17_7787_c1
450 nmdc:mga0yw44_6035_c1
451 nmdc:mga0yw44_636_c1
452 nmdc:mga0sz30_14232_c2
453 nmdc:mga0sz30_18382_c1
454 Ga0500635_0000066
455 Ga0500643_000176
456 Ga0500650_0001109
457 Ga0500556_0000008
458 Ga0500568_0000003
459 Ga0500573_0016936
460 Ga0500573_0106491
461 Ga0500573_0139913
462 Ga0500573_0154783
463 Ga0500573_0186905
464 Ga0500573_0240821
465 Ga0500577_0061843
466 Ga0500616_0000010
467 Ga0500616_0007317
468 Ga0501084_0182273
469 Ga0466962_0134662
470 2587862013
471 2588107557
472 2643847382
473 2643877177
474 2643997372
475 2644097370
476 2644181806
477 2644280131
478 2644384232
479 2723640063
480 2774397440
481 2808899871
482 2812325221
483 2821271876
484 2844844361
485 2844853656
486 2857730894
487 2870625336
488 2884763426
489 2895662033
490 2919056312
491 2919444662
492 2919526314
493 2928122529
494 2928154444
495 2935412474
496 2966926090
497 8045833235
498 8046354614
499 8056040452
500 8057346648

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12401

FhaA_N

FhaA, N-terminal domain

20

134

0.99

PF00498

FHA

FHA domain

162

225

0.98

PF16697

Yop-YscD_cpl

Inner membrane component of T3SS, cytoplasmic domain

149

235

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3oun-assembly1.cif.gz_A crystal structure of the fhaa fha domain complexed with the intracellular domain of rv3910 0.9293 130 216
3gqs-assembly1.cif.gz_A crystal structure of the fha domain of ct664 protein from chlamydia trachomatis 0.9179 129 216
3poa-assembly1.cif.gz_A structural and functional analysis of phosphothreonine-dependent fha domain interactions 0.9178 129 220
8p5r-assembly1.cif.gz_H crystal structure of full-length, homohexameric 2-oxoglutarate dehydrogenase kgd from mycobacterium smegmatis in complex with gara 0.9122 129 216
6i2r-assembly1.cif.gz_D crystal structure of the suca domain of mycobacterium smegmatis kgd (alpha-ketoglutarate decarboxylase), mutant r802a, in complex with gara 0.9089 132 216
ID Description Score Start End Superfamily
3gqsA00 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.9179 129 216 2.60.200.20
3poaA00 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.9178 129 220 2.60.200.20
af_Q54ST8_470_584_2.60.200.20 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.9173 127 220 2.60.200.20
2ff4B03 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.9172 130 216 2.60.200.20
6i2sB01 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.9055 131 216 2.60.200.20
ID Description Score Start End GO Terms
AF-A0A147F2T3-F1-model_v4 Phosphopeptide-binding protein 0.9647 1 128
AF-A0A353FUU8-F1-model_v4 deleted 0.9603 1 121
AF-A0A7X8AKQ3-F1-model_v4 Diguanylate cyclase 0.9468 128 219 GO:0052621
AF-A0A7W1R2A9-F1-model_v4 DUF3662 domain-containing protein 0.9432 1 120
AF-A0A349AW43-F1-model_v4 DUF2662 domain-containing protein 0.9426 129 217

Map