F362191

General Info

Members Datasets Scaffolds Average Seq Length
251 170 502 144

Family's Representative Sequence

Representative Sequence 3300005345|Ga0070692_10243804|Ga0070692_102438041
Length 156
Sequence MTSRRSAAPDMNMEERIHDYIAGQPERKRDDMRALHRLILQVSPDCALWFLDGKDDEGKTISNNPNIGYGRQPIRYAGGKSREFYRIGLSANTTGLSIYIIGIEDKKYLAEAYGQRLGKASVTGYCIKFRTLSDIDRGVLEEAIRFGFEARNETQA

Samples

Sample ID Description Type Environment
1 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
74 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
75 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
76 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
77 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
78 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
116 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
117 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
118 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
119 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
120 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
121 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
122 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
123 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
124 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
125 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
126 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
127 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
128 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
129 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
130 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
131 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
132 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
133 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
134 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
135 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
136 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
137 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
138 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
139 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
140 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
141 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
142 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
145 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
146 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
151 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
152 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
153 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
154 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
155 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
156 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
157 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
158 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
159 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
160 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
161 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
162 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
163 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
164 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
165 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
166 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
167 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
168 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
169 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
170 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.6
Metatranscriptomes 0
Isolates 0.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.36
Nodule 0
Rhizoplane 1.2
Rhizosphere 82.47
Stem 0
Stem Tuber 0
Unclassified 6.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070692_10243804 3300005345 Bacteria 1072
2 JGI24739J22299_10007462 3300001989 Bacteria 4102
3 JGI25162J39368_1002277 3300002737 Bacteria 7743
4 JGI25162J39368_1011705 3300002737 Bacteria 1041
5 JGI25164J39214_1000784 3300002772 Bacteria 11493
6 JGI25165J46597_1001820 3300003214 Bacteria 8933
7 JGI25165J46597_1002311 3300003214 Bacteria 6492
8 JGI25165J46597_1012208 3300003214 Bacteria 1207
9 rootH2_10024170 3300003320 Bacteria 19128
10 rootH2_10027345 3300003320 Bacteria 2699
11 rootH2_10116827 3300003320 Bacteria 2479
12 rootH1_10174316 3300003323 Bacteria 4135
13 rootH1_10306491 3300003323 Bacteria 1130
14 Ga0065715_10452727 3300005293 Bacteria 815
15 Ga0065715_10573389 3300005293 Bacteria 722
16 Ga0065707_10230928 3300005295 Unclassified 1189
17 Ga0070658_10001115 3300005327 Bacteria 22930
18 Ga0070658_11498447 3300005327 Bacteria 585
19 Ga0070676_10170732 3300005328 Bacteria 1406
20 Ga0070690_100069455 3300005330 Bacteria 2286
21 Ga0068869_100943827 3300005334 Bacteria 748
22 Ga0070666_10020331 3300005335 Bacteria 4291
23 Ga0070666_10152366 3300005335 Bacteria 1613
24 Ga0070666_11514422 3300005335 Bacteria 502
25 Ga0070682_100856973 3300005337 Bacteria 743
26 Ga0068868_100011667 3300005338 Bacteria 6400
27 Ga0068868_100076905 3300005338 Bacteria 2669
28 Ga0070660_100089663 3300005339 Bacteria 2423
29 Ga0070687_100076261 3300005343 Bacteria 1815
30 Ga0070668_100232823 3300005347 Bacteria 1523
31 Ga0070668_100788693 3300005347 Bacteria 843
32 Ga0070669_100002975 3300005353 Bacteria 12214
33 Ga0070675_100747141 3300005354 Bacteria 892
34 Ga0070674_100048788 3300005356 Bacteria 2907
35 Ga0070674_101380682 3300005356 Unclassified 630
36 Ga0070673_100002890 3300005364 Bacteria 10572
37 Ga0070659_101409062 3300005366 Bacteria 620
38 Ga0070713_100075031 3300005436 Bacteria 2867
39 Ga0070678_100259620 3300005456 Bacteria 1460
40 Ga0070662_100917433 3300005457 Bacteria 748
41 Ga0070662_101160155 3300005457 Bacteria 663
42 Ga0068867_101688847 3300005459 Bacteria 593
43 Ga0070707_100826500 3300005468 Bacteria 890
44 Ga0070684_100898049 3300005535 Bacteria 830
45 Ga0068853_100416315 3300005539 Bacteria 1260
46 Ga0068853_100818889 3300005539 Bacteria 892
47 Ga0068853_100841043 3300005539 Bacteria 880
48 Ga0070672_100034125 3300005543 Bacteria 3860
49 Ga0070672_100947610 3300005543 Bacteria 761
50 Ga0070686_100418669 3300005544 Bacteria 1023
51 Ga0070665_100000017 3300005548 Bacteria 448013
52 Ga0070665_100982579 3300005548 Bacteria 856
53 Ga0070704_101027078 3300005549 Bacteria 746
54 Ga0068855_100044241 3300005563 Bacteria 5270
55 Ga0068855_100159745 3300005563 Bacteria 2559
56 Ga0068855_100448626 3300005563 Bacteria 1408
57 Ga0068854_100876874 3300005578 Bacteria 787
58 Ga0068854_101017128 3300005578 Bacteria 734
59 Ga0068854_101133891 3300005578 Bacteria 698
60 Ga0068856_100051606 3300005614 Bacteria 4055
61 Ga0068852_100028241 3300005616 Bacteria 4588
62 Ga0068852_101535586 3300005616 Bacteria 688
63 Ga0068859_100006660 3300005617 Bacteria 11729
64 Ga0068859_102037660 3300005617 Bacteria 634
65 Ga0068866_10551452 3300005718 Bacteria 771
66 Ga0068870_10029349 3300005840 Bacteria 2769
67 Ga0068858_100377839 3300005842 Bacteria 1359
68 Ga0068858_100728302 3300005842 Bacteria 966
69 Ga0068860_101354335 3300005843 Bacteria 733
70 Ga0075365_11004447 3300006038 Unclassified 588
71 Ga0075370_10427237 3300006353 Bacteria 796
72 Ga0068871_101278476 3300006358 Bacteria 690
73 Ga0068865_100000107 3300006881 Bacteria 43014
74 Ga0068865_100017689 3300006881 Bacteria 4588
75 Ga0097620_100006660 3300006931 Bacteria 11729
76 Ga0097620_102037622 3300006931 Bacteria 634
77 Ga0105240_10001376 3300009093 Bacteria 41811
78 Ga0105245_10001064 3300009098 Bacteria 24872
79 Ga0105245_10060300 3300009098 Bacteria 3417
80 Ga0105245_10069967 3300009098 Bacteria 3183
81 Ga0105245_10475750 3300009098 Bacteria 1262
82 Ga0105247_11066599 3300009101 Unclassified 635
83 Ga0105243_10326206 3300009148 Bacteria 1401
84 Ga0105243_11072688 3300009148 Bacteria 812
85 Ga0105243_11363769 3300009148 Bacteria 728
86 Ga0105241_10022398 3300009174 Bacteria 4680
87 Ga0105241_10124079 3300009174 Bacteria 2083
88 Ga0105241_10862183 3300009174 Bacteria 838
89 Ga0105242_10009079 3300009176 Bacteria 7636
90 Ga0105248_10000003 3300009177 Bacteria 1019601
91 Ga0105237_10063659 3300009545 Bacteria 3686
92 Ga0105237_10199168 3300009545 Bacteria 2002
93 Ga0105237_11077178 3300009545 Bacteria 810
94 Ga0105238_12472613 3300009551 Bacteria 555
95 Ga0105239_10036854 3300010375 Bacteria 5365
96 Ga0105239_10273828 3300010375 Bacteria 1899
97 Ga0105239_12086342 3300010375 Unclassified 659
98 Ga0105246_11078711 3300011119 Bacteria 732
99 Ga0157371_10063821 3300013102 Bacteria 2611
100 Ga0157374_10337641 3300013296 Bacteria 1495
101 Ga0157374_10584920 3300013296 Bacteria 1126
102 Ga0157378_10049668 3300013297 Bacteria 3732
103 Ga0157378_10088169 3300013297 Bacteria 2816
104 Ga0163162_10000051 3300013306 Bacteria 117695
105 Ga0163162_10426806 3300013306 Bacteria 1458
106 Ga0163162_11016749 3300013306 Bacteria 937
107 Ga0163162_12075181 3300013306 Unclassified 652
108 Ga0157372_10135437 3300013307 Bacteria 2836
109 Ga0157372_10201603 3300013307 Bacteria 2305
110 Ga0157372_10227783 3300013307 Bacteria 2161
111 Ga0157375_10038419 3300013308 Bacteria 4597
112 Ga0163163_10648503 3300014325 Unclassified 1119
113 Ga0163163_10672000 3300014325 Bacteria 1099
114 Ga0157380_10848784 3300014326 Bacteria 935
115 Ga0157377_10102480 3300014745 Bacteria 1708
116 Ga0157379_10546093 3300014968 Bacteria 1078
117 Ga0157379_10853256 3300014968 Bacteria 862
118 Ga0157376_11304441 3300014969 Bacteria 756
119 Ga0163161_10696972 3300017792 Bacteria 845
120 Ga0213876_10023427 3300021384 Unclassified 3262
121 Ga0207427_100305 3300025231 Bacteria 34164
122 Ga0207427_106624 3300025231 Bacteria 1446
123 Ga0209437_100020 3300025233 Bacteria 656374
124 Ga0209437_106725 3300025233 Bacteria 1902
125 Ga0209129_1014434 3300025258 Bacteria 1683
126 Ga0209233_1000020 3300025261 Bacteria 798224
127 Ga0209233_1017626 3300025261 Bacteria 1941
128 Ga0209564_1008284 3300025295 Bacteria 5157
129 Ga0207697_10067995 3300025315 Bacteria 1490
130 Ga0207642_10076879 3300025899 Bacteria 1608
131 Ga0207642_10746548 3300025899 Bacteria 619
132 Ga0207688_10031111 3300025901 Bacteria 2945
133 Ga0207680_10285590 3300025903 Bacteria 1147
134 Ga0207680_10905720 3300025903 Bacteria 632
135 Ga0207647_10403591 3300025904 Bacteria 770
136 Ga0207647_10408347 3300025904 Bacteria 764
137 Ga0207645_10000088 3300025907 Bacteria 65894
138 Ga0207645_10255928 3300025907 Bacteria 1159
139 Ga0207643_10013068 3300025908 Bacteria 4489
140 Ga0207705_10001091 3300025909 Bacteria 22077
141 Ga0207705_10347003 3300025909 Bacteria 1143
142 Ga0207705_10901012 3300025909 Bacteria 685
143 Ga0207654_10074563 3300025911 Bacteria 2025
144 Ga0207654_10081055 3300025911 Bacteria 1953
145 Ga0207695_10014944 3300025913 Bacteria 9161
146 Ga0207695_10048081 3300025913 Bacteria 4508
147 Ga0207671_10005868 3300025914 Bacteria 11154
148 Ga0207662_10095353 3300025918 Bacteria 1836
149 Ga0207657_10005269 3300025919 Bacteria 13547
150 Ga0207657_10662294 3300025919 Unclassified 812
151 Ga0207646_10807298 3300025922 Bacteria 835
152 Ga0207687_10012337 3300025927 Bacteria 5587
153 Ga0207687_10280352 3300025927 Unclassified 1335
154 Ga0207706_10267354 3300025933 Bacteria 1493
155 Ga0207706_10286628 3300025933 Bacteria 1436
156 Ga0207706_11353009 3300025933 Bacteria 586
157 Ga0207686_10058490 3300025934 Bacteria 2430
158 Ga0207686_10361910 3300025934 Bacteria 1095
159 Ga0207709_10126179 3300025935 Bacteria 1736
160 Ga0207669_10656570 3300025937 Bacteria 858
161 Ga0207704_10004331 3300025938 Bacteria 6489
162 Ga0207704_11306735 3300025938 Bacteria 620
163 Ga0207691_10009737 3300025940 Bacteria 9223
164 Ga0207691_10873701 3300025940 Unclassified 753
165 Ga0207691_11193220 3300025940 Bacteria 631
166 Ga0207711_10000012 3300025941 Bacteria 515147
167 Ga0207689_10064033 3300025942 Bacteria 3025
168 Ga0207667_10226120 3300025949 Bacteria 1917
169 Ga0207667_10472589 3300025949 Bacteria 1273
170 Ga0207640_10255247 3300025981 Bacteria 1363
171 Ga0207640_10704231 3300025981 Bacteria 866
172 Ga0207640_11203315 3300025981 Bacteria 674
173 Ga0207639_10008741 3300026041 Bacteria 6956
174 Ga0207639_10684359 3300026041 Bacteria 951
175 Ga0207708_10290078 3300026075 Bacteria 1328
176 Ga0207702_10055979 3300026078 Bacteria 3347
177 Ga0207641_10107060 3300026088 Bacteria 2472
178 Ga0207648_10007201 3300026089 Bacteria 10969
179 Ga0207648_10088911 3300026089 Bacteria 2697
180 Ga0207674_10666181 3300026116 Bacteria 1005
181 Ga0207675_100013829 3300026118 Bacteria 7526
182 Ga0207675_100739654 3300026118 Bacteria 994
183 Ga0207683_10032582 3300026121 Bacteria 4527
184 Ga0207698_10470073 3300026142 Bacteria 1218
185 Ga0268266_10000037 3300028379 Bacteria 342368
186 Ga0268264_11060152 3300028381 Bacteria 818
187 Ga0307515_10000019 3300028794 Bacteria 422262
188 Ga0307515_10072720 3300028794 Bacteria 4633
189 Ga0307513_10999184 3300031456 Unclassified 546
190 Ga0307408_100772105 3300031548 Bacteria 870
191 Ga0307405_10078742 3300031731 Bacteria 2146
192 Ga0307406_10098775 3300031901 Bacteria 1983
193 Ga0307409_100143737 3300031995 Unclassified 2060
194 Ga0307411_10484051 3300032005 Bacteria 1043
195 Ga0307510_10023424 3300033180 Bacteria 7158
196 Ga0373935_0939914 3300035692 Bacteria 641
197 Ga0436364_1057197 3300037853 Bacteria 616
198 Ga0436365_1054924 3300039437 Bacteria 11608
199 Ga0436360_0591757 3300039438 Bacteria 1164
200 Ga0436361_0515442 3300039447 Bacteria 980
201 Ga0451853_0013079 3300041512 Bacteria 660
202 Ga0451853_2967229 3300041512 Bacteria 556
203 Ga0466972_0122383 3300044658 Bacteria 1227
204 Ga0466961_0356182 3300044693 Bacteria 890
205 Ga0466964_0196743 3300044706 Bacteria 965
206 Ga0466960_0154025 3300044901 Bacteria 1230
207 Ga0466959_0115539 3300045049 Bacteria 1912
208 Ga0495617_007403 3300046452 Bacteria 3809
209 Ga0495583_0000005 3300046506 Bacteria 636894
210 Ga0495583_0001019 3300046506 Bacteria 31909
211 Ga0495631_0388260 3300046518 Unclassified 594
212 Ga0495640_0382360 3300046533 Bacteria 866
213 Ga0495586_0607556 3300046535 Bacteria 632
214 Ga0495633_0000074 3300046558 Bacteria 130197
215 Ga0495633_0045105 3300046558 Bacteria 2088
216 Ga0495625_0052911 3300046660 Unclassified 2906
217 Ga0495625_0246708 3300046660 Bacteria 1160
218 Ga0495683_0000453 3300047323 Bacteria 32191
219 Ga0496105_0048807 3300048908 Bacteria 3494
220 Ga0496112_0787059 3300048915 Bacteria 876
221 Ga0496114_0592481 3300048917 Bacteria 978
222 Ga0496120_0088951 3300048923 Bacteria 1654
223 Ga0501036_0035915 3300049572 Bacteria 4193
224 Ga0501037_0942648 3300049573 Bacteria 564
225 Ga0501047_0086393 3300049581 Bacteria 3014
226 Ga0501048_0896410 3300049582 Bacteria 638
227 Ga0501070_0111177 3300049586 Bacteria 2264
228 Ga0501073_0008989 3300049589 Bacteria 7379
229 Ga0501073_0121091 3300049589 Bacteria 1813
230 Ga0501074_0029872 3300049590 Bacteria 3949
231 Ga0501074_0125907 3300049590 Bacteria 1832
232 Ga0501222_051012 3300049662 Bacteria 607
233 Ga0501233_100992 3300049668 Bacteria 763
234 Ga0501257_100757 3300049686 Bacteria 758
235 Ga0501234_018299 3300049707 Bacteria 1109
236 Ga0501079_0024261 3300049741 Bacteria 4654
237 Ga0501080_0146281 3300049742 Bacteria 2184
238 Ga0501035_0011210 3300049822 Bacteria 8303
239 nmdc:mga07m45_612106_c1 3300050496 Bacteria 629
240 nmdc:mga0n895_241419_c1 3300050512 Bacteria 1833
241 Ga0500643_019897 3300053087 Bacteria 2204
242 Ga0500644_0043424 3300053088 Bacteria 1504
243 Ga0500646_0088233 3300053090 Unclassified 956
244 Ga0500595_023628 3300053119 Bacteria 2156
245 Ga0500568_0000992 3300053139 Bacteria 19446
246 Ga0500604_0000015 3300053151 Bacteria 92018
247 Ga0500604_0061810 3300053151 Bacteria 1178
248 Ga0500616_0000080 3300053153 Bacteria 200381
249 Ga0500616_0126339 3300053153 Bacteria 1214
250 Ga0501084_1353791 3300054114 Bacteria 596
251 2586207975 2585427687 Bacteria 5544917
252 Ga0070692_10243804
253 JGI24739J22299_10007462
254 JGI25162J39368_1002277
255 JGI25162J39368_1011705
256 JGI25164J39214_1000784
257 JGI25165J46597_1001820
258 JGI25165J46597_1002311
259 JGI25165J46597_1012208
260 rootH2_10024170
261 rootH2_10027345
262 rootH2_10116827
263 rootH1_10174316
264 rootH1_10306491
265 Ga0065715_10452727
266 Ga0065715_10573389
267 Ga0065707_10230928
268 Ga0070658_10001115
269 Ga0070658_11498447
270 Ga0070676_10170732
271 Ga0070690_100069455
272 Ga0068869_100943827
273 Ga0070666_10020331
274 Ga0070666_10152366
275 Ga0070666_11514422
276 Ga0070682_100856973
277 Ga0068868_100011667
278 Ga0068868_100076905
279 Ga0070660_100089663
280 Ga0070687_100076261
281 Ga0070668_100232823
282 Ga0070668_100788693
283 Ga0070669_100002975
284 Ga0070675_100747141
285 Ga0070674_100048788
286 Ga0070674_101380682
287 Ga0070673_100002890
288 Ga0070659_101409062
289 Ga0070713_100075031
290 Ga0070678_100259620
291 Ga0070662_100917433
292 Ga0070662_101160155
293 Ga0068867_101688847
294 Ga0070707_100826500
295 Ga0070684_100898049
296 Ga0068853_100416315
297 Ga0068853_100818889
298 Ga0068853_100841043
299 Ga0070672_100034125
300 Ga0070672_100947610
301 Ga0070686_100418669
302 Ga0070665_100000017
303 Ga0070665_100982579
304 Ga0070704_101027078
305 Ga0068855_100044241
306 Ga0068855_100159745
307 Ga0068855_100448626
308 Ga0068854_100876874
309 Ga0068854_101017128
310 Ga0068854_101133891
311 Ga0068856_100051606
312 Ga0068852_100028241
313 Ga0068852_101535586
314 Ga0068859_100006660
315 Ga0068859_102037660
316 Ga0068866_10551452
317 Ga0068870_10029349
318 Ga0068858_100377839
319 Ga0068858_100728302
320 Ga0068860_101354335
321 Ga0075365_11004447
322 Ga0075370_10427237
323 Ga0068871_101278476
324 Ga0068865_100000107
325 Ga0068865_100017689
326 Ga0097620_100006660
327 Ga0097620_102037622
328 Ga0105240_10001376
329 Ga0105245_10001064
330 Ga0105245_10060300
331 Ga0105245_10069967
332 Ga0105245_10475750
333 Ga0105247_11066599
334 Ga0105243_10326206
335 Ga0105243_11072688
336 Ga0105243_11363769
337 Ga0105241_10022398
338 Ga0105241_10124079
339 Ga0105241_10862183
340 Ga0105242_10009079
341 Ga0105248_10000003
342 Ga0105237_10063659
343 Ga0105237_10199168
344 Ga0105237_11077178
345 Ga0105238_12472613
346 Ga0105239_10036854
347 Ga0105239_10273828
348 Ga0105239_12086342
349 Ga0105246_11078711
350 Ga0157371_10063821
351 Ga0157374_10337641
352 Ga0157374_10584920
353 Ga0157378_10049668
354 Ga0157378_10088169
355 Ga0163162_10000051
356 Ga0163162_10426806
357 Ga0163162_11016749
358 Ga0163162_12075181
359 Ga0157372_10135437
360 Ga0157372_10201603
361 Ga0157372_10227783
362 Ga0157375_10038419
363 Ga0163163_10648503
364 Ga0163163_10672000
365 Ga0157380_10848784
366 Ga0157377_10102480
367 Ga0157379_10546093
368 Ga0157379_10853256
369 Ga0157376_11304441
370 Ga0163161_10696972
371 Ga0213876_10023427
372 Ga0207427_100305
373 Ga0207427_106624
374 Ga0209437_100020
375 Ga0209437_106725
376 Ga0209129_1014434
377 Ga0209233_1000020
378 Ga0209233_1017626
379 Ga0209564_1008284
380 Ga0207697_10067995
381 Ga0207642_10076879
382 Ga0207642_10746548
383 Ga0207688_10031111
384 Ga0207680_10285590
385 Ga0207680_10905720
386 Ga0207647_10403591
387 Ga0207647_10408347
388 Ga0207645_10000088
389 Ga0207645_10255928
390 Ga0207643_10013068
391 Ga0207705_10001091
392 Ga0207705_10347003
393 Ga0207705_10901012
394 Ga0207654_10074563
395 Ga0207654_10081055
396 Ga0207695_10014944
397 Ga0207695_10048081
398 Ga0207671_10005868
399 Ga0207662_10095353
400 Ga0207657_10005269
401 Ga0207657_10662294
402 Ga0207646_10807298
403 Ga0207687_10012337
404 Ga0207687_10280352
405 Ga0207706_10267354
406 Ga0207706_10286628
407 Ga0207706_11353009
408 Ga0207686_10058490
409 Ga0207686_10361910
410 Ga0207709_10126179
411 Ga0207669_10656570
412 Ga0207704_10004331
413 Ga0207704_11306735
414 Ga0207691_10009737
415 Ga0207691_10873701
416 Ga0207691_11193220
417 Ga0207711_10000012
418 Ga0207689_10064033
419 Ga0207667_10226120
420 Ga0207667_10472589
421 Ga0207640_10255247
422 Ga0207640_10704231
423 Ga0207640_11203315
424 Ga0207639_10008741
425 Ga0207639_10684359
426 Ga0207708_10290078
427 Ga0207702_10055979
428 Ga0207641_10107060
429 Ga0207648_10007201
430 Ga0207648_10088911
431 Ga0207674_10666181
432 Ga0207675_100013829
433 Ga0207675_100739654
434 Ga0207683_10032582
435 Ga0207698_10470073
436 Ga0268266_10000037
437 Ga0268264_11060152
438 Ga0307515_10000019
439 Ga0307515_10072720
440 Ga0307513_10999184
441 Ga0307408_100772105
442 Ga0307405_10078742
443 Ga0307406_10098775
444 Ga0307409_100143737
445 Ga0307411_10484051
446 Ga0307510_10023424
447 Ga0373935_0939914
448 Ga0436364_1057197
449 Ga0436365_1054924
450 Ga0436360_0591757
451 Ga0436361_0515442
452 Ga0451853_0013079
453 Ga0451853_2967229
454 Ga0466972_0122383
455 Ga0466961_0356182
456 Ga0466964_0196743
457 Ga0466960_0154025
458 Ga0466959_0115539
459 Ga0495617_007403
460 Ga0495583_0000005
461 Ga0495583_0001019
462 Ga0495631_0388260
463 Ga0495640_0382360
464 Ga0495586_0607556
465 Ga0495633_0000074
466 Ga0495633_0045105
467 Ga0495625_0052911
468 Ga0495625_0246708
469 Ga0495683_0000453
470 Ga0496105_0048807
471 Ga0496112_0787059
472 Ga0496114_0592481
473 Ga0496120_0088951
474 Ga0501036_0035915
475 Ga0501037_0942648
476 Ga0501047_0086393
477 Ga0501048_0896410
478 Ga0501070_0111177
479 Ga0501073_0008989
480 Ga0501073_0121091
481 Ga0501074_0029872
482 Ga0501074_0125907
483 Ga0501222_051012
484 Ga0501233_100992
485 Ga0501257_100757
486 Ga0501234_018299
487 Ga0501079_0024261
488 Ga0501080_0146281
489 Ga0501035_0011210
490 nmdc:mga07m45_612106_c1
491 nmdc:mga0n895_241419_c1
492 Ga0500643_019897
493 Ga0500644_0043424
494 Ga0500646_0088233
495 Ga0500595_023628
496 Ga0500568_0000992
497 Ga0500604_0000015
498 Ga0500604_0061810
499 Ga0500616_0000080
500 Ga0500616_0126339
501 Ga0501084_1353791
502 2586207975

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.7564 9 137
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.6546 9 137
2fki-assembly1.cif.gz_A nmr structure of protein yjbr from escherichia coli; northeast structural genomics consortium target er226 0.645 22 138
2fki-assembly1.cif.gz_A nmr structure of protein yjbr from escherichia coli; northeast structural genomics consortium target er226 0.5524 22 138
3a8u-assembly1.cif.gz_X crystal structure of omega-amino acid:pyruvate aminotransferase 0.5468 75 141
ID Description Score Start End Superfamily
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7451 9 137 3.90.1150.200
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6887 9 137 3.90.1150.200
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6177 5 138 3.90.1150.200
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.5858 5 138 3.90.1150.200
af_Q54J48_8_246_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.5703 53 81 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A7W5Q1R6-F1-model_v4 YdhG-like domain-containing protein 0.9909 1 139
AF-A0A4Q3UIT9-F1-model_v4 DUF1801 domain-containing protein 0.9855 1 139
AF-A0A6B8RMY4-F1-model_v4 DUF1801 domain-containing protein 0.9837 1 138
AF-A0A1H6JFL5-F1-model_v4 Uncharacterized protein 0.9801 1 138
AF-A0A4Q3UIT9-F1-model_v4 DUF1801 domain-containing protein 0.9785 1 139

Map