F362087

General Info

Members Datasets Scaffolds Average Seq Length
251 147 502 540

Family's Representative Sequence

Representative Sequence 3300002987|JGI25159J45721_1008298|JGI25159J45721_10082982
Length 560
Sequence VDTVTILLSSFILSVTGLLIFIWSLRKRLFDATSVAANVIFSPGEIGRGEDPSVSPDKREGLHKPVKGEVKPVLTAEQEAELEKELAERVEADNSSAFVTFVFLACAVVWLIVASLAGLTSSIKLHEPDWLSQYAWLTFGRIRTIHLNAVAYGWAPMAALGVANWMLPRLLKTPLVGARFAIFGAMLWNAGLIAGLGCIAAGISDGLEWLEIPWQVDLLMVAGGALVGLPLVYTLQNRKVHHLYVSIWYMGAALFWFPILFLIGNLPAIHFGVQQAAMNWWFGHNVLGLFYTPMALASVYYFLPKIIGRPIQSYNLSLLGFWTLAFFYGQVGGHHLIGGPIPGWLVTLSVVQSVMMLVPVISFSINQHMTMRGYFSKLIYSPTLRFIVLGGMMYTLSSIQGSIEALHSVNTVAHFTHFTVAHAHLGLYGFFTMVMFGAIYFVMPRVMAWEWPYPKLIAAHFWLVVVGFGIYFIGLSIGGWLQGLAMLDAARPFMDSVTVTIPYLQSRSVGGAVMTLGHLLFAIHFVAMALRQGPGRVGAALLHTRETTTSIPEDRNLAGA

Samples

Sample ID Description Type Environment
1 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
9 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
10 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
11 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
20 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
21 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
22 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
23 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
24 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
25 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
26 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
27 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
28 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
29 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
30 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
31 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
32 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
33 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
34 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
35 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
36 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
37 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
38 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
39 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
40 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
41 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
42 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
44 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
45 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
50 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
51 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
52 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
53 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
54 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
55 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
56 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
57 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
58 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
59 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
60 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
61 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
62 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
63 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
64 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
65 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
66 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
67 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
68 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
69 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
70 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
71 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
72 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
73 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
74 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
75 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
76 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
77 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
78 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
79 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
80 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
81 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
82 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
83 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
84 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
85 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
86 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
87 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
88 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
89 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
90 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
91 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
92 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
93 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
94 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
95 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
96 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
97 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
98 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
99 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
100 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
101 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
102 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
103 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
104 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
105 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
106 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
107 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
108 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
109 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
118 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
120 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
121 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
122 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
123 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
124 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
125 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
126 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
127 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
128 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
129 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
130 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
131 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
132 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
133 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
134 2643221638 Duganella sp. Root336D2 Isolate Unclassified
135 2643221645 Massilia sp. Root351 Isolate Unclassified
136 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
137 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
138 2831864461 Roseateles noduli HZ7 Isolate Nodule
139 2842733646 Variovorax sp. R-72446 Isolate Unclassified
140 2857558681 Duganella sp. R-74565 Isolate Unclassified
141 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
142 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
143 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
144 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
145 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
146 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
147 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.03
Metatranscriptomes 0
Isolates 7.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 35.46
Nodule 1.99
Rhizoplane 0.8
Rhizosphere 51.39
Stem 0
Stem Tuber 0
Unclassified 0.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1008298 3300002987 Bacteria 2869
2 JGI25159J45721_1000762 3300002987 Bacteria 13974
3 JGI25159J45721_1007432 3300002987 Bacteria 3142
4 JGI25151J46595_10006500 3300003187 Bacteria 5866
5 rootH1_10020578 3300003323 Bacteria 7733
6 JGI25160J50197_1001081 3300003354 Bacteria 13974
7 JGI25161J50226_1000453 3300003374 Bacteria 19004
8 JGI25404J52841_10001798 3300003659 Bacteria 3891
9 Ga0055526_1001407 3300003771 Bacteria 17108
10 Ga0055526_1001803 3300003771 Bacteria 14831
11 Ga0055526_1003661 3300003771 Bacteria 9614
12 Ga0055526_1004573 3300003771 Bacteria 8254
13 Ga0055526_1005778 3300003771 Bacteria 6973
14 Ga0055526_1016553 3300003771 Bacteria 2875
15 Ga0055537_1000179 3300003773 Bacteria 47132
16 Ga0055537_1002355 3300003773 Bacteria 6417
17 Ga0055537_1003892 3300003773 Bacteria 4445
18 Ga0055524_1000008 3300003775 Bacteria 297761
19 Ga0055524_1000647 3300003775 Bacteria 24696
20 Ga0055524_1002942 3300003775 Bacteria 8492
21 Ga0055524_1007978 3300003775 Bacteria 4443
22 Ga0055524_1017962 3300003775 Bacteria 2476
23 Ga0055534_1000495 3300003784 Bacteria 21714
24 Ga0055534_1001187 3300003784 Bacteria 10953
25 Ga0055534_1003337 3300003784 Bacteria 5083
26 Ga0055534_1003464 3300003784 Bacteria 4950
27 Ga0055528_1000119 3300003790 Bacteria 62428
28 Ga0055530_10001373 3300003791 Bacteria 18061
29 Ga0055530_10007268 3300003791 Bacteria 4702
30 Ga0055531_10000117 3300003794 Bacteria 88276
31 Ga0055531_10000577 3300003794 Bacteria 31960
32 Ga0055543_1001425 3300004625 Bacteria 9508
33 Ga0065165_1000005 3300005262 Bacteria 370361
34 Ga0065165_1000241 3300005262 Bacteria 93644
35 Ga0065165_1000270 3300005262 Bacteria 88828
36 Ga0065165_1001994 3300005262 Bacteria 19150
37 Ga0070709_10069841 3300005434 Unclassified 2263
38 Ga0068853_100043456 3300005539 Bacteria 3844
39 Ga0070665_100122010 3300005548 Bacteria 2608
40 Ga0068860_100043446 3300005843 Bacteria 4287
41 Ga0081540_1000028 3300005983 Bacteria 150331
42 Ga0081540_1000242 3300005983 Bacteria 57393
43 Ga0081540_1000425 3300005983 Bacteria 41644
44 Ga0075366_10007748 3300006195 Bacteria 5945
45 Ga0075366_10040239 3300006195 Bacteria 2764
46 Ga0075436_100071818 3300006914 Unclassified 2394
47 Ga0099826_10000001 3300006948 Bacteria 1155201
48 Ga0099826_10000004 3300006948 Bacteria 802669
49 Ga0099794_10007896 3300007265 Bacteria 4398
50 Ga0099795_10005657 3300007788 Bacteria 3347
51 Ga0105248_10010778 3300009177 Bacteria 10091
52 Ga0105239_10060482 3300010375 Bacteria 4158
53 Ga0157369_10023051 3300013105 Bacteria 6939
54 Ga0182008_10000969 3300014497 Bacteria 19939
55 Ga0182005_1002044 3300015265 Bacteria 7559
56 Ga0213872_10000001 3300021361 Bacteria 662532
57 Ga0213872_10000028 3300021361 Bacteria 148766
58 Ga0213872_10000101 3300021361 Bacteria 79972
59 Ga0213872_10000743 3300021361 Bacteria 24099
60 Ga0213872_10010160 3300021361 Bacteria 4488
61 Ga0209436_100049 3300025208 Bacteria 66162
62 Ga0209436_101577 3300025208 Bacteria 7689
63 Ga0207425_1000033 3300025245 Bacteria 245540
64 Ga0209129_1005741 3300025258 Bacteria 4263
65 Ga0209565_1000003 3300025263 Bacteria 1099648
66 Ga0209565_1000066 3300025263 Bacteria 173062
67 Ga0209565_1000162 3300025263 Bacteria 89049
68 Ga0209565_1000383 3300025263 Bacteria 37599
69 Ga0209565_1000474 3300025263 Bacteria 29679
70 Ga0209565_1004965 3300025263 Bacteria 3951
71 Ga0209565_1008582 3300025263 Bacteria 2654
72 Ga0209673_1000003 3300025273 Bacteria 980859
73 Ga0209673_1011380 3300025273 Bacteria 3673
74 Ga0209130_1000084 3300025284 Bacteria 160070
75 Ga0209130_1000438 3300025284 Bacteria 44389
76 Ga0209130_1001623 3300025284 Bacteria 13881
77 Ga0209675_1000003 3300025291 Bacteria 1003982
78 Ga0209675_1000050 3300025291 Bacteria 212222
79 Ga0209675_1000437 3300025291 Bacteria 33080
80 Ga0209675_1000713 3300025291 Bacteria 22701
81 Ga0209675_1003385 3300025291 Bacteria 7601
82 Ga0209675_1010636 3300025291 Bacteria 3122
83 Ga0209025_1001993 3300025294 Bacteria 23406
84 Ga0209564_1000003 3300025295 Bacteria 1585848
85 Ga0209564_1000012 3300025295 Bacteria 792078
86 Ga0209564_1000095 3300025295 Bacteria 237896
87 Ga0209564_1001394 3300025295 Bacteria 25173
88 Ga0209564_1001787 3300025295 Bacteria 19890
89 Ga0209564_1005141 3300025295 Bacteria 7602
90 Ga0209758_1020248 3300025297 Bacteria 3158
91 Ga0209050_1000011 3300025298 Bacteria 914037
92 Ga0209050_1000138 3300025298 Bacteria 173923
93 Ga0209050_1000221 3300025298 Bacteria 126843
94 Ga0209050_1002638 3300025298 Bacteria 14724
95 Ga0209050_1003183 3300025298 Bacteria 12452
96 Ga0209256_1000005 3300025299 Bacteria 1315082
97 Ga0209256_1000255 3300025299 Bacteria 94783
98 Ga0209256_1000295 3300025299 Bacteria 87239
99 Ga0209256_1002521 3300025299 Bacteria 14711
100 Ga0209256_1008838 3300025299 Bacteria 4558
101 Ga0207426_1001590 3300025302 Bacteria 18203
102 Ga0209257_1000003 3300025304 Bacteria 1702593
103 Ga0209257_1000047 3300025304 Bacteria 460507
104 Ga0207678_10097750 3300026067 Bacteria 2509
105 Ga0207641_10083737 3300026088 Bacteria 2775
106 Ga0207674_10058543 3300026116 Bacteria 3902
107 Ga0209282_1000001 3300027666 Bacteria 2450367
108 Ga0209282_1000035 3300027666 Bacteria 137066
109 Ga0307517_10000360 3300028786 Bacteria 78173
110 Ga0307515_10020644 3300028794 Bacteria 11734
111 Ga0307515_10033580 3300028794 Bacteria 8438
112 Ga0307515_10033876 3300028794 Bacteria 8391
113 Ga0307515_10115007 3300028794 Bacteria 3104
114 Ga0265332_10009765 3300031238 Bacteria 4282
115 Ga0307509_10003935 3300031507 Bacteria 21930
116 Ga0307509_10016418 3300031507 Bacteria 8569
117 Ga0307408_100000530 3300031548 Bacteria 32976
118 Ga0307508_10003788 3300031616 Bacteria 15120
119 Ga0307510_10000008 3300033180 Bacteria 433990
120 Ga0395899_0001281 3300037312 Bacteria 21785
121 Ga0395900_0002372 3300037418 Bacteria 20818
122 Ga0395900_0012591 3300037418 Bacteria 8654
123 Ga0395900_0027324 3300037418 Bacteria 5844
124 Ga0395900_0040062 3300037418 Bacteria 4828
125 Ga0395898_0019650 3300037466 Bacteria 6872
126 Ga0395905_0010663 3300037471 Bacteria 8913
127 Ga0395905_0011853 3300037471 Bacteria 8415
128 Ga0395901_0001654 3300038443 Bacteria 23028
129 Ga0395901_0002320 3300038443 Bacteria 19379
130 Ga0395901_0034689 3300038443 Bacteria 5212
131 Ga0395901_0139592 3300038443 Bacteria 2547
132 Ga0436361_0148264 3300039447 Bacteria 57652
133 Ga0436361_0194707 3300039447 Bacteria 11860
134 Ga0436361_0213400 3300039447 Bacteria 127007
135 Ga0436361_0420505 3300039447 Bacteria 103715
136 Ga0436361_0506842 3300039447 Bacteria 7683
137 Ga0436361_0529332 3300039447 Bacteria 100222
138 Ga0436361_1161562 3300039447 Bacteria 16490
139 Ga0451577_0000001 3300042876 Bacteria 2461803
140 Ga0495617_002001 3300046452 Bacteria 8489
141 Ga0495638_0010690 3300046460 Bacteria 6356
142 Ga0495650_0000772 3300046471 Bacteria 39497
143 Ga0495605_0000107 3300046474 Bacteria 105085
144 Ga0495605_0001245 3300046474 Bacteria 16946
145 Ga0495605_0002911 3300046474 Bacteria 10385
146 Ga0495585_0020196 3300046492 Bacteria 3832
147 Ga0495607_0013106 3300046501 Bacteria 5443
148 Ga0495607_0015863 3300046501 Bacteria 4872
149 Ga0495607_0025807 3300046501 Bacteria 3651
150 Ga0495583_0000021 3300046506 Bacteria 287046
151 Ga0495583_0024176 3300046506 Bacteria 3058
152 Ga0495606_0000449 3300046507 Bacteria 67234
153 Ga0495610_0005025 3300046512 Bacteria 9569
154 Ga0495616_0003203 3300046513 Bacteria 10552
155 Ga0495616_0004333 3300046513 Bacteria 8961
156 Ga0495637_0008004 3300046520 Bacteria 5207
157 Ga0495643_0000193 3300046522 Bacteria 96406
158 Ga0495644_0000347 3300046523 Bacteria 21047
159 Ga0495644_0010387 3300046523 Bacteria 3589
160 Ga0495644_0010644 3300046523 Bacteria 3543
161 Ga0495648_0000571 3300046524 Bacteria 39432
162 Ga0495666_0002097 3300046526 Bacteria 9881
163 Ga0495609_0001728 3300046538 Bacteria 14123
164 Ga0495609_0018187 3300046538 Bacteria 3258
165 Ga0495622_0000010 3300046557 Bacteria 212375
166 Ga0495622_0000103 3300046557 Bacteria 74095
167 Ga0495622_0001808 3300046557 Bacteria 10534
168 Ga0495633_0008380 3300046558 Bacteria 5832
169 Ga0495656_0005979 3300046615 Bacteria 4234
170 Ga0495656_0032035 3300046615 Bacteria 2136
171 Ga0495668_0000006 3300046616 Bacteria 553404
172 Ga0495611_0002250 3300046648 Bacteria 8956
173 Ga0495625_0002180 3300046660 Bacteria 21737
174 Ga0495625_0003911 3300046660 Bacteria 14356
175 Ga0495625_0040027 3300046660 Bacteria 3421
176 Ga0495659_0000247 3300046664 Bacteria 22323
177 Ga0495670_0005178 3300046691 Bacteria 6416
178 Ga0495670_0009397 3300046691 Bacteria 4806
179 Ga0495671_0000408 3300046692 Bacteria 34520
180 Ga0495671_0053705 3300046692 Bacteria 1999
181 Ga0495660_0000339 3300046810 Bacteria 41484
182 Ga0495604_0005235 3300047317 Bacteria 10274
183 Ga0495636_0001944 3300047318 Bacteria 7915
184 Ga0495672_0000030 3300047320 Bacteria 305021
185 Ga0495672_0010796 3300047320 Bacteria 6483
186 Ga0495676_0001852 3300047321 Bacteria 18563
187 Ga0495687_000245 3300047443 Bacteria 73990
188 Ga0495677_0007234 3300047445 Bacteria 4153
189 Ga0495677_0008791 3300047445 Bacteria 3743
190 Ga0495685_000290 3300047447 Bacteria 16765
191 Ga0495673_0000015 3300047469 Bacteria 598766
192 Ga0495686_0001699 3300047472 Bacteria 22746
193 Ga0495686_0007795 3300047472 Bacteria 7966
194 Ga0495593_0002413 3300047673 Bacteria 11238
195 Ga0496104_0036907 3300048907 Bacteria 4569
196 Ga0496112_0027578 3300048915 Bacteria 5476
197 Ga0496116_0015710 3300048919 Bacteria 5969
198 Ga0496117_0015903 3300048920 Bacteria 6375
199 Ga0496118_0018007 3300048921 Bacteria 6398
200 Ga0496121_0000738 3300048924 Bacteria 60238
201 Ga0495678_000115 3300049459 Bacteria 96173
202 Ga0495678_000872 3300049459 Bacteria 26844
203 Ga0495682_0000370 3300049460 Bacteria 32590
204 Ga0495682_0000580 3300049460 Bacteria 24795
205 Ga0501292_001588 3300049515 Bacteria 2816
206 Ga0501032_0003405 3300049569 Bacteria 12180
207 Ga0501033_0007445 3300049570 Bacteria 8526
208 Ga0501033_0029992 3300049570 Bacteria 4088
209 Ga0501034_0038575 3300049571 Bacteria 4837
210 Ga0501034_0043213 3300049571 Bacteria 4562
211 Ga0501037_0000670 3300049573 Bacteria 26232
212 Ga0501043_0000058 3300049579 Bacteria 102030
213 Ga0501043_0001095 3300049579 Bacteria 23800
214 Ga0501046_0000051 3300049580 Bacteria 133545
215 Ga0501046_0003593 3300049580 Bacteria 14205
216 Ga0501047_0000003 3300049581 Bacteria 508375
217 Ga0501047_0058607 3300049581 Bacteria 3719
218 Ga0501048_0002735 3300049582 Bacteria 13443
219 Ga0501262_002070 3300049759 Bacteria 2265
220 Ga0501035_0004913 3300049822 Bacteria 12685
221 Ga0501044_0020376 3300049823 Bacteria 7081
222 nmdc:mga00v17_39071_c1 3300050491 Bacteria 2840
223 Ga0500643_006595 3300053087 Bacteria 4827
224 Ga0500571_000206 3300053110 Bacteria 21640
225 Ga0500593_000877 3300053117 Bacteria 11177
226 Ga0500655_000447 3300053133 Bacteria 8449
227 Ga0500564_003965 3300053138 Bacteria 5846
228 Ga0500586_000422 3300053145 Bacteria 8489
229 Ga0500619_000019 3300053154 Bacteria 52899
230 Ga0500622_0005681 3300053156 Bacteria 7415
231 Ga0500622_0024015 3300053156 Bacteria 3226
232 2587727647 2585428057 Bacteria 6737412
233 2587733026 2585428058 Bacteria 6853932
234 2643787916 2643221554 Bacteria 6603920
235 2643969462 2643221592 Bacteria 6608788
236 2644143762 2643221625 Bacteria 6512927
237 2644212046 2643221638 Bacteria 6579467
238 2644253212 2643221645 Bacteria 7207331
239 2644276532 2643221648 Bacteria 6521465
240 2739611641 2739367655 Bacteria 4051151
241 2831867488 2831864461 Bacteria 6502356
242 2842734769 2842733646 Bacteria 5716726
243 2857562769 2857558681 Bacteria 6617694
244 2881928546 2881927736 Bacteria 3993927
245 2887377528 2887375801 Bacteria 5334027
246 2895513989 2895511927 Bacteria 6802080
247 2901310423 2901300506 Bacteria 8463898
248 2928157826 2928157003 Bacteria 7522202
249 8002392876 8002392321 Bacteria 4159911
250 8002395258 8002392321 Bacteria 4159911
251 8048747060 8048746797 Bacteria 3557226
252 JGI25159J45721_1008298
253 JGI25159J45721_1000762
254 JGI25159J45721_1007432
255 JGI25151J46595_10006500
256 rootH1_10020578
257 JGI25160J50197_1001081
258 JGI25161J50226_1000453
259 JGI25404J52841_10001798
260 Ga0055526_1001407
261 Ga0055526_1001803
262 Ga0055526_1003661
263 Ga0055526_1004573
264 Ga0055526_1005778
265 Ga0055526_1016553
266 Ga0055537_1000179
267 Ga0055537_1002355
268 Ga0055537_1003892
269 Ga0055524_1000008
270 Ga0055524_1000647
271 Ga0055524_1002942
272 Ga0055524_1007978
273 Ga0055524_1017962
274 Ga0055534_1000495
275 Ga0055534_1001187
276 Ga0055534_1003337
277 Ga0055534_1003464
278 Ga0055528_1000119
279 Ga0055530_10001373
280 Ga0055530_10007268
281 Ga0055531_10000117
282 Ga0055531_10000577
283 Ga0055543_1001425
284 Ga0065165_1000005
285 Ga0065165_1000241
286 Ga0065165_1000270
287 Ga0065165_1001994
288 Ga0070709_10069841
289 Ga0068853_100043456
290 Ga0070665_100122010
291 Ga0068860_100043446
292 Ga0081540_1000028
293 Ga0081540_1000242
294 Ga0081540_1000425
295 Ga0075366_10007748
296 Ga0075366_10040239
297 Ga0075436_100071818
298 Ga0099826_10000001
299 Ga0099826_10000004
300 Ga0099794_10007896
301 Ga0099795_10005657
302 Ga0105248_10010778
303 Ga0105239_10060482
304 Ga0157369_10023051
305 Ga0182008_10000969
306 Ga0182005_1002044
307 Ga0213872_10000001
308 Ga0213872_10000028
309 Ga0213872_10000101
310 Ga0213872_10000743
311 Ga0213872_10010160
312 Ga0209436_100049
313 Ga0209436_101577
314 Ga0207425_1000033
315 Ga0209129_1005741
316 Ga0209565_1000003
317 Ga0209565_1000066
318 Ga0209565_1000162
319 Ga0209565_1000383
320 Ga0209565_1000474
321 Ga0209565_1004965
322 Ga0209565_1008582
323 Ga0209673_1000003
324 Ga0209673_1011380
325 Ga0209130_1000084
326 Ga0209130_1000438
327 Ga0209130_1001623
328 Ga0209675_1000003
329 Ga0209675_1000050
330 Ga0209675_1000437
331 Ga0209675_1000713
332 Ga0209675_1003385
333 Ga0209675_1010636
334 Ga0209025_1001993
335 Ga0209564_1000003
336 Ga0209564_1000012
337 Ga0209564_1000095
338 Ga0209564_1001394
339 Ga0209564_1001787
340 Ga0209564_1005141
341 Ga0209758_1020248
342 Ga0209050_1000011
343 Ga0209050_1000138
344 Ga0209050_1000221
345 Ga0209050_1002638
346 Ga0209050_1003183
347 Ga0209256_1000005
348 Ga0209256_1000255
349 Ga0209256_1000295
350 Ga0209256_1002521
351 Ga0209256_1008838
352 Ga0207426_1001590
353 Ga0209257_1000003
354 Ga0209257_1000047
355 Ga0207678_10097750
356 Ga0207641_10083737
357 Ga0207674_10058543
358 Ga0209282_1000001
359 Ga0209282_1000035
360 Ga0307517_10000360
361 Ga0307515_10020644
362 Ga0307515_10033580
363 Ga0307515_10033876
364 Ga0307515_10115007
365 Ga0265332_10009765
366 Ga0307509_10003935
367 Ga0307509_10016418
368 Ga0307408_100000530
369 Ga0307508_10003788
370 Ga0307510_10000008
371 Ga0395899_0001281
372 Ga0395900_0002372
373 Ga0395900_0012591
374 Ga0395900_0027324
375 Ga0395900_0040062
376 Ga0395898_0019650
377 Ga0395905_0010663
378 Ga0395905_0011853
379 Ga0395901_0001654
380 Ga0395901_0002320
381 Ga0395901_0034689
382 Ga0395901_0139592
383 Ga0436361_0148264
384 Ga0436361_0194707
385 Ga0436361_0213400
386 Ga0436361_0420505
387 Ga0436361_0506842
388 Ga0436361_0529332
389 Ga0436361_1161562
390 Ga0451577_0000001
391 Ga0495617_002001
392 Ga0495638_0010690
393 Ga0495650_0000772
394 Ga0495605_0000107
395 Ga0495605_0001245
396 Ga0495605_0002911
397 Ga0495585_0020196
398 Ga0495607_0013106
399 Ga0495607_0015863
400 Ga0495607_0025807
401 Ga0495583_0000021
402 Ga0495583_0024176
403 Ga0495606_0000449
404 Ga0495610_0005025
405 Ga0495616_0003203
406 Ga0495616_0004333
407 Ga0495637_0008004
408 Ga0495643_0000193
409 Ga0495644_0000347
410 Ga0495644_0010387
411 Ga0495644_0010644
412 Ga0495648_0000571
413 Ga0495666_0002097
414 Ga0495609_0001728
415 Ga0495609_0018187
416 Ga0495622_0000010
417 Ga0495622_0000103
418 Ga0495622_0001808
419 Ga0495633_0008380
420 Ga0495656_0005979
421 Ga0495656_0032035
422 Ga0495668_0000006
423 Ga0495611_0002250
424 Ga0495625_0002180
425 Ga0495625_0003911
426 Ga0495625_0040027
427 Ga0495659_0000247
428 Ga0495670_0005178
429 Ga0495670_0009397
430 Ga0495671_0000408
431 Ga0495671_0053705
432 Ga0495660_0000339
433 Ga0495604_0005235
434 Ga0495636_0001944
435 Ga0495672_0000030
436 Ga0495672_0010796
437 Ga0495676_0001852
438 Ga0495687_000245
439 Ga0495677_0007234
440 Ga0495677_0008791
441 Ga0495685_000290
442 Ga0495673_0000015
443 Ga0495686_0001699
444 Ga0495686_0007795
445 Ga0495593_0002413
446 Ga0496104_0036907
447 Ga0496112_0027578
448 Ga0496116_0015710
449 Ga0496117_0015903
450 Ga0496118_0018007
451 Ga0496121_0000738
452 Ga0495678_000115
453 Ga0495678_000872
454 Ga0495682_0000370
455 Ga0495682_0000580
456 Ga0501292_001588
457 Ga0501032_0003405
458 Ga0501033_0007445
459 Ga0501033_0029992
460 Ga0501034_0038575
461 Ga0501034_0043213
462 Ga0501037_0000670
463 Ga0501043_0000058
464 Ga0501043_0001095
465 Ga0501046_0000051
466 Ga0501046_0003593
467 Ga0501047_0000003
468 Ga0501047_0058607
469 Ga0501048_0002735
470 Ga0501262_002070
471 Ga0501035_0004913
472 Ga0501044_0020376
473 nmdc:mga00v17_39071_c1
474 Ga0500643_006595
475 Ga0500571_000206
476 Ga0500593_000877
477 Ga0500655_000447
478 Ga0500564_003965
479 Ga0500586_000422
480 Ga0500619_000019
481 Ga0500622_0005681
482 Ga0500622_0024015
483 2587727647
484 2587733026
485 2643787916
486 2643969462
487 2644143762
488 2644212046
489 2644253212
490 2644276532
491 2739611641
492 2831867488
493 2842734769
494 2857562769
495 2881928546
496 2887377528
497 2895513989
498 2901310423
499 2928157826
500 8002392876
501 8002395258
502 8048747060

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00115

COX1

Cytochrome C and Quinol oxidase polypeptide I

98

513

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mk7-assembly4.cif.gz_K the structure of cbb3 cytochrome oxidase 0.9655 94 525
8snh-assembly1.cif.gz_E cytochrome bc1-cbb3 supercomplex from pseudomonas aeruginosa 0.9646 97 528
6xkw-assembly1.cif.gz_n r. capsulatus ciii2civ bipartite super-complex (sc-2a) with ccoh/cy 0.9262 92 529
3mk7-assembly4.cif.gz_K the structure of cbb3 cytochrome oxidase 0.8966 94 525
8snh-assembly1.cif.gz_E cytochrome bc1-cbb3 supercomplex from pseudomonas aeruginosa 0.89 97 528
ID Description Score Start End Superfamily
5djqA00 Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain 0.9634 92 524 1.20.210.10
5djqA00 Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain 0.8948 92 524 1.20.210.10
4xydA00 Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain 0.858 94 530 1.20.210.10
af_Q7HP04_41_512_1.20.210.10 Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain 0.8416 90 515 1.20.210.10
4xydA00 Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain 0.8416 94 530 1.20.210.10
ID Description Score Start End GO Terms
AF-A0A1I7YPX9-F1-model_v4 Cytochrome c oxidase subunit 1 (Cytochrome c oxidase polypeptide I) 0.9793 70 458 GO:0004129
GO:0006119
GO:0016020
GO:0020037
GO:0046872
AF-A0A1H1QXI6-F1-model_v4 Cytochrome c oxidase cbb3-type subunit 1 0.9778 84 523 GO:0004129
GO:0009060
GO:0016020
GO:0020037
AF-A0A0P7DCY6-F1-model_v4 Uncharacterized protein 0.9777 169 336 GO:0004129
GO:0006119
GO:0016020
GO:0020037
AF-A0A5Q4FHT4-F1-model_v4 Cytochrome oxidase subunit I profile domain-containing protein 0.977 89 374 GO:0004129
GO:0009060
GO:0016020
GO:0020037
AF-A0A2E5K535-F1-model_v4 Cytochrome oxidase subunit I profile domain-containing protein 0.976 85 522 GO:0004129
GO:0009060
GO:0016020
GO:0020037

Map