F362029

General Info

Members Datasets Scaffolds Average Seq Length
250 165 208 302

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2871720351|2871721678
Length 331
Sequence KPQKFKQYSGKNGSIHCKTICNFIDMEQRAIKRIKTITEFHRSRGLPPPEHPLISVIDYKEVKRPADIGEVNWMLDFYQISLKTGMNGKLKYGQQEYDFDEGTLFFISPKQIFRIEADPNVQENQSGWMLLIHPDFLWHTSLAKTINQYDFFDYSLNEALFLSKKEELTINVIIENIEREYHSVVDKFSQNIIISHIETLLNYSERFYERQFITRKVTHHTILNRLEVLLEDYFNDHDLISKGLPTVQFVADELGISPNYLSRLLKTLTGQSTQQFIHDKLIKKAKEKLSTTSLSVSEIAYELGFEHPQSFTKLFKNKTRLSPLEFRTSFQ

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
3 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
4 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
5 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
6 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
7 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
8 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
9 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
10 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
11 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
12 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
13 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
14 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
15 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
16 2738541278 Niastella sp. CF465 Isolate Unclassified
17 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
18 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
19 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
20 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
21 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
22 2818991444 Filimonas endophytica 3197 Isolate Unclassified
23 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
24 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
25 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
26 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
27 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
28 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
29 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
30 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
31 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
32 2914759650 Rhizosphaericola mali Isolate Rhizosphere
33 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
34 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
35 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
36 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
37 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
38 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
39 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
40 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
41 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
42 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
43 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
44 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
45 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
46 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
47 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
48 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
49 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
50 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
51 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
52 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
53 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
54 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
55 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
56 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
82 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
83 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
86 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
88 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
89 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
96 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
109 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
110 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
111 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
112 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
113 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
114 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
115 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
116 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
117 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
120 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
121 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
122 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
123 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
124 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
125 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
126 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
127 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
128 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
129 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
130 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
131 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
132 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
133 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
134 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
135 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
136 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
137 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
138 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
139 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
140 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
141 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
142 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
143 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
144 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
145 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
146 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
147 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
148 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
149 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
150 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
151 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
152 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
153 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
154 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
155 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
156 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
157 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
158 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
159 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
160 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
161 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
162 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
163 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
164 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
165 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 83.2
Metatranscriptomes 0
Isolates 16.8

Biome Distribution

Category Percentage (%)
Aerial Root 0.8
Bulb 0
Endosphere 19.6
Nodule 0.4
Rhizoplane 0.8
Rhizosphere 55.2
Stem 0
Stem Tuber 0
Unclassified 23.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3593415 2162886007 Bacteria 12972
2 JGI24740J21852_10003880 3300001979 Bacteria 6487
3 rootH1_10004400 3300003316 Bacteria 7952
4 rootH2_10009210 3300003320 Bacteria 76383
5 rootH2_10041216 3300003320 Bacteria 24283
6 rootH2_10052355 3300003320 Bacteria 2572
7 rootL2_10024715 3300003322 Bacteria 5259
8 rootL2_10040971 3300003322 Bacteria 11673
9 rootL2_10048850 3300003322 Bacteria 41711
10 rootL2_10079669 3300003322 Bacteria 4116
11 rootL2_10129704 3300003322 Bacteria 2959
12 rootL2_10306367 3300003322 Bacteria 3257
13 rootH1_10097910 3300003323 Bacteria 12830
14 rootH1_10138576 3300003323 Bacteria 11483
15 rootH1_10205216 3300003323 Bacteria 2232
16 rootH1_10228252 3300003323 Unclassified 2632
17 rootH1_10235241 3300003323 Bacteria 4520
18 rootH1_10256332 3300003323 Bacteria 3700
19 rootH1_10260427 3300003323 Bacteria 5018
20 rootH1_10345308 3300003323 Bacteria 3017
21 JGI25160J50197_1003732 3300003354 Bacteria 6713
22 JGI25160J50197_1022271 3300003354 Unclassified 1861
23 Ga0055535_1002028 3300003761 Bacteria 8237
24 Ga0055535_1002926 3300003761 Bacteria 5302
25 Ga0055542_1003182 3300003762 Bacteria 4627
26 Ga0055536_1000003 3300003781 Bacteria 447744
27 Ga0055530_10002046 3300003791 Bacteria 13585
28 Ga0055530_10008794 3300003791 Bacteria 3983
29 Ga0055531_10000063 3300003794 Bacteria 119938
30 Ga0055531_10000085 3300003794 Bacteria 102372
31 Ga0065165_1003209 3300005262 Bacteria 11918
32 Ga0065165_1028667 3300005262 Bacteria 1794
33 Ga0065714_10008200 3300005288 Bacteria 3409
34 Ga0065704_10081889 3300005289 Bacteria 3687
35 Ga0070683_100037437 3300005329 Bacteria 4441
36 Ga0070682_100000822 3300005337 Bacteria 18129
37 Ga0070668_100391892 3300005347 Bacteria 1184
38 Ga0070698_100031407 3300005471 Bacteria 5506
39 Ga0070684_100110875 3300005535 Bacteria 2460
40 Ga0068853_100294621 3300005539 Bacteria 1498
41 Ga0068853_100349547 3300005539 Unclassified 1375
42 Ga0068855_100000407 3300005563 Bacteria 53304
43 Ga0068856_100023756 3300005614 Bacteria 5963
44 Ga0068852_100404604 3300005616 Bacteria 1343
45 Ga0068859_100528595 3300005617 Bacteria 1274
46 Ga0068860_100199203 3300005843 Bacteria 1940
47 Ga0097620_100528669 3300006931 Bacteria 1274
48 Ga0105244_10000010 3300009036 Bacteria 265799
49 Ga0105240_10000020 3300009093 Bacteria 399699
50 Ga0105240_10000319 3300009093 Bacteria 91429
51 Ga0105240_10010812 3300009093 Bacteria 12782
52 Ga0105243_10000117 3300009148 Bacteria 91860
53 Ga0105241_10011163 3300009174 Bacteria 6586
54 Ga0105241_10125984 3300009174 Bacteria 2068
55 Ga0105237_10047807 3300009545 Bacteria 4302
56 Ga0105237_10219890 3300009545 Bacteria 1900
57 Ga0105237_10322718 3300009545 Bacteria 1548
58 Ga0105238_10000867 3300009551 Bacteria 31241
59 Ga0105238_10354065 3300009551 Bacteria 1457
60 Ga0105239_10000631 3300010375 Bacteria 50176
61 Ga0105239_10152095 3300010375 Bacteria 2583
62 Ga0105239_10589268 3300010375 Bacteria 1268
63 Ga0157373_10000028 3300013100 Bacteria 132569
64 Ga0157371_10000050 3300013102 Bacteria 183160
65 Ga0157370_10000442 3300013104 Bacteria 51866
66 Ga0157370_10055710 3300013104 Bacteria 3765
67 Ga0157370_10171966 3300013104 Bacteria 2013
68 Ga0157370_10184649 3300013104 Bacteria 1937
69 Ga0157370_10207854 3300013104 Bacteria 1815
70 Ga0157369_10000002 3300013105 Bacteria 524510
71 Ga0157378_10199716 3300013297 Bacteria 1891
72 Ga0163162_10001849 3300013306 Bacteria 19921
73 Ga0157372_10004637 3300013307 Bacteria 14603
74 Ga0157372_10045252 3300013307 Bacteria 4881
75 Ga0182008_10000011 3300014497 Bacteria 297770
76 Ga0182008_10000319 3300014497 Bacteria 37848
77 Ga0157376_10087818 3300014969 Bacteria 2684
78 Ga0182006_1000868 3300015261 Bacteria 20280
79 Ga0182007_10000001 3300015262 Bacteria 1127301
80 Ga0182005_1000212 3300015265 Bacteria 38424
81 Ga0163161_10000138 3300017792 Bacteria 68614
82 Ga0163161_10002833 3300017792 Bacteria 12305
83 Ga0163161_10073599 3300017792 Bacteria 2504
84 Ga0163161_10338139 3300017792 Bacteria 1194
85 Ga0209436_102098 3300025208 Bacteria 6247
86 Ga0209258_100036 3300025242 Bacteria 428859
87 Ga0209258_100068 3300025242 Bacteria 286288
88 Ga0209646_1000744 3300025246 Bacteria 11436
89 Ga0209026_1000348 3300025250 Bacteria 44090
90 Ga0209148_1000230 3300025254 Bacteria 91940
91 Ga0209148_1000259 3300025254 Bacteria 82912
92 Ga0209673_1025890 3300025273 Unclassified 1940
93 Ga0209675_1000263 3300025291 Bacteria 51088
94 Ga0209676_1000001 3300025292 Bacteria 1852142
95 Ga0209564_1025134 3300025295 Unclassified 2014
96 Ga0209050_1000016 3300025298 Bacteria 729149
97 Ga0209050_1007473 3300025298 Bacteria 6119
98 Ga0209050_1029548 3300025298 Bacteria 1750
99 Ga0207426_1000157 3300025302 Bacteria 178442
100 Ga0207426_1000782 3300025302 Bacteria 34779
101 Ga0209257_1000001 3300025304 Bacteria 2274655
102 Ga0209257_1000008 3300025304 Bacteria 1294570
103 Ga0209257_1002178 3300025304 Bacteria 20288
104 Ga0207655_1000200 3300025728 Bacteria 104540
105 Ga0207654_10013017 3300025911 Bacteria 4271
106 Ga0207695_10000020 3300025913 Bacteria 723025
107 Ga0207695_10002733 3300025913 Bacteria 25725
108 Ga0207695_10006812 3300025913 Bacteria 14729
109 Ga0207695_10241085 3300025913 Unclassified 1709
110 Ga0207671_10002192 3300025914 Bacteria 21199
111 Ga0207646_10275249 3300025922 Bacteria 1521
112 Ga0207709_10000217 3300025935 Bacteria 72596
113 Ga0207661_10026776 3300025944 Bacteria 4398
114 Ga0207667_10000321 3300025949 Bacteria 66544
115 Ga0207658_10161470 3300025986 Unclassified 1837
116 Ga0207639_10346350 3300026041 Unclassified 1326
117 Ga0207702_10008333 3300026078 Bacteria 8751
118 Ga0207702_10221354 3300026078 Bacteria 1764
119 Ga0307515_10000001 3300028794 Bacteria 4259510
120 Ga0316176_1002853 3300030732 Bacteria 37876
121 Ga0316183_1081447 3300030742 Bacteria 28525
122 Ga0316181_1268831 3300030744 Bacteria 16215
123 Ga0316182_1421094 3300030745 Bacteria 1478
124 Ga0307513_10187751 3300031456 Bacteria 1922
125 Ga0265314_10193405 3300031711 Unclassified 1208
126 Ga0307414_10008444 3300032004 Bacteria 5840
127 Ga0307510_10000062 3300033180 Bacteria 81920
128 Ga0395899_0123040 3300037312 Unclassified 1857
129 Ga0395905_0055260 3300037471 Bacteria 3716
130 Ga0395905_0543568 3300037471 Bacteria 1063
131 Ga0439449_0088184 3300042007 Bacteria 1145
132 Ga0466972_0000007 3300044658 Bacteria 277010
133 Ga0466972_0000010 3300044658 Bacteria 256339
134 Ga0466972_0000307 3300044658 Bacteria 28883
135 Ga0466966_0004466 3300044684 Bacteria 9224
136 Ga0453684_0151938 3300044712 Bacteria 2750
137 Ga0466971_0062054 3300044719 Unclassified 1691
138 Ga0466968_0003113 3300044735 Bacteria 6122
139 Ga0466968_0016502 3300044735 Bacteria 2941
140 Ga0466970_0000244 3300044765 Bacteria 26639
141 Ga0466970_0011552 3300044765 Bacteria 4503
142 Ga0466957_0012791 3300044842 Bacteria 4862
143 Ga0466957_0018599 3300044842 Bacteria 4081
144 Ga0466959_0002903 3300045049 Bacteria 11057
145 Ga0495638_0066623 3300046460 Bacteria 2213
146 Ga0495596_0002968 3300046500 Bacteria 8799
147 Ga0495606_0000426 3300046507 Bacteria 70066
148 Ga0495606_0005442 3300046507 Bacteria 12193
149 Ga0495606_0008231 3300046507 Bacteria 9108
150 Ga0495606_0016311 3300046507 Bacteria 5671
151 Ga0495606_0053549 3300046507 Bacteria 2618
152 Ga0495606_0058501 3300046507 Bacteria 2477
153 Ga0495606_0145310 3300046507 Bacteria 1397
154 Ga0495610_0003808 3300046512 Bacteria 11502
155 Ga0495643_0089868 3300046522 Bacteria 1586
156 Ga0495663_0000311 3300046525 Bacteria 18294
157 Ga0495652_0187971 3300046529 Bacteria 1579
158 Ga0495609_0002167 3300046538 Bacteria 12333
159 Ga0495686_0000061 3300047472 Bacteria 236734
160 Ga0495686_0004976 3300047472 Bacteria 10685
161 Ga0495686_0033182 3300047472 Bacteria 3335
162 Ga0496102_0021523 3300048905 Bacteria 5703
163 Ga0496115_0026241 3300048918 Bacteria 4545
164 Ga0496116_0000006 3300048919 Bacteria 811937
165 Ga0496116_0014174 3300048919 Bacteria 6381
166 Ga0496117_0000023 3300048920 Bacteria 438585
167 Ga0496117_0003481 3300048920 Bacteria 18254
168 Ga0496118_0000660 3300048921 Bacteria 56444
169 Ga0496119_0000010 3300048922 Bacteria 438534
170 Ga0496121_0148881 3300048924 Bacteria 1726
171 Ga0496122_0000066 3300048925 Bacteria 231473
172 Ga0496122_0000166 3300048925 Bacteria 157284
173 Ga0496122_0001325 3300048925 Bacteria 40567
174 Ga0496122_0003566 3300048925 Bacteria 20334
175 Ga0496123_0000294 3300048926 Bacteria 97574
176 Ga0496123_0003434 3300048926 Bacteria 17791
177 Ga0496123_0007665 3300048926 Bacteria 10092
178 Ga0496123_0045772 3300048926 Bacteria 2976
179 Ga0496124_0001583 3300048927 Bacteria 32871
180 Ga0496124_0162405 3300048927 Bacteria 1740
181 Ga0496125_0000181 3300048928 Bacteria 138133
182 Ga0496125_0000443 3300048928 Bacteria 75675
183 Ga0496126_0001004 3300048929 Bacteria 48080
184 Ga0496126_0014057 3300048929 Bacteria 8110
185 Ga0501249_000011 3300049679 Bacteria 168084
186 Ga0501257_022944 3300049686 Bacteria 1478
187 Ga0501044_0090776 3300049823 Bacteria 3082
188 nmdc:mga0k408_232562_c1 3300050493 Bacteria 1100
189 Ga0500635_0009067 3300053080 Bacteria 2749
190 Ga0500644_0000169 3300053088 Bacteria 41659
191 Ga0500583_0000036 3300053092 Bacteria 95404
192 Ga0500583_0000776 3300053092 Bacteria 9273
193 Ga0500583_0001567 3300053092 Bacteria 6617
194 Ga0500562_005386 3300053108 Bacteria 3215
195 Ga0500562_017333 3300053108 Unclassified 1857
196 Ga0500562_034807 3300053108 Bacteria 1333
197 Ga0500590_014693 3300053148 Bacteria 4037
198 Ga0500616_0000894 3300053153 Bacteria 32766
199 Ga0500622_0000004 3300053156 Bacteria 557587
200 Ga0500622_0001936 3300053156 Bacteria 15603
201 Ga0500622_0008935 3300053156 Bacteria 5571
202 Ga0500622_0011610 3300053156 Bacteria 4791
203 Ga0500624_000187 3300053157 Bacteria 24423
204 Ga0500633_0000979 3300053160 Bacteria 5035
205 Ga0500634_0066506 3300053161 Bacteria 1899
206 Ga0500634_0080741 3300053161 Bacteria 1677
207 Ga0500611_027804 3300053727 Bacteria 1142
208 Ga0466962_0018868 3300061719 Bacteria 3314

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046522 Ga0495643_0089868 Ga0495643_0089868_709_1536 248
2 3300013100 Ga0157373_10000028 Ga0157373_1000002891 260
3 3300014497 Ga0182008_10000011 Ga0182008_10000011123 260
4 3300046525 Ga0495663_0000311 Ga0495663_0000311_9259_10176 260
5 iso_pu_bacteria 2821136567 2821138612 264
6 3300005539 Ga0068853_100349547 Ga0068853_1003495472 268
7 3300013104 Ga0157370_10207854 Ga0157370_102078542 268
8 3300005262 Ga0065165_1028667 Ga0065165_10286673 273
9 3300003322 rootL2_10129704 rootL2_101297041 278
10 3300003323 rootH1_10256332 rootH1_102563322 278
11 3300025246 Ga0209646_1000744 Ga0209646_10007448 278
12 3300046507 Ga0495606_0053549 Ga0495606_0053549_773_1693 284
13 3300049686 Ga0501257_022944 Ga0501257_022944_406_1272 284
14 3300049679 Ga0501249_000011 Ga0501249_000011_87694_88614 285
15 3300053108 Ga0500562_034807 Ga0500562_034807_385_1311 285
16 3300053156 Ga0500622_0008935 Ga0500622_0008935_4687_5556 285
17 3300053161 Ga0500634_0066506 Ga0500634_0066506_276_1190 285
18 3300048905 Ga0496102_0021523 Ga0496102_0021523_4681_5601 287
19 3300048919 Ga0496116_0000006 Ga0496116_0000006_717120_718040 287
20 3300048920 Ga0496117_0000023 Ga0496117_0000023_267152_268072 287
21 3300048921 Ga0496118_0000660 Ga0496118_0000660_46720_47640 287
22 3300048922 Ga0496119_0000010 Ga0496119_0000010_170520_171440 287
23 3300048925 Ga0496122_0000166 Ga0496122_0000166_19512_20432 287
24 3300048926 Ga0496123_0000294 Ga0496123_0000294_14226_15146 287
25 3300048927 Ga0496124_0001583 Ga0496124_0001583_6147_7067 287
26 3300003761 Ga0055535_1002028 Ga0055535_10020287 289
27 3300025242 Ga0209258_100068 Ga0209258_1000687 289
28 3300025254 Ga0209148_1000259 Ga0209148_10002597 289
29 3300046507 Ga0495606_0005442 Ga0495606_0005442_6790_7707 289
30 3300046507 Ga0495606_0000426 Ga0495606_0000426_14202_15086 290
31 3300048919 Ga0496116_0014174 Ga0496116_0014174_3139_4062 291
32 3300048920 Ga0496117_0003481 Ga0496117_0003481_9759_10682 291
33 3300048925 Ga0496122_0003566 Ga0496122_0003566_14552_15475 291
34 3300048926 Ga0496123_0045772 Ga0496123_0045772_1214_2137 291
35 3300013104 Ga0157370_10000442 Ga0157370_1000044214 293
36 iso_pu_bacteria 2821136567 2821139379 293
37 iso_pu_bacteria 2883068021 2883071870 293
38 iso_pu_bacteria 2904467357 2904471989 293
39 3300003322 rootL2_10040971 rootL2_1004097111 294
40 3300003323 rootH1_10097910 rootH1_100979105 294
41 3300003323 rootH1_10345308 rootH1_103453082 294
42 3300026041 Ga0207639_10346350 Ga0207639_103463502 294
43 3300053156 Ga0500622_0011610 Ga0500622_0011610_3180_4100 294
44 3300025986 Ga0207658_10161470 Ga0207658_101614703 295
45 iso_pu_bacteria 2818991442 2819576070 295
46 iso_pu_bacteria 2904467357 2904469405 295
47 iso_pu_bacteria 2919437846 2919440488 295
48 3300005289 Ga0065704_10081889 Ga0065704_100818893 296
49 iso_pu_bacteria 2585428095 2587866839 296
50 iso_pu_bacteria 2585428182 2588209471 296
51 iso_pu_bacteria 2775506987 2776613368 296
52 iso_pu_bacteria 2818991460 2819680182 296
53 iso_pu_bacteria 2904445276 2904445636 296
54 iso_pu_bacteria 2911138879 2911141615 296
55 iso_pu_bacteria 8003151029 8003152764 296
56 3300003316 rootH1_10004400 rootH1_100044004 297
57 3300003320 rootH2_10009210 rootH2_1000921016 297
58 3300003320 rootH2_10041216 rootH2_1004121618 297
59 3300003322 rootL2_10024715 rootL2_100247152 297
60 3300003323 rootH1_10205216 rootH1_102052162 297
61 3300003354 JGI25160J50197_1022271 JGI25160J50197_10222712 297
62 3300003791 Ga0055530_10008794 Ga0055530_100087942 297
63 3300025273 Ga0209673_1025890 Ga0209673_10258901 297
64 3300025295 Ga0209564_1025134 Ga0209564_10251342 297
65 3300025298 Ga0209050_1007473 Ga0209050_10074734 297
66 3300025302 Ga0207426_1000782 Ga0207426_100078225 297
67 3300025304 Ga0209257_1002178 Ga0209257_100217810 297
68 3300042007 Ga0439449_0088184 Ga0439449_0088184_15_920 297
69 3300044658 Ga0466972_0000307 Ga0466972_0000307_4577_5494 297
70 3300046507 Ga0495606_0008231 Ga0495606_0008231_4246_5160 297
71 3300046507 Ga0495606_0058501 Ga0495606_0058501_48_959 297
72 3300053092 Ga0500583_0000776 Ga0500583_0000776_1086_1994 297
73 3300053148 Ga0500590_014693 Ga0500590_014693_1105_2019 297
74 iso_pu_bacteria 2585428061 2587750351 297
75 iso_pu_bacteria 2739367874 2740057147 297
76 iso_pu_bacteria 2818991444 2819589196 297
77 iso_pu_bacteria 2919177583 2919181107 297
78 iso_pu_bacteria 2919191525 2919195507 297
79 iso_pu_bacteria 2945997725 2945999762 297
80 iso_pu_bacteria 2721755487 2722727832 298
81 iso_pu_bacteria 2738541278 2738731294 298
82 iso_pu_bacteria 2910245624 2910245690 298
83 iso_pu_bacteria 2914759650 2914760900 298
84 3300005563 Ga0068855_100000407 Ga0068855_10000040731 299
85 3300010375 Ga0105239_10589268 Ga0105239_105892682 299
86 3300015265 Ga0182005_1000212 Ga0182005_100021225 299
87 3300025208 Ga0209436_102098 Ga0209436_1020984 299
88 3300025949 Ga0207667_10000321 Ga0207667_1000032141 299
89 3300031711 Ga0265314_10193405 Ga0265314_101934052 299
90 3300044712 Ga0453684_0151938 Ga0453684_0151938_384_1295 299
91 3300053153 Ga0500616_0000894 Ga0500616_0000894_28266_29177 299
92 iso_pu_bacteria 2585428045 2587677857 299
93 iso_pu_bacteria 2585428060 2587748370 299
94 iso_pu_bacteria 2585428060 2587748498 299
95 iso_pu_bacteria 2585428182 2588209739 299
96 iso_pu_bacteria 2585428183 2588215118 299
97 iso_pu_bacteria 2585428184 2588218298 299
98 iso_pu_bacteria 2585428185 2588222386 299
99 iso_pu_bacteria 2588253712 2588446179 299
100 iso_pu_bacteria 2588254255 2590604178 299
101 iso_pu_bacteria 2588254257 2590614167 299
102 iso_pu_bacteria 2728369107 2729199458 299
103 iso_pu_bacteria 2765235839 2765573490 299
104 iso_pu_bacteria 2816332188 2816873855 299
105 iso_pu_bacteria 2889290771 2889290795 299
106 iso_pu_bacteria 2984572630 2984574988 299
107 iso_pu_bacteria 2984606641 2984608441 299
108 3300001979 JGI24740J21852_10003880 JGI24740J21852_100038804 300
109 3300003320 rootH2_10052355 rootH2_100523553 300
110 3300003322 rootL2_10048850 rootL2_1004885028 300
111 3300003323 rootH1_10138576 rootH1_101385769 300
112 3300003794 Ga0055531_10000063 Ga0055531_1000006388 300
113 3300005288 Ga0065714_10008200 Ga0065714_100082005 300
114 3300005616 Ga0068852_100404604 Ga0068852_1004046041 300
115 3300005617 Ga0068859_100528595 Ga0068859_1005285951 300
116 3300006931 Ga0097620_100528669 Ga0097620_1005286692 300
117 3300009093 Ga0105240_10000319 Ga0105240_100003194 300
118 3300009174 Ga0105241_10011163 Ga0105241_100111636 300
119 3300009545 Ga0105237_10047807 Ga0105237_100478073 300
120 3300009551 Ga0105238_10000867 Ga0105238_100008672 300
121 3300009551 Ga0105238_10354065 Ga0105238_103540652 300
122 3300010375 Ga0105239_10152095 Ga0105239_101520952 300
123 3300013102 Ga0157371_10000050 Ga0157371_1000005098 300
124 3300013104 Ga0157370_10171966 Ga0157370_101719661 300
125 3300013104 Ga0157370_10184649 Ga0157370_101846493 300
126 3300013105 Ga0157369_10000002 Ga0157369_10000002251 300
127 3300013306 Ga0163162_10001849 Ga0163162_100018494 300
128 3300013307 Ga0157372_10004637 Ga0157372_100046372 300
129 3300013307 Ga0157372_10045252 Ga0157372_100452522 300
130 3300014497 Ga0182008_10000319 Ga0182008_1000031920 300
131 3300015261 Ga0182006_1000868 Ga0182006_100086813 300
132 3300015262 Ga0182007_10000001 Ga0182007_10000001522 300
133 3300017792 Ga0163161_10338139 Ga0163161_103381392 300
134 3300025304 Ga0209257_1000008 Ga0209257_1000008745 300
135 3300025911 Ga0207654_10013017 Ga0207654_100130173 300
136 3300025913 Ga0207695_10002733 Ga0207695_100027334 300
137 3300025914 Ga0207671_10002192 Ga0207671_1000219212 300
138 3300026078 Ga0207702_10221354 Ga0207702_102213542 300
139 3300030732 Ga0316176_1002853 Ga0316176_10028536 300
140 3300030742 Ga0316183_1081447 Ga0316183_108144719 300
141 3300030744 Ga0316181_1268831 Ga0316181_12688319 300
142 3300030745 Ga0316182_1421094 Ga0316182_14210942 300
143 3300032004 Ga0307414_10008444 Ga0307414_100084443 300
144 3300044719 Ga0466971_0062054 Ga0466971_0062054_586_1500 300
145 3300046460 Ga0495638_0066623 Ga0495638_0066623_347_1264 300
146 3300046507 Ga0495606_0145310 Ga0495606_0145310_153_1067 300
147 3300046538 Ga0495609_0002167 Ga0495609_0002167_10409_11323 300
148 3300049823 Ga0501044_0090776 Ga0501044_0090776_771_1685 300
149 3300053156 Ga0500622_0001936 Ga0500622_0001936_10478_11392 300
150 3300053727 Ga0500611_027804 Ga0500611_027804_53_970 300
151 3300061719 Ga0466962_0018868 Ga0466962_0018868_275_1189 300
152 3300003322 rootL2_10079669 rootL2_100796693 301
153 3300003323 rootH1_10228252 rootH1_102282521 301
154 3300003761 Ga0055535_1002926 Ga0055535_10029263 301
155 3300003762 Ga0055542_1003182 Ga0055542_10031823 301
156 3300003781 Ga0055536_1000003 Ga0055536_100000351 301
157 3300003791 Ga0055530_10002046 Ga0055530_100020468 301
158 3300017792 Ga0163161_10000138 Ga0163161_1000013820 301
159 3300017792 Ga0163161_10073599 Ga0163161_100735992 301
160 3300025242 Ga0209258_100036 Ga0209258_1000366 301
161 3300025254 Ga0209148_1000230 Ga0209148_100023033 301
162 3300025292 Ga0209676_1000001 Ga0209676_1000001385 301
163 3300025298 Ga0209050_1000016 Ga0209050_100001650 301
164 3300031456 Ga0307513_10187751 Ga0307513_101877512 301
165 3300048927 Ga0496124_0162405 Ga0496124_0162405_431_1345 301
166 3300053092 Ga0500583_0000036 Ga0500583_0000036_75096_76013 301
167 3300003323 rootH1_10235241 rootH1_102352415 302
168 3300003354 JGI25160J50197_1003732 JGI25160J50197_10037327 302
169 3300005262 Ga0065165_1003209 Ga0065165_10032093 302
170 3300005329 Ga0070683_100037437 Ga0070683_1000374376 302
171 3300005471 Ga0070698_100031407 Ga0070698_1000314074 302
172 3300005535 Ga0070684_100110875 Ga0070684_1001108751 302
173 3300005539 Ga0068853_100294621 Ga0068853_1002946212 302
174 3300005614 Ga0068856_100023756 Ga0068856_1000237562 302
175 3300005843 Ga0068860_100199203 Ga0068860_1001992032 302
176 3300009093 Ga0105240_10000020 Ga0105240_10000020330 302
177 3300009093 Ga0105240_10010812 Ga0105240_100108129 302
178 3300009174 Ga0105241_10125984 Ga0105241_101259842 302
179 3300009545 Ga0105237_10219890 Ga0105237_102198902 302
180 3300009545 Ga0105237_10322718 Ga0105237_103227182 302
181 3300010375 Ga0105239_10000631 Ga0105239_1000063146 302
182 3300013297 Ga0157378_10199716 Ga0157378_101997162 302
183 3300014969 Ga0157376_10087818 Ga0157376_100878182 302
184 3300017792 Ga0163161_10002833 Ga0163161_100028337 302
185 3300025250 Ga0209026_1000348 Ga0209026_100034830 302
186 3300025298 Ga0209050_1029548 Ga0209050_10295481 302
187 3300025302 Ga0207426_1000157 Ga0207426_100015772 302
188 3300025913 Ga0207695_10000020 Ga0207695_10000020196 302
189 3300025913 Ga0207695_10006812 Ga0207695_100068125 302
190 3300025913 Ga0207695_10241085 Ga0207695_102410852 302
191 3300025922 Ga0207646_10275249 Ga0207646_102752492 302
192 3300025944 Ga0207661_10026776 Ga0207661_100267765 302
193 3300026078 Ga0207702_10008333 Ga0207702_100083337 302
194 3300028794 Ga0307515_10000001 Ga0307515_100000012570 302
195 3300033180 Ga0307510_10000062 Ga0307510_1000006229 302
196 3300037312 Ga0395899_0123040 Ga0395899_0123040_304_1224 302
197 3300037471 Ga0395905_0055260 Ga0395905_0055260_446_1366 302
198 3300037471 Ga0395905_0543568 Ga0395905_0543568_65_979 302
199 3300044658 Ga0466972_0000007 Ga0466972_0000007_16525_17445 302
200 3300044658 Ga0466972_0000010 Ga0466972_0000010_134124_135038 302
201 3300044684 Ga0466966_0004466 Ga0466966_0004466_4335_5255 302
202 3300044735 Ga0466968_0003113 Ga0466968_0003113_1755_2675 302
203 3300044735 Ga0466968_0016502 Ga0466968_0016502_1549_2469 302
204 3300044765 Ga0466970_0000244 Ga0466970_0000244_6494_7408 302
205 3300044765 Ga0466970_0011552 Ga0466970_0011552_666_1586 302
206 3300044842 Ga0466957_0012791 Ga0466957_0012791_2953_3879 302
207 3300044842 Ga0466957_0018599 Ga0466957_0018599_1848_2768 302
208 3300045049 Ga0466959_0002903 Ga0466959_0002903_6284_7204 302
209 3300046507 Ga0495606_0016311 Ga0495606_0016311_1618_2538 302
210 3300046512 Ga0495610_0003808 Ga0495610_0003808_2710_3639 302
211 3300046529 Ga0495652_0187971 Ga0495652_0187971_416_1336 302
212 3300047472 Ga0495686_0000061 Ga0495686_0000061_183896_184816 302
213 3300047472 Ga0495686_0004976 Ga0495686_0004976_1990_2910 302
214 3300047472 Ga0495686_0033182 Ga0495686_0033182_2378_3298 302
215 3300050493 nmdc:mga0k408_232562_c1 nmdc:mga0k408_232562_c1_40_960 302
216 3300053080 Ga0500635_0009067 Ga0500635_0009067_1819_2739 302
217 3300053088 Ga0500644_0000169 Ga0500644_0000169_28567_29487 302
218 3300053108 Ga0500562_005386 Ga0500562_005386_1701_2624 302
219 3300053108 Ga0500562_017333 Ga0500562_017333_242_1162 302
220 3300053156 Ga0500622_0000004 Ga0500622_0000004_130004_130924 302
221 3300053157 Ga0500624_000187 Ga0500624_000187_15397_16317 302
222 3300053160 Ga0500633_0000979 Ga0500633_0000979_3579_4499 302
223 3300053161 Ga0500634_0080741 Ga0500634_0080741_562_1482 302
224 2162886007 SwRhRL2b_contig_3593415 SwRhRL2b_0252.00008490 303
225 3300003322 rootL2_10306367 rootL2_103063672 303
226 3300003323 rootH1_10260427 rootH1_102604273 303
227 3300003794 Ga0055531_10000085 Ga0055531_1000008524 303
228 3300005337 Ga0070682_100000822 Ga0070682_10000082218 303
229 3300005347 Ga0070668_100391892 Ga0070668_1003918921 303
230 3300009036 Ga0105244_10000010 Ga0105244_10000010110 303
231 3300009148 Ga0105243_10000117 Ga0105243_1000011771 303
232 3300013104 Ga0157370_10055710 Ga0157370_100557104 303
233 3300025291 Ga0209675_1000263 Ga0209675_100026346 303
234 3300025304 Ga0209257_1000001 Ga0209257_10000011190 303
235 3300025728 Ga0207655_1000200 Ga0207655_100020013 303
236 3300025935 Ga0207709_10000217 Ga0207709_1000021721 303
237 3300046500 Ga0495596_0002968 Ga0495596_0002968_33_953 303
238 3300048918 Ga0496115_0026241 Ga0496115_0026241_1706_2626 303
239 3300048924 Ga0496121_0148881 Ga0496121_0148881_740_1660 303
240 3300048925 Ga0496122_0000066 Ga0496122_0000066_30125_31045 303
241 3300048925 Ga0496122_0001325 Ga0496122_0001325_13942_14862 303
242 3300048926 Ga0496123_0003434 Ga0496123_0003434_3155_4075 303
243 3300048926 Ga0496123_0007665 Ga0496123_0007665_8423_9343 303
244 3300048928 Ga0496125_0000181 Ga0496125_0000181_46057_46977 303
245 3300048928 Ga0496125_0000443 Ga0496125_0000443_60138_61058 303
246 3300048929 Ga0496126_0001004 Ga0496126_0001004_16758_17726 303
247 3300048929 Ga0496126_0014057 Ga0496126_0014057_1476_2396 303
248 3300053092 Ga0500583_0001567 Ga0500583_0001567_1356_2279 303
249 iso_pu_bacteria 2582581278 2585144686 303
250 iso_pu_bacteria 2871720351 2871721678 303

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12833

HTH_18

Helix-turn-helix domain

250

329

0.97

PF00165

HTH_AraC

Bacterial regulatory helix-turn-helix proteins, AraC family

289

328

0.95

PF02311

AraC_binding

AraC-like ligand binding domain

74

171

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lsg-assembly1.cif.gz_A the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 0.8904 193 299
5chh-assembly1.cif.gz_A crystal structure of transcriptional regulator cdpr from pseudomonas aeruginosa 0.8851 217 300
3mkl-assembly2.cif.gz_B crystal structure of dna-binding transcriptional dual regulator from escherichia coli k-12 0.8711 197 302
3lsg-assembly1.cif.gz_A the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 0.8665 193 299
3oou-assembly1.cif.gz_A the structure of a protein with unkown function from listeria innocua 0.8652 194 303
ID Description Score Start End Superfamily
3lsgA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9729 255 299 1.10.10.60
af_P32677_219_275_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9542 251 302 1.10.10.60
3lsgB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9419 255 299 1.10.10.60
3lsgC02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9329 255 299 1.10.10.60
1d5yD02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9311 253 303 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A3C0CTA9-F1-model_v4 HTH araC/xylS-type domain-containing protein 0.9366 217 302 GO:0003700
GO:0043565
AF-A0A059VNN1-F1-model_v4 Transcriptional regulator 0.9355 218 302 GO:0003700
GO:0043565
AF-W6RL25-F1-model_v4 DNA-binding domain-containing protein, AraC-type 0.9345 198 301 GO:0003700
GO:0043565
AF-A0A5B8TM19-F1-model_v4 deleted 0.9335 217 302
AF-A0A4Q3EPE4-F1-model_v4 deleted 0.9322 210 303

Feature Viewer

pLDDT pTM Quality
82.9 0.66 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map