F362633
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 251 | 197 | 502 | 338 |
Family's Representative Sequence
| Representative Sequence | 3300045051|Ga0451576_0004019|Ga0451576_0004019_15190_16200 |
| Length | 336 |
| Sequence | MRTALDAYAAALPKAELHLHIEGTLEPELMFELAGRNHAKLRFASVEAIKAAYDFDGLQSFLDIYYEGAGVLRAERDFHDLAWAYFTRVAPMNVKHAEIFFDPQTHTSRGVPYEAVISGLTRACRRAEKELGITSKLILCFLRHLDEGAALKTLDEALPFGGIAGVGLDSSEKDRPPSLFERVFAKARAAGLRCVAHAGEEGPPAYIAEALDLLMVERIDHGVRCLEDPELVKRLAGAQTALTVCPLSNHKLRVFDALEDHNLKELLAAGVLASVHSDDPAYFGGYVDANYRDTARALGLTKAELRTLARNSFLSSWLSGPEKSRHLAAIDGITAS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 2 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 3 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 4 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 5 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 6 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 7 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 15 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 16 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 17 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 18 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 19 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 20 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 21 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 22 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 23 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 24 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 25 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 26 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 27 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 28 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 29 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 30 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 31 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 32 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 33 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 34 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 35 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 36 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 37 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 38 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 39 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 40 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 41 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 42 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 43 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 44 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 45 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 46 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 47 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 48 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 49 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 69 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 70 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 71 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 72 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 73 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 74 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 75 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 76 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 77 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 78 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 79 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 80 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 81 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 82 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 83 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 84 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 85 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 86 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 87 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 88 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 89 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 90 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 91 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 92 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 115 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 116 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 117 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 118 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 119 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 120 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 121 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 123 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 124 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 125 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 126 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 127 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 128 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 129 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 130 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 131 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 132 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 133 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 134 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 135 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 136 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 137 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 138 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 139 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 140 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 141 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 142 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 143 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 144 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 145 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 146 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 147 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 148 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 149 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 150 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 151 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 152 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 153 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 154 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 155 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 156 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 157 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 158 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 159 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 160 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 161 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 162 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 163 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 164 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 165 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 166 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 167 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 168 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 169 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 170 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 171 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 172 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 173 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 174 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 175 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 176 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 177 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 178 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 179 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 180 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 181 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 182 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 183 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 184 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 185 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 186 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 187 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 188 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 189 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 190 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 191 | 2898329390 | Caulobacter sp. 602-2 | Isolate | Rhizosphere |
| 192 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 193 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 194 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 195 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 196 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 197 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.85 |
| Metatranscriptomes | 0.8 |
| Isolates | 12.35 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.8 |
| Bulb | 0 |
| Endosphere | 25.1 |
| Nodule | 0 |
| Rhizoplane | 2.79 |
| Rhizosphere | 60.56 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0451576_0004019 | 3300045051 | Bacteria | 19564 |
| 2 | JGI25165J46597_1000032 | 3300003214 | Bacteria | 294371 |
| 3 | JGI25153J46596_10036190 | 3300003215 | Bacteria | 1586 |
| 4 | Ga0055536_1002547 | 3300003781 | Bacteria | 10188 |
| 5 | Ga0055536_1002762 | 3300003781 | Bacteria | 9718 |
| 6 | Ga0055530_10000045 | 3300003791 | Bacteria | 109202 |
| 7 | Ga0055530_10003768 | 3300003791 | Bacteria | 8361 |
| 8 | Ga0055530_10009725 | 3300003791 | Bacteria | 3650 |
| 9 | Ga0055531_10003599 | 3300003794 | Bacteria | 9796 |
| 10 | Ga0055531_10014018 | 3300003794 | Bacteria | 3646 |
| 11 | Ga0065165_1001209 | 3300005262 | Bacteria | 29779 |
| 12 | Ga0065165_1001873 | 3300005262 | Bacteria | 20385 |
| 13 | Ga0070658_10363048 | 3300005327 | Bacteria | 1241 |
| 14 | Ga0070680_100000081 | 3300005336 | Bacteria | 52556 |
| 15 | Ga0070691_10064947 | 3300005341 | Bacteria | 1761 |
| 16 | Ga0070708_100033851 | 3300005445 | Bacteria | 4441 |
| 17 | Ga0070681_10029507 | 3300005458 | Bacteria | 5508 |
| 18 | Ga0070681_10163031 | 3300005458 | Bacteria | 2153 |
| 19 | Ga0070679_100000031 | 3300005530 | Bacteria | 107526 |
| 20 | Ga0070679_100302665 | 3300005530 | Bacteria | 1549 |
| 21 | Ga0068855_100135890 | 3300005563 | Bacteria | 2805 |
| 22 | Ga0068855_100374366 | 3300005563 | Bacteria | 1565 |
| 23 | Ga0068859_100041073 | 3300005617 | Bacteria | 4646 |
| 24 | Ga0068863_100010285 | 3300005841 | Bacteria | 9091 |
| 25 | Ga0068860_100000391 | 3300005843 | Bacteria | 57332 |
| 26 | Ga0068862_100000014 | 3300005844 | Bacteria | 251552 |
| 27 | Ga0075363_100087489 | 3300006048 | Bacteria | 1711 |
| 28 | Ga0075369_10000943 | 3300006186 | Bacteria | 9677 |
| 29 | Ga0075366_10039431 | 3300006195 | Bacteria | 2792 |
| 30 | Ga0097620_100041073 | 3300006931 | Bacteria | 4646 |
| 31 | Ga0105240_10067893 | 3300009093 | Bacteria | 4418 |
| 32 | Ga0105247_10001671 | 3300009101 | Bacteria | 15659 |
| 33 | Ga0105242_10147953 | 3300009176 | Bacteria | 2045 |
| 34 | Ga0105248_10055601 | 3300009177 | Bacteria | 4440 |
| 35 | Ga0105238_10207711 | 3300009551 | Bacteria | 1934 |
| 36 | Ga0105249_10000002 | 3300009553 | Bacteria | 376207 |
| 37 | Ga0157373_10085101 | 3300013100 | Bacteria | 2229 |
| 38 | Ga0157370_10216974 | 3300013104 | Bacteria | 1773 |
| 39 | Ga0157369_10314711 | 3300013105 | Bacteria | 1627 |
| 40 | Ga0157375_10152156 | 3300013308 | Bacteria | 2450 |
| 41 | Ga0163163_10128008 | 3300014325 | Bacteria | 2578 |
| 42 | Ga0163163_10331069 | 3300014325 | Bacteria | 1577 |
| 43 | Ga0182006_1082762 | 3300015261 | Bacteria | 1168 |
| 44 | Ga0206354_10648923 | 3300020081 | Bacteria | 3540 |
| 45 | Ga0206353_10246987 | 3300020082 | Bacteria | 7299 |
| 46 | Ga0209437_105615 | 3300025233 | Bacteria | 2127 |
| 47 | Ga0209026_1007292 | 3300025250 | Bacteria | 2521 |
| 48 | Ga0209233_1000066 | 3300025261 | Bacteria | 381218 |
| 49 | Ga0209565_1001017 | 3300025263 | Bacteria | 14345 |
| 50 | Ga0209673_1000910 | 3300025273 | Bacteria | 37777 |
| 51 | Ga0209676_1000171 | 3300025292 | Bacteria | 154045 |
| 52 | Ga0209676_1000177 | 3300025292 | Bacteria | 151589 |
| 53 | Ga0209564_1001677 | 3300025295 | Bacteria | 21114 |
| 54 | Ga0209758_1000782 | 3300025297 | Bacteria | 45683 |
| 55 | Ga0209758_1003851 | 3300025297 | Bacteria | 13164 |
| 56 | Ga0209050_1000121 | 3300025298 | Bacteria | 196019 |
| 57 | Ga0209050_1000391 | 3300025298 | Bacteria | 82421 |
| 58 | Ga0209050_1000496 | 3300025298 | Bacteria | 67112 |
| 59 | Ga0209256_1002273 | 3300025299 | Bacteria | 16266 |
| 60 | Ga0209256_1022340 | 3300025299 | Bacteria | 1917 |
| 61 | Ga0209051_1003390 | 3300025303 | Bacteria | 10460 |
| 62 | Ga0209257_1000125 | 3300025304 | Bacteria | 218126 |
| 63 | Ga0209257_1000224 | 3300025304 | Bacteria | 134156 |
| 64 | Ga0209257_1000253 | 3300025304 | Bacteria | 123508 |
| 65 | Ga0209257_1002307 | 3300025304 | Bacteria | 19282 |
| 66 | Ga0209257_1008861 | 3300025304 | Bacteria | 5555 |
| 67 | Ga0207710_10000920 | 3300025900 | Bacteria | 15715 |
| 68 | Ga0207654_10111155 | 3300025911 | Bacteria | 1705 |
| 69 | Ga0207707_10131300 | 3300025912 | Bacteria | 2191 |
| 70 | Ga0207707_10266309 | 3300025912 | Bacteria | 1486 |
| 71 | Ga0207695_10000575 | 3300025913 | Bacteria | 74997 |
| 72 | Ga0207695_10005806 | 3300025913 | Bacteria | 16245 |
| 73 | Ga0207695_10057092 | 3300025913 | Bacteria | 4058 |
| 74 | Ga0207695_10150584 | 3300025913 | Bacteria | 2266 |
| 75 | Ga0207660_10000342 | 3300025917 | Bacteria | 30128 |
| 76 | Ga0207652_10000003 | 3300025921 | Bacteria | 502441 |
| 77 | Ga0207694_10007063 | 3300025924 | Bacteria | 8525 |
| 78 | Ga0207644_10228846 | 3300025931 | Bacteria | 1476 |
| 79 | Ga0207706_10165375 | 3300025933 | Bacteria | 1944 |
| 80 | Ga0207711_10001469 | 3300025941 | Bacteria | 21980 |
| 81 | Ga0207667_10088139 | 3300025949 | Bacteria | 3210 |
| 82 | Ga0207712_10000002 | 3300025961 | Bacteria | 706628 |
| 83 | Ga0207641_10003069 | 3300026088 | Bacteria | 15060 |
| 84 | Ga0207676_10021046 | 3300026095 | Bacteria | 4781 |
| 85 | Ga0209371_1000094 | 3300027312 | Bacteria | 170815 |
| 86 | Ga0209981_1000043 | 3300027378 | Bacteria | 12361 |
| 87 | Ga0268266_10042635 | 3300028379 | Bacteria | 3877 |
| 88 | Ga0268265_10000048 | 3300028380 | Bacteria | 178523 |
| 89 | Ga0268264_10000439 | 3300028381 | Bacteria | 57339 |
| 90 | Ga0307517_10012557 | 3300028786 | Bacteria | 11610 |
| 91 | Ga0268256_1000083 | 3300030500 | Bacteria | 170829 |
| 92 | Ga0307511_10076951 | 3300030521 | Bacteria | 2380 |
| 93 | Ga0265320_10000088 | 3300031240 | Bacteria | 77379 |
| 94 | Ga0265325_10010201 | 3300031241 | Bacteria | 5451 |
| 95 | Ga0307513_10002446 | 3300031456 | Bacteria | 25748 |
| 96 | Ga0307513_10009092 | 3300031456 | Bacteria | 12594 |
| 97 | Ga0307410_10168178 | 3300031852 | Bacteria | 1649 |
| 98 | Ga0307406_10312526 | 3300031901 | Bacteria | 1212 |
| 99 | Ga0307510_10150285 | 3300033180 | Bacteria | 1950 |
| 100 | Ga0373936_0022662 | 3300035113 | Bacteria | 2446 |
| 101 | Ga0373946_0011042 | 3300035171 | Bacteria | 3359 |
| 102 | Ga0373935_0234509 | 3300035692 | Bacteria | 1279 |
| 103 | Ga0373927_0000479 | 3300035695 | Bacteria | 30749 |
| 104 | Ga0373925_0000023 | 3300037068 | Bacteria | 158881 |
| 105 | Ga0395900_0103443 | 3300037418 | Bacteria | 2925 |
| 106 | Ga0395898_0116057 | 3300037466 | Bacteria | 2565 |
| 107 | Ga0395905_0004157 | 3300037471 | Bacteria | 15144 |
| 108 | Ga0395905_0188866 | 3300037471 | Bacteria | 1933 |
| 109 | Ga0395905_0245689 | 3300037471 | Bacteria | 1672 |
| 110 | Ga0395901_0048250 | 3300038443 | Bacteria | 4422 |
| 111 | Ga0395901_0192200 | 3300038443 | Bacteria | 2140 |
| 112 | Ga0439437_000883 | 3300042000 | Bacteria | 3124 |
| 113 | Ga0439456_022495 | 3300042013 | Bacteria | 1335 |
| 114 | Ga0439464_0005211 | 3300042439 | Bacteria | 3352 |
| 115 | Ga0451577_0440548 | 3300042876 | Bacteria | 1183 |
| 116 | Ga0453684_0001961 | 3300044712 | Bacteria | 53017 |
| 117 | Ga0451576_0129484 | 3300045051 | Bacteria | 2630 |
| 118 | Ga0466967_0521877 | 3300045976 | Bacteria | 1167 |
| 119 | Ga0495627_000656 | 3300046453 | Bacteria | 26634 |
| 120 | Ga0495590_0000868 | 3300046457 | Bacteria | 13601 |
| 121 | Ga0495638_0000370 | 3300046460 | Bacteria | 55689 |
| 122 | Ga0495638_0001482 | 3300046460 | Bacteria | 21206 |
| 123 | Ga0495638_0003212 | 3300046460 | Bacteria | 12928 |
| 124 | Ga0495650_0000068 | 3300046471 | Bacteria | 266671 |
| 125 | Ga0495650_0103325 | 3300046471 | Bacteria | 1067 |
| 126 | Ga0495607_0020815 | 3300046501 | Bacteria | 4139 |
| 127 | Ga0495583_0000002 | 3300046506 | Bacteria | 782521 |
| 128 | Ga0495606_0028579 | 3300046507 | Bacteria | 3930 |
| 129 | Ga0495610_0000111 | 3300046512 | Bacteria | 95122 |
| 130 | Ga0495610_0005818 | 3300046512 | Bacteria | 8665 |
| 131 | Ga0495616_0000782 | 3300046513 | Bacteria | 23235 |
| 132 | Ga0495632_0005603 | 3300046519 | Bacteria | 8263 |
| 133 | Ga0495637_0031657 | 3300046520 | Bacteria | 2337 |
| 134 | Ga0495648_0000281 | 3300046524 | Bacteria | 57761 |
| 135 | Ga0495648_0169616 | 3300046524 | Bacteria | 1120 |
| 136 | Ga0495654_0000051 | 3300046530 | Bacteria | 145932 |
| 137 | Ga0495621_0029027 | 3300046539 | Bacteria | 1884 |
| 138 | Ga0495668_0000026 | 3300046616 | Bacteria | 297287 |
| 139 | Ga0495668_0012085 | 3300046616 | Bacteria | 5136 |
| 140 | Ga0495668_0014176 | 3300046616 | Bacteria | 4683 |
| 141 | Ga0495668_0067450 | 3300046616 | Bacteria | 1968 |
| 142 | Ga0495625_0000198 | 3300046660 | Bacteria | 95530 |
| 143 | Ga0495625_0002170 | 3300046660 | Bacteria | 21795 |
| 144 | Ga0495625_0002430 | 3300046660 | Bacteria | 20159 |
| 145 | Ga0495625_0012992 | 3300046660 | Bacteria | 6719 |
| 146 | Ga0495625_0051073 | 3300046660 | Bacteria | 2965 |
| 147 | Ga0495659_0086346 | 3300046664 | Bacteria | 1199 |
| 148 | Ga0495671_0050307 | 3300046692 | Bacteria | 2075 |
| 149 | Ga0495671_0140224 | 3300046692 | Bacteria | 1178 |
| 150 | Ga0495660_0047248 | 3300046810 | Bacteria | 2358 |
| 151 | Ga0495660_0064795 | 3300046810 | Bacteria | 1952 |
| 152 | Ga0495673_0000267 | 3300047469 | Bacteria | 72453 |
| 153 | Ga0495673_0000287 | 3300047469 | Bacteria | 67754 |
| 154 | Ga0495681_0117667 | 3300047470 | Bacteria | 1144 |
| 155 | Ga0495686_0000857 | 3300047472 | Bacteria | 39041 |
| 156 | Ga0495686_0005076 | 3300047472 | Bacteria | 10541 |
| 157 | Ga0495686_0008981 | 3300047472 | Bacteria | 7255 |
| 158 | Ga0495686_0047325 | 3300047472 | Bacteria | 2716 |
| 159 | Ga0495686_0108384 | 3300047472 | Bacteria | 1668 |
| 160 | Ga0496106_0104431 | 3300048909 | Bacteria | 2200 |
| 161 | Ga0496107_0000038 | 3300048910 | Bacteria | 78077 |
| 162 | Ga0496108_0374372 | 3300048911 | Bacteria | 1243 |
| 163 | Ga0496109_0147307 | 3300048912 | Bacteria | 2203 |
| 164 | Ga0496115_0003309 | 3300048918 | Bacteria | 11572 |
| 165 | Ga0496115_0057575 | 3300048918 | Bacteria | 3126 |
| 166 | Ga0496115_0260287 | 3300048918 | Bacteria | 1427 |
| 167 | Ga0496124_0029889 | 3300048927 | Bacteria | 4847 |
| 168 | Ga0496125_0020573 | 3300048928 | Bacteria | 6191 |
| 169 | Ga0495678_000903 | 3300049459 | Bacteria | 26225 |
| 170 | Ga0501032_0106289 | 3300049569 | Bacteria | 1859 |
| 171 | Ga0501037_0009345 | 3300049573 | Bacteria | 7196 |
| 172 | Ga0501039_0003630 | 3300049575 | Bacteria | 11562 |
| 173 | Ga0501040_0006561 | 3300049576 | Bacteria | 7555 |
| 174 | Ga0501042_0008197 | 3300049578 | Bacteria | 6884 |
| 175 | Ga0501043_0017002 | 3300049579 | Bacteria | 5702 |
| 176 | Ga0501046_0011419 | 3300049580 | Bacteria | 7593 |
| 177 | Ga0501071_0039262 | 3300049587 | Bacteria | 3386 |
| 178 | Ga0501072_0013860 | 3300049588 | Bacteria | 6176 |
| 179 | Ga0501073_0034328 | 3300049589 | Bacteria | 3611 |
| 180 | Ga0501074_0004427 | 3300049590 | Bacteria | 10045 |
| 181 | Ga0501075_0001110 | 3300049591 | Bacteria | 17326 |
| 182 | Ga0501076_0019524 | 3300049592 | Bacteria | 5181 |
| 183 | Ga0501077_0001182 | 3300049593 | Bacteria | 15746 |
| 184 | Ga0501080_0002136 | 3300049742 | Bacteria | 17176 |
| 185 | Ga0501081_0010673 | 3300049743 | Bacteria | 6003 |
| 186 | Ga0501083_0015413 | 3300049744 | Bacteria | 5353 |
| 187 | Ga0501035_0022926 | 3300049822 | Bacteria | 5731 |
| 188 | Ga0501045_0015661 | 3300049824 | Bacteria | 5379 |
| 189 | nmdc:mga0k408_32189_c1 | 3300050493 | Bacteria | 2996 |
| 190 | nmdc:mga07m45_32569_c1 | 3300050496 | Bacteria | 2890 |
| 191 | nmdc:mga0sz30_4740_c1 | 3300050516 | Bacteria | 4938 |
| 192 | Ga0500578_0000070 | 3300053086 | Bacteria | 113202 |
| 193 | Ga0500578_0220878 | 3300053086 | Bacteria | 1152 |
| 194 | Ga0500643_012246 | 3300053087 | Bacteria | 3079 |
| 195 | Ga0500644_0000082 | 3300053088 | Bacteria | 58141 |
| 196 | Ga0500644_0006720 | 3300053088 | Bacteria | 2961 |
| 197 | Ga0500554_006676 | 3300053102 | Bacteria | 2606 |
| 198 | Ga0500556_0001096 | 3300053104 | Bacteria | 13560 |
| 199 | Ga0500594_0000158 | 3300053118 | Bacteria | 17728 |
| 200 | Ga0500595_052379 | 3300053119 | Bacteria | 1260 |
| 201 | Ga0500608_000072 | 3300053122 | Bacteria | 43162 |
| 202 | Ga0500658_0000824 | 3300053134 | Bacteria | 12750 |
| 203 | Ga0500559_0000304 | 3300053136 | Bacteria | 37380 |
| 204 | Ga0500559_0002780 | 3300053136 | Bacteria | 8855 |
| 205 | Ga0500564_000232 | 3300053138 | Bacteria | 15491 |
| 206 | Ga0500577_0004215 | 3300053142 | Bacteria | 3785 |
| 207 | Ga0500616_0073654 | 3300053153 | Bacteria | 1733 |
| 208 | Ga0500622_0001700 | 3300053156 | Bacteria | 17076 |
| 209 | Ga0500622_0006548 | 3300053156 | Bacteria | 6729 |
| 210 | Ga0500622_0054162 | 3300053156 | Bacteria | 2058 |
| 211 | Ga0500627_0024604 | 3300053158 | Bacteria | 2466 |
| 212 | Ga0500636_0116826 | 3300053177 | Bacteria | 1501 |
| 213 | Ga0500611_001493 | 3300053727 | Bacteria | 2588 |
| 214 | Ga0500645_001056 | 3300053730 | Bacteria | 15286 |
| 215 | Ga0500645_001569 | 3300053730 | Bacteria | 11375 |
| 216 | Ga0500609_000110 | 3300053731 | Bacteria | 10836 |
| 217 | Ga0500587_000592 | 3300053739 | Bacteria | 4516 |
| 218 | Ga0501084_0003575 | 3300054114 | Bacteria | 12615 |
| 219 | Ga0501082_0067204 | 3300060353 | Bacteria | 3086 |
| 220 | Ga0530510_0007152 | 3300061734 | Bacteria | 7765 |
| 221 | 2511121987 | 2510917020 | Bacteria | 5657507 |
| 222 | 2512643346 | 2512564014 | Bacteria | 4639632 |
| 223 | 2585147915 | 2582581279 | Bacteria | 4980720 |
| 224 | 2585194721 | 2582581293 | Bacteria | 5907401 |
| 225 | 2587918324 | 2585428106 | Bacteria | 5179711 |
| 226 | 2643748422 | 2643221545 | Bacteria | 5083237 |
| 227 | 2643782381 | 2643221552 | Bacteria | 5708754 |
| 228 | 2643924154 | 2643221583 | Bacteria | 5218014 |
| 229 | 2643930787 | 2643221584 | Bacteria | 5511711 |
| 230 | 2644086916 | 2643221614 | Bacteria | 4260023 |
| 231 | 2644227784 | 2643221640 | Bacteria | 5258820 |
| 232 | 2644233955 | 2643221642 | Bacteria | 5357871 |
| 233 | 2644341870 | 2643221661 | Bacteria | 4267604 |
| 234 | 2644368157 | 2643221666 | Bacteria | 4265935 |
| 235 | 2644510095 | 2643221691 | Bacteria | 5093099 |
| 236 | 2792459049 | 2791355048 | Bacteria | 5832535 |
| 237 | 2819540124 | 2818991435 | Bacteria | 5433759 |
| 238 | 2819649162 | 2818991454 | Bacteria | 5563326 |
| 239 | 2843746579 | 2843744320 | Bacteria | 5659202 |
| 240 | 2849563689 | 2849560528 | Bacteria | 5393480 |
| 241 | 2849576017 | 2849573788 | Bacteria | 5421256 |
| 242 | 2851153381 | 2851153111 | Bacteria | 5542585 |
| 243 | 2857505471 | 2857504554 | Bacteria | 5369913 |
| 244 | 2884962265 | 2884960567 | Bacteria | 5437054 |
| 245 | 2898331555 | 2898329390 | Bacteria | 5168154 |
| 246 | 2928029549 | 2928027323 | Bacteria | 4382488 |
| 247 | 2928533070 | 2928531327 | Bacteria | 5101314 |
| 248 | 2984557475 | 2984555340 | Bacteria | 4247089 |
| 249 | 2993359208 | 2993356040 | Bacteria | 4247105 |
| 250 | 3007254145 | 3007252601 | Bacteria | 4559114 |
| 251 | 3007317117 | 3007315729 | Bacteria | 5076637 |
| 252 | Ga0451576_0004019 | |||
| 253 | JGI25165J46597_1000032 | |||
| 254 | JGI25153J46596_10036190 | |||
| 255 | Ga0055536_1002547 | |||
| 256 | Ga0055536_1002762 | |||
| 257 | Ga0055530_10000045 | |||
| 258 | Ga0055530_10003768 | |||
| 259 | Ga0055530_10009725 | |||
| 260 | Ga0055531_10003599 | |||
| 261 | Ga0055531_10014018 | |||
| 262 | Ga0065165_1001209 | |||
| 263 | Ga0065165_1001873 | |||
| 264 | Ga0070658_10363048 | |||
| 265 | Ga0070680_100000081 | |||
| 266 | Ga0070691_10064947 | |||
| 267 | Ga0070708_100033851 | |||
| 268 | Ga0070681_10029507 | |||
| 269 | Ga0070681_10163031 | |||
| 270 | Ga0070679_100000031 | |||
| 271 | Ga0070679_100302665 | |||
| 272 | Ga0068855_100135890 | |||
| 273 | Ga0068855_100374366 | |||
| 274 | Ga0068859_100041073 | |||
| 275 | Ga0068863_100010285 | |||
| 276 | Ga0068860_100000391 | |||
| 277 | Ga0068862_100000014 | |||
| 278 | Ga0075363_100087489 | |||
| 279 | Ga0075369_10000943 | |||
| 280 | Ga0075366_10039431 | |||
| 281 | Ga0097620_100041073 | |||
| 282 | Ga0105240_10067893 | |||
| 283 | Ga0105247_10001671 | |||
| 284 | Ga0105242_10147953 | |||
| 285 | Ga0105248_10055601 | |||
| 286 | Ga0105238_10207711 | |||
| 287 | Ga0105249_10000002 | |||
| 288 | Ga0157373_10085101 | |||
| 289 | Ga0157370_10216974 | |||
| 290 | Ga0157369_10314711 | |||
| 291 | Ga0157375_10152156 | |||
| 292 | Ga0163163_10128008 | |||
| 293 | Ga0163163_10331069 | |||
| 294 | Ga0182006_1082762 | |||
| 295 | Ga0206354_10648923 | |||
| 296 | Ga0206353_10246987 | |||
| 297 | Ga0209437_105615 | |||
| 298 | Ga0209026_1007292 | |||
| 299 | Ga0209233_1000066 | |||
| 300 | Ga0209565_1001017 | |||
| 301 | Ga0209673_1000910 | |||
| 302 | Ga0209676_1000171 | |||
| 303 | Ga0209676_1000177 | |||
| 304 | Ga0209564_1001677 | |||
| 305 | Ga0209758_1000782 | |||
| 306 | Ga0209758_1003851 | |||
| 307 | Ga0209050_1000121 | |||
| 308 | Ga0209050_1000391 | |||
| 309 | Ga0209050_1000496 | |||
| 310 | Ga0209256_1002273 | |||
| 311 | Ga0209256_1022340 | |||
| 312 | Ga0209051_1003390 | |||
| 313 | Ga0209257_1000125 | |||
| 314 | Ga0209257_1000224 | |||
| 315 | Ga0209257_1000253 | |||
| 316 | Ga0209257_1002307 | |||
| 317 | Ga0209257_1008861 | |||
| 318 | Ga0207710_10000920 | |||
| 319 | Ga0207654_10111155 | |||
| 320 | Ga0207707_10131300 | |||
| 321 | Ga0207707_10266309 | |||
| 322 | Ga0207695_10000575 | |||
| 323 | Ga0207695_10005806 | |||
| 324 | Ga0207695_10057092 | |||
| 325 | Ga0207695_10150584 | |||
| 326 | Ga0207660_10000342 | |||
| 327 | Ga0207652_10000003 | |||
| 328 | Ga0207694_10007063 | |||
| 329 | Ga0207644_10228846 | |||
| 330 | Ga0207706_10165375 | |||
| 331 | Ga0207711_10001469 | |||
| 332 | Ga0207667_10088139 | |||
| 333 | Ga0207712_10000002 | |||
| 334 | Ga0207641_10003069 | |||
| 335 | Ga0207676_10021046 | |||
| 336 | Ga0209371_1000094 | |||
| 337 | Ga0209981_1000043 | |||
| 338 | Ga0268266_10042635 | |||
| 339 | Ga0268265_10000048 | |||
| 340 | Ga0268264_10000439 | |||
| 341 | Ga0307517_10012557 | |||
| 342 | Ga0268256_1000083 | |||
| 343 | Ga0307511_10076951 | |||
| 344 | Ga0265320_10000088 | |||
| 345 | Ga0265325_10010201 | |||
| 346 | Ga0307513_10002446 | |||
| 347 | Ga0307513_10009092 | |||
| 348 | Ga0307410_10168178 | |||
| 349 | Ga0307406_10312526 | |||
| 350 | Ga0307510_10150285 | |||
| 351 | Ga0373936_0022662 | |||
| 352 | Ga0373946_0011042 | |||
| 353 | Ga0373935_0234509 | |||
| 354 | Ga0373927_0000479 | |||
| 355 | Ga0373925_0000023 | |||
| 356 | Ga0395900_0103443 | |||
| 357 | Ga0395898_0116057 | |||
| 358 | Ga0395905_0004157 | |||
| 359 | Ga0395905_0188866 | |||
| 360 | Ga0395905_0245689 | |||
| 361 | Ga0395901_0048250 | |||
| 362 | Ga0395901_0192200 | |||
| 363 | Ga0439437_000883 | |||
| 364 | Ga0439456_022495 | |||
| 365 | Ga0439464_0005211 | |||
| 366 | Ga0451577_0440548 | |||
| 367 | Ga0453684_0001961 | |||
| 368 | Ga0451576_0129484 | |||
| 369 | Ga0466967_0521877 | |||
| 370 | Ga0495627_000656 | |||
| 371 | Ga0495590_0000868 | |||
| 372 | Ga0495638_0000370 | |||
| 373 | Ga0495638_0001482 | |||
| 374 | Ga0495638_0003212 | |||
| 375 | Ga0495650_0000068 | |||
| 376 | Ga0495650_0103325 | |||
| 377 | Ga0495607_0020815 | |||
| 378 | Ga0495583_0000002 | |||
| 379 | Ga0495606_0028579 | |||
| 380 | Ga0495610_0000111 | |||
| 381 | Ga0495610_0005818 | |||
| 382 | Ga0495616_0000782 | |||
| 383 | Ga0495632_0005603 | |||
| 384 | Ga0495637_0031657 | |||
| 385 | Ga0495648_0000281 | |||
| 386 | Ga0495648_0169616 | |||
| 387 | Ga0495654_0000051 | |||
| 388 | Ga0495621_0029027 | |||
| 389 | Ga0495668_0000026 | |||
| 390 | Ga0495668_0012085 | |||
| 391 | Ga0495668_0014176 | |||
| 392 | Ga0495668_0067450 | |||
| 393 | Ga0495625_0000198 | |||
| 394 | Ga0495625_0002170 | |||
| 395 | Ga0495625_0002430 | |||
| 396 | Ga0495625_0012992 | |||
| 397 | Ga0495625_0051073 | |||
| 398 | Ga0495659_0086346 | |||
| 399 | Ga0495671_0050307 | |||
| 400 | Ga0495671_0140224 | |||
| 401 | Ga0495660_0047248 | |||
| 402 | Ga0495660_0064795 | |||
| 403 | Ga0495673_0000267 | |||
| 404 | Ga0495673_0000287 | |||
| 405 | Ga0495681_0117667 | |||
| 406 | Ga0495686_0000857 | |||
| 407 | Ga0495686_0005076 | |||
| 408 | Ga0495686_0008981 | |||
| 409 | Ga0495686_0047325 | |||
| 410 | Ga0495686_0108384 | |||
| 411 | Ga0496106_0104431 | |||
| 412 | Ga0496107_0000038 | |||
| 413 | Ga0496108_0374372 | |||
| 414 | Ga0496109_0147307 | |||
| 415 | Ga0496115_0003309 | |||
| 416 | Ga0496115_0057575 | |||
| 417 | Ga0496115_0260287 | |||
| 418 | Ga0496124_0029889 | |||
| 419 | Ga0496125_0020573 | |||
| 420 | Ga0495678_000903 | |||
| 421 | Ga0501032_0106289 | |||
| 422 | Ga0501037_0009345 | |||
| 423 | Ga0501039_0003630 | |||
| 424 | Ga0501040_0006561 | |||
| 425 | Ga0501042_0008197 | |||
| 426 | Ga0501043_0017002 | |||
| 427 | Ga0501046_0011419 | |||
| 428 | Ga0501071_0039262 | |||
| 429 | Ga0501072_0013860 | |||
| 430 | Ga0501073_0034328 | |||
| 431 | Ga0501074_0004427 | |||
| 432 | Ga0501075_0001110 | |||
| 433 | Ga0501076_0019524 | |||
| 434 | Ga0501077_0001182 | |||
| 435 | Ga0501080_0002136 | |||
| 436 | Ga0501081_0010673 | |||
| 437 | Ga0501083_0015413 | |||
| 438 | Ga0501035_0022926 | |||
| 439 | Ga0501045_0015661 | |||
| 440 | nmdc:mga0k408_32189_c1 | |||
| 441 | nmdc:mga07m45_32569_c1 | |||
| 442 | nmdc:mga0sz30_4740_c1 | |||
| 443 | Ga0500578_0000070 | |||
| 444 | Ga0500578_0220878 | |||
| 445 | Ga0500643_012246 | |||
| 446 | Ga0500644_0000082 | |||
| 447 | Ga0500644_0006720 | |||
| 448 | Ga0500554_006676 | |||
| 449 | Ga0500556_0001096 | |||
| 450 | Ga0500594_0000158 | |||
| 451 | Ga0500595_052379 | |||
| 452 | Ga0500608_000072 | |||
| 453 | Ga0500658_0000824 | |||
| 454 | Ga0500559_0000304 | |||
| 455 | Ga0500559_0002780 | |||
| 456 | Ga0500564_000232 | |||
| 457 | Ga0500577_0004215 | |||
| 458 | Ga0500616_0073654 | |||
| 459 | Ga0500622_0001700 | |||
| 460 | Ga0500622_0006548 | |||
| 461 | Ga0500622_0054162 | |||
| 462 | Ga0500627_0024604 | |||
| 463 | Ga0500636_0116826 | |||
| 464 | Ga0500611_001493 | |||
| 465 | Ga0500645_001056 | |||
| 466 | Ga0500645_001569 | |||
| 467 | Ga0500609_000110 | |||
| 468 | Ga0500587_000592 | |||
| 469 | Ga0501084_0003575 | |||
| 470 | Ga0501082_0067204 | |||
| 471 | Ga0530510_0007152 | |||
| 472 | 2511121987 | |||
| 473 | 2512643346 | |||
| 474 | 2585147915 | |||
| 475 | 2585194721 | |||
| 476 | 2587918324 | |||
| 477 | 2643748422 | |||
| 478 | 2643782381 | |||
| 479 | 2643924154 | |||
| 480 | 2643930787 | |||
| 481 | 2644086916 | |||
| 482 | 2644227784 | |||
| 483 | 2644233955 | |||
| 484 | 2644341870 | |||
| 485 | 2644368157 | |||
| 486 | 2644510095 | |||
| 487 | 2792459049 | |||
| 488 | 2819540124 | |||
| 489 | 2819649162 | |||
| 490 | 2843746579 | |||
| 491 | 2849563689 | |||
| 492 | 2849576017 | |||
| 493 | 2851153381 | |||
| 494 | 2857505471 | |||
| 495 | 2884962265 | |||
| 496 | 2898331555 | |||
| 497 | 2928029549 | |||
| 498 | 2928533070 | |||
| 499 | 2984557475 | |||
| 500 | 2993359208 | |||
| 501 | 3007254145 | |||
| 502 | 3007317117 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3pbm-assembly1.cif.gz_A | the crystal structure of adenosine deaminase in complex with chloropurine from pseudomonas aeruginosa | 0.9866 | 10 | 321 |
| 3rys-assembly2.cif.gz_B | the crystal structure of adenine deaminase (aaur1117) from arthrobacter aurescens | 0.9828 | 15 | 339 |
| 3pbm-assembly1.cif.gz_A | the crystal structure of adenosine deaminase in complex with chloropurine from pseudomonas aeruginosa | 0.9804 | 10 | 321 |
| 3rys-assembly2.cif.gz_B | the crystal structure of adenine deaminase (aaur1117) from arthrobacter aurescens | 0.9739 | 15 | 339 |
| 6n9m-assembly1.cif.gz_A | crystal structure of adenosine deaminase from salmonella typhimurium with pentostatin (deoxycoformycin) | 0.9444 | 13 | 334 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9P6I7_4_353_3.20.20.140 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.9829 | 8 | 340 | 3.20.20.140 |
| 3rysB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.9828 | 15 | 339 | 3.20.20.140 |
| af_P53909_2_346_3.20.20.140 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.9765 | 9 | 340 | 3.20.20.140 |
| af_E9AHV7_5_359_3.20.20.140 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.9739 | 8 | 340 | 3.20.20.140 |
| 3rysB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.9739 | 15 | 339 | 3.20.20.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y2BR73-F1-model_v4 | Adenosine deaminase | 0.9986 | 183 | 340 |
GO:0000034
GO:0005829 GO:0006146 GO:0043103 |
| AF-A0A6M0F672-F1-model_v4 | Adenosine deaminase (EC 3.5.4.4) | 0.9972 | 79 | 340 |
GO:0000034
GO:0004000 GO:0005829 GO:0006146 GO:0043103 GO:0046936 |
| AF-A0A3L7T771-F1-model_v4 | Adenosine deaminase | 0.9972 | 178 | 341 |
GO:0000034
GO:0005829 GO:0006146 GO:0009168 GO:0043103 |
| AF-A0A4Q2LBT3-F1-model_v4 | deleted | 0.9966 | 238 | 340 |
|
| AF-A0A6N7D3B3-F1-model_v4 | Adenine deaminase (ADE) (EC 3.5.4.2) (Adenine aminohydrolase) (AAH) | 0.9958 | 75 | 340 |
GO:0000034
GO:0005829 GO:0006146 GO:0009117 GO:0043103 |