F362633

General Info

Members Datasets Scaffolds Average Seq Length
251 197 502 338

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0004019|Ga0451576_0004019_15190_16200
Length 336
Sequence MRTALDAYAAALPKAELHLHIEGTLEPELMFELAGRNHAKLRFASVEAIKAAYDFDGLQSFLDIYYEGAGVLRAERDFHDLAWAYFTRVAPMNVKHAEIFFDPQTHTSRGVPYEAVISGLTRACRRAEKELGITSKLILCFLRHLDEGAALKTLDEALPFGGIAGVGLDSSEKDRPPSLFERVFAKARAAGLRCVAHAGEEGPPAYIAEALDLLMVERIDHGVRCLEDPELVKRLAGAQTALTVCPLSNHKLRVFDALEDHNLKELLAAGVLASVHSDDPAYFGGYVDANYRDTARALGLTKAELRTLARNSFLSSWLSGPEKSRHLAAIDGITAS

Samples

Sample ID Description Type Environment
1 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
5 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
16 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
17 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
18 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
19 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
20 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
21 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
22 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
23 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
24 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
25 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
26 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
27 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
28 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
29 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
30 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
31 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
32 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
33 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
34 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
35 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
38 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
39 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
40 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
41 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
42 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
44 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
45 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
47 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
69 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
70 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
71 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
72 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
73 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
74 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
75 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
76 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
77 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
78 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
79 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
80 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
81 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
82 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
83 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
84 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
85 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
86 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
87 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
88 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
89 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
90 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
91 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
92 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
93 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
94 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
95 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
96 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
97 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
98 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
99 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
100 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
101 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
102 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
103 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
104 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
105 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
106 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
107 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
108 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
109 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
110 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
111 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
112 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
113 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
114 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
115 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
116 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
117 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
118 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
119 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
120 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
121 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
122 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
130 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
131 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
132 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
133 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
134 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
135 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
136 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
137 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
138 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
139 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
141 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
142 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
143 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
144 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
145 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
146 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
147 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
148 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
149 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
150 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
151 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
152 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
153 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
154 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
155 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
156 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
157 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
158 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
159 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
160 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
161 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
162 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
163 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
164 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
165 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
166 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
167 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
168 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
169 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
170 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
171 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
172 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
173 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
174 2643221583 Caulobacter sp. Root655 Isolate Unclassified
175 2643221584 Caulobacter sp. Root656 Isolate Unclassified
176 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
177 2643221640 Caulobacter sp. Root342 Isolate Unclassified
178 2643221642 Caulobacter sp. Root343 Isolate Unclassified
179 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
180 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
181 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
182 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
183 2818991435 Caulobacter henricii 536 Isolate Unclassified
184 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
185 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
186 2849560528 Caulobacter zeae 410 Isolate Unclassified
187 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
188 2851153111 Caulobacter radicis 736 Isolate Unclassified
189 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
190 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
191 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
192 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
193 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
194 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
195 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
196 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
197 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 86.85
Metatranscriptomes 0.8
Isolates 12.35

Biome Distribution

Category Percentage (%)
Aerial Root 0.8
Bulb 0
Endosphere 25.1
Nodule 0
Rhizoplane 2.79
Rhizosphere 60.56
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451576_0004019 3300045051 Bacteria 19564
2 JGI25165J46597_1000032 3300003214 Bacteria 294371
3 JGI25153J46596_10036190 3300003215 Bacteria 1586
4 Ga0055536_1002547 3300003781 Bacteria 10188
5 Ga0055536_1002762 3300003781 Bacteria 9718
6 Ga0055530_10000045 3300003791 Bacteria 109202
7 Ga0055530_10003768 3300003791 Bacteria 8361
8 Ga0055530_10009725 3300003791 Bacteria 3650
9 Ga0055531_10003599 3300003794 Bacteria 9796
10 Ga0055531_10014018 3300003794 Bacteria 3646
11 Ga0065165_1001209 3300005262 Bacteria 29779
12 Ga0065165_1001873 3300005262 Bacteria 20385
13 Ga0070658_10363048 3300005327 Bacteria 1241
14 Ga0070680_100000081 3300005336 Bacteria 52556
15 Ga0070691_10064947 3300005341 Bacteria 1761
16 Ga0070708_100033851 3300005445 Bacteria 4441
17 Ga0070681_10029507 3300005458 Bacteria 5508
18 Ga0070681_10163031 3300005458 Bacteria 2153
19 Ga0070679_100000031 3300005530 Bacteria 107526
20 Ga0070679_100302665 3300005530 Bacteria 1549
21 Ga0068855_100135890 3300005563 Bacteria 2805
22 Ga0068855_100374366 3300005563 Bacteria 1565
23 Ga0068859_100041073 3300005617 Bacteria 4646
24 Ga0068863_100010285 3300005841 Bacteria 9091
25 Ga0068860_100000391 3300005843 Bacteria 57332
26 Ga0068862_100000014 3300005844 Bacteria 251552
27 Ga0075363_100087489 3300006048 Bacteria 1711
28 Ga0075369_10000943 3300006186 Bacteria 9677
29 Ga0075366_10039431 3300006195 Bacteria 2792
30 Ga0097620_100041073 3300006931 Bacteria 4646
31 Ga0105240_10067893 3300009093 Bacteria 4418
32 Ga0105247_10001671 3300009101 Bacteria 15659
33 Ga0105242_10147953 3300009176 Bacteria 2045
34 Ga0105248_10055601 3300009177 Bacteria 4440
35 Ga0105238_10207711 3300009551 Bacteria 1934
36 Ga0105249_10000002 3300009553 Bacteria 376207
37 Ga0157373_10085101 3300013100 Bacteria 2229
38 Ga0157370_10216974 3300013104 Bacteria 1773
39 Ga0157369_10314711 3300013105 Bacteria 1627
40 Ga0157375_10152156 3300013308 Bacteria 2450
41 Ga0163163_10128008 3300014325 Bacteria 2578
42 Ga0163163_10331069 3300014325 Bacteria 1577
43 Ga0182006_1082762 3300015261 Bacteria 1168
44 Ga0206354_10648923 3300020081 Bacteria 3540
45 Ga0206353_10246987 3300020082 Bacteria 7299
46 Ga0209437_105615 3300025233 Bacteria 2127
47 Ga0209026_1007292 3300025250 Bacteria 2521
48 Ga0209233_1000066 3300025261 Bacteria 381218
49 Ga0209565_1001017 3300025263 Bacteria 14345
50 Ga0209673_1000910 3300025273 Bacteria 37777
51 Ga0209676_1000171 3300025292 Bacteria 154045
52 Ga0209676_1000177 3300025292 Bacteria 151589
53 Ga0209564_1001677 3300025295 Bacteria 21114
54 Ga0209758_1000782 3300025297 Bacteria 45683
55 Ga0209758_1003851 3300025297 Bacteria 13164
56 Ga0209050_1000121 3300025298 Bacteria 196019
57 Ga0209050_1000391 3300025298 Bacteria 82421
58 Ga0209050_1000496 3300025298 Bacteria 67112
59 Ga0209256_1002273 3300025299 Bacteria 16266
60 Ga0209256_1022340 3300025299 Bacteria 1917
61 Ga0209051_1003390 3300025303 Bacteria 10460
62 Ga0209257_1000125 3300025304 Bacteria 218126
63 Ga0209257_1000224 3300025304 Bacteria 134156
64 Ga0209257_1000253 3300025304 Bacteria 123508
65 Ga0209257_1002307 3300025304 Bacteria 19282
66 Ga0209257_1008861 3300025304 Bacteria 5555
67 Ga0207710_10000920 3300025900 Bacteria 15715
68 Ga0207654_10111155 3300025911 Bacteria 1705
69 Ga0207707_10131300 3300025912 Bacteria 2191
70 Ga0207707_10266309 3300025912 Bacteria 1486
71 Ga0207695_10000575 3300025913 Bacteria 74997
72 Ga0207695_10005806 3300025913 Bacteria 16245
73 Ga0207695_10057092 3300025913 Bacteria 4058
74 Ga0207695_10150584 3300025913 Bacteria 2266
75 Ga0207660_10000342 3300025917 Bacteria 30128
76 Ga0207652_10000003 3300025921 Bacteria 502441
77 Ga0207694_10007063 3300025924 Bacteria 8525
78 Ga0207644_10228846 3300025931 Bacteria 1476
79 Ga0207706_10165375 3300025933 Bacteria 1944
80 Ga0207711_10001469 3300025941 Bacteria 21980
81 Ga0207667_10088139 3300025949 Bacteria 3210
82 Ga0207712_10000002 3300025961 Bacteria 706628
83 Ga0207641_10003069 3300026088 Bacteria 15060
84 Ga0207676_10021046 3300026095 Bacteria 4781
85 Ga0209371_1000094 3300027312 Bacteria 170815
86 Ga0209981_1000043 3300027378 Bacteria 12361
87 Ga0268266_10042635 3300028379 Bacteria 3877
88 Ga0268265_10000048 3300028380 Bacteria 178523
89 Ga0268264_10000439 3300028381 Bacteria 57339
90 Ga0307517_10012557 3300028786 Bacteria 11610
91 Ga0268256_1000083 3300030500 Bacteria 170829
92 Ga0307511_10076951 3300030521 Bacteria 2380
93 Ga0265320_10000088 3300031240 Bacteria 77379
94 Ga0265325_10010201 3300031241 Bacteria 5451
95 Ga0307513_10002446 3300031456 Bacteria 25748
96 Ga0307513_10009092 3300031456 Bacteria 12594
97 Ga0307410_10168178 3300031852 Bacteria 1649
98 Ga0307406_10312526 3300031901 Bacteria 1212
99 Ga0307510_10150285 3300033180 Bacteria 1950
100 Ga0373936_0022662 3300035113 Bacteria 2446
101 Ga0373946_0011042 3300035171 Bacteria 3359
102 Ga0373935_0234509 3300035692 Bacteria 1279
103 Ga0373927_0000479 3300035695 Bacteria 30749
104 Ga0373925_0000023 3300037068 Bacteria 158881
105 Ga0395900_0103443 3300037418 Bacteria 2925
106 Ga0395898_0116057 3300037466 Bacteria 2565
107 Ga0395905_0004157 3300037471 Bacteria 15144
108 Ga0395905_0188866 3300037471 Bacteria 1933
109 Ga0395905_0245689 3300037471 Bacteria 1672
110 Ga0395901_0048250 3300038443 Bacteria 4422
111 Ga0395901_0192200 3300038443 Bacteria 2140
112 Ga0439437_000883 3300042000 Bacteria 3124
113 Ga0439456_022495 3300042013 Bacteria 1335
114 Ga0439464_0005211 3300042439 Bacteria 3352
115 Ga0451577_0440548 3300042876 Bacteria 1183
116 Ga0453684_0001961 3300044712 Bacteria 53017
117 Ga0451576_0129484 3300045051 Bacteria 2630
118 Ga0466967_0521877 3300045976 Bacteria 1167
119 Ga0495627_000656 3300046453 Bacteria 26634
120 Ga0495590_0000868 3300046457 Bacteria 13601
121 Ga0495638_0000370 3300046460 Bacteria 55689
122 Ga0495638_0001482 3300046460 Bacteria 21206
123 Ga0495638_0003212 3300046460 Bacteria 12928
124 Ga0495650_0000068 3300046471 Bacteria 266671
125 Ga0495650_0103325 3300046471 Bacteria 1067
126 Ga0495607_0020815 3300046501 Bacteria 4139
127 Ga0495583_0000002 3300046506 Bacteria 782521
128 Ga0495606_0028579 3300046507 Bacteria 3930
129 Ga0495610_0000111 3300046512 Bacteria 95122
130 Ga0495610_0005818 3300046512 Bacteria 8665
131 Ga0495616_0000782 3300046513 Bacteria 23235
132 Ga0495632_0005603 3300046519 Bacteria 8263
133 Ga0495637_0031657 3300046520 Bacteria 2337
134 Ga0495648_0000281 3300046524 Bacteria 57761
135 Ga0495648_0169616 3300046524 Bacteria 1120
136 Ga0495654_0000051 3300046530 Bacteria 145932
137 Ga0495621_0029027 3300046539 Bacteria 1884
138 Ga0495668_0000026 3300046616 Bacteria 297287
139 Ga0495668_0012085 3300046616 Bacteria 5136
140 Ga0495668_0014176 3300046616 Bacteria 4683
141 Ga0495668_0067450 3300046616 Bacteria 1968
142 Ga0495625_0000198 3300046660 Bacteria 95530
143 Ga0495625_0002170 3300046660 Bacteria 21795
144 Ga0495625_0002430 3300046660 Bacteria 20159
145 Ga0495625_0012992 3300046660 Bacteria 6719
146 Ga0495625_0051073 3300046660 Bacteria 2965
147 Ga0495659_0086346 3300046664 Bacteria 1199
148 Ga0495671_0050307 3300046692 Bacteria 2075
149 Ga0495671_0140224 3300046692 Bacteria 1178
150 Ga0495660_0047248 3300046810 Bacteria 2358
151 Ga0495660_0064795 3300046810 Bacteria 1952
152 Ga0495673_0000267 3300047469 Bacteria 72453
153 Ga0495673_0000287 3300047469 Bacteria 67754
154 Ga0495681_0117667 3300047470 Bacteria 1144
155 Ga0495686_0000857 3300047472 Bacteria 39041
156 Ga0495686_0005076 3300047472 Bacteria 10541
157 Ga0495686_0008981 3300047472 Bacteria 7255
158 Ga0495686_0047325 3300047472 Bacteria 2716
159 Ga0495686_0108384 3300047472 Bacteria 1668
160 Ga0496106_0104431 3300048909 Bacteria 2200
161 Ga0496107_0000038 3300048910 Bacteria 78077
162 Ga0496108_0374372 3300048911 Bacteria 1243
163 Ga0496109_0147307 3300048912 Bacteria 2203
164 Ga0496115_0003309 3300048918 Bacteria 11572
165 Ga0496115_0057575 3300048918 Bacteria 3126
166 Ga0496115_0260287 3300048918 Bacteria 1427
167 Ga0496124_0029889 3300048927 Bacteria 4847
168 Ga0496125_0020573 3300048928 Bacteria 6191
169 Ga0495678_000903 3300049459 Bacteria 26225
170 Ga0501032_0106289 3300049569 Bacteria 1859
171 Ga0501037_0009345 3300049573 Bacteria 7196
172 Ga0501039_0003630 3300049575 Bacteria 11562
173 Ga0501040_0006561 3300049576 Bacteria 7555
174 Ga0501042_0008197 3300049578 Bacteria 6884
175 Ga0501043_0017002 3300049579 Bacteria 5702
176 Ga0501046_0011419 3300049580 Bacteria 7593
177 Ga0501071_0039262 3300049587 Bacteria 3386
178 Ga0501072_0013860 3300049588 Bacteria 6176
179 Ga0501073_0034328 3300049589 Bacteria 3611
180 Ga0501074_0004427 3300049590 Bacteria 10045
181 Ga0501075_0001110 3300049591 Bacteria 17326
182 Ga0501076_0019524 3300049592 Bacteria 5181
183 Ga0501077_0001182 3300049593 Bacteria 15746
184 Ga0501080_0002136 3300049742 Bacteria 17176
185 Ga0501081_0010673 3300049743 Bacteria 6003
186 Ga0501083_0015413 3300049744 Bacteria 5353
187 Ga0501035_0022926 3300049822 Bacteria 5731
188 Ga0501045_0015661 3300049824 Bacteria 5379
189 nmdc:mga0k408_32189_c1 3300050493 Bacteria 2996
190 nmdc:mga07m45_32569_c1 3300050496 Bacteria 2890
191 nmdc:mga0sz30_4740_c1 3300050516 Bacteria 4938
192 Ga0500578_0000070 3300053086 Bacteria 113202
193 Ga0500578_0220878 3300053086 Bacteria 1152
194 Ga0500643_012246 3300053087 Bacteria 3079
195 Ga0500644_0000082 3300053088 Bacteria 58141
196 Ga0500644_0006720 3300053088 Bacteria 2961
197 Ga0500554_006676 3300053102 Bacteria 2606
198 Ga0500556_0001096 3300053104 Bacteria 13560
199 Ga0500594_0000158 3300053118 Bacteria 17728
200 Ga0500595_052379 3300053119 Bacteria 1260
201 Ga0500608_000072 3300053122 Bacteria 43162
202 Ga0500658_0000824 3300053134 Bacteria 12750
203 Ga0500559_0000304 3300053136 Bacteria 37380
204 Ga0500559_0002780 3300053136 Bacteria 8855
205 Ga0500564_000232 3300053138 Bacteria 15491
206 Ga0500577_0004215 3300053142 Bacteria 3785
207 Ga0500616_0073654 3300053153 Bacteria 1733
208 Ga0500622_0001700 3300053156 Bacteria 17076
209 Ga0500622_0006548 3300053156 Bacteria 6729
210 Ga0500622_0054162 3300053156 Bacteria 2058
211 Ga0500627_0024604 3300053158 Bacteria 2466
212 Ga0500636_0116826 3300053177 Bacteria 1501
213 Ga0500611_001493 3300053727 Bacteria 2588
214 Ga0500645_001056 3300053730 Bacteria 15286
215 Ga0500645_001569 3300053730 Bacteria 11375
216 Ga0500609_000110 3300053731 Bacteria 10836
217 Ga0500587_000592 3300053739 Bacteria 4516
218 Ga0501084_0003575 3300054114 Bacteria 12615
219 Ga0501082_0067204 3300060353 Bacteria 3086
220 Ga0530510_0007152 3300061734 Bacteria 7765
221 2511121987 2510917020 Bacteria 5657507
222 2512643346 2512564014 Bacteria 4639632
223 2585147915 2582581279 Bacteria 4980720
224 2585194721 2582581293 Bacteria 5907401
225 2587918324 2585428106 Bacteria 5179711
226 2643748422 2643221545 Bacteria 5083237
227 2643782381 2643221552 Bacteria 5708754
228 2643924154 2643221583 Bacteria 5218014
229 2643930787 2643221584 Bacteria 5511711
230 2644086916 2643221614 Bacteria 4260023
231 2644227784 2643221640 Bacteria 5258820
232 2644233955 2643221642 Bacteria 5357871
233 2644341870 2643221661 Bacteria 4267604
234 2644368157 2643221666 Bacteria 4265935
235 2644510095 2643221691 Bacteria 5093099
236 2792459049 2791355048 Bacteria 5832535
237 2819540124 2818991435 Bacteria 5433759
238 2819649162 2818991454 Bacteria 5563326
239 2843746579 2843744320 Bacteria 5659202
240 2849563689 2849560528 Bacteria 5393480
241 2849576017 2849573788 Bacteria 5421256
242 2851153381 2851153111 Bacteria 5542585
243 2857505471 2857504554 Bacteria 5369913
244 2884962265 2884960567 Bacteria 5437054
245 2898331555 2898329390 Bacteria 5168154
246 2928029549 2928027323 Bacteria 4382488
247 2928533070 2928531327 Bacteria 5101314
248 2984557475 2984555340 Bacteria 4247089
249 2993359208 2993356040 Bacteria 4247105
250 3007254145 3007252601 Bacteria 4559114
251 3007317117 3007315729 Bacteria 5076637
252 Ga0451576_0004019
253 JGI25165J46597_1000032
254 JGI25153J46596_10036190
255 Ga0055536_1002547
256 Ga0055536_1002762
257 Ga0055530_10000045
258 Ga0055530_10003768
259 Ga0055530_10009725
260 Ga0055531_10003599
261 Ga0055531_10014018
262 Ga0065165_1001209
263 Ga0065165_1001873
264 Ga0070658_10363048
265 Ga0070680_100000081
266 Ga0070691_10064947
267 Ga0070708_100033851
268 Ga0070681_10029507
269 Ga0070681_10163031
270 Ga0070679_100000031
271 Ga0070679_100302665
272 Ga0068855_100135890
273 Ga0068855_100374366
274 Ga0068859_100041073
275 Ga0068863_100010285
276 Ga0068860_100000391
277 Ga0068862_100000014
278 Ga0075363_100087489
279 Ga0075369_10000943
280 Ga0075366_10039431
281 Ga0097620_100041073
282 Ga0105240_10067893
283 Ga0105247_10001671
284 Ga0105242_10147953
285 Ga0105248_10055601
286 Ga0105238_10207711
287 Ga0105249_10000002
288 Ga0157373_10085101
289 Ga0157370_10216974
290 Ga0157369_10314711
291 Ga0157375_10152156
292 Ga0163163_10128008
293 Ga0163163_10331069
294 Ga0182006_1082762
295 Ga0206354_10648923
296 Ga0206353_10246987
297 Ga0209437_105615
298 Ga0209026_1007292
299 Ga0209233_1000066
300 Ga0209565_1001017
301 Ga0209673_1000910
302 Ga0209676_1000171
303 Ga0209676_1000177
304 Ga0209564_1001677
305 Ga0209758_1000782
306 Ga0209758_1003851
307 Ga0209050_1000121
308 Ga0209050_1000391
309 Ga0209050_1000496
310 Ga0209256_1002273
311 Ga0209256_1022340
312 Ga0209051_1003390
313 Ga0209257_1000125
314 Ga0209257_1000224
315 Ga0209257_1000253
316 Ga0209257_1002307
317 Ga0209257_1008861
318 Ga0207710_10000920
319 Ga0207654_10111155
320 Ga0207707_10131300
321 Ga0207707_10266309
322 Ga0207695_10000575
323 Ga0207695_10005806
324 Ga0207695_10057092
325 Ga0207695_10150584
326 Ga0207660_10000342
327 Ga0207652_10000003
328 Ga0207694_10007063
329 Ga0207644_10228846
330 Ga0207706_10165375
331 Ga0207711_10001469
332 Ga0207667_10088139
333 Ga0207712_10000002
334 Ga0207641_10003069
335 Ga0207676_10021046
336 Ga0209371_1000094
337 Ga0209981_1000043
338 Ga0268266_10042635
339 Ga0268265_10000048
340 Ga0268264_10000439
341 Ga0307517_10012557
342 Ga0268256_1000083
343 Ga0307511_10076951
344 Ga0265320_10000088
345 Ga0265325_10010201
346 Ga0307513_10002446
347 Ga0307513_10009092
348 Ga0307410_10168178
349 Ga0307406_10312526
350 Ga0307510_10150285
351 Ga0373936_0022662
352 Ga0373946_0011042
353 Ga0373935_0234509
354 Ga0373927_0000479
355 Ga0373925_0000023
356 Ga0395900_0103443
357 Ga0395898_0116057
358 Ga0395905_0004157
359 Ga0395905_0188866
360 Ga0395905_0245689
361 Ga0395901_0048250
362 Ga0395901_0192200
363 Ga0439437_000883
364 Ga0439456_022495
365 Ga0439464_0005211
366 Ga0451577_0440548
367 Ga0453684_0001961
368 Ga0451576_0129484
369 Ga0466967_0521877
370 Ga0495627_000656
371 Ga0495590_0000868
372 Ga0495638_0000370
373 Ga0495638_0001482
374 Ga0495638_0003212
375 Ga0495650_0000068
376 Ga0495650_0103325
377 Ga0495607_0020815
378 Ga0495583_0000002
379 Ga0495606_0028579
380 Ga0495610_0000111
381 Ga0495610_0005818
382 Ga0495616_0000782
383 Ga0495632_0005603
384 Ga0495637_0031657
385 Ga0495648_0000281
386 Ga0495648_0169616
387 Ga0495654_0000051
388 Ga0495621_0029027
389 Ga0495668_0000026
390 Ga0495668_0012085
391 Ga0495668_0014176
392 Ga0495668_0067450
393 Ga0495625_0000198
394 Ga0495625_0002170
395 Ga0495625_0002430
396 Ga0495625_0012992
397 Ga0495625_0051073
398 Ga0495659_0086346
399 Ga0495671_0050307
400 Ga0495671_0140224
401 Ga0495660_0047248
402 Ga0495660_0064795
403 Ga0495673_0000267
404 Ga0495673_0000287
405 Ga0495681_0117667
406 Ga0495686_0000857
407 Ga0495686_0005076
408 Ga0495686_0008981
409 Ga0495686_0047325
410 Ga0495686_0108384
411 Ga0496106_0104431
412 Ga0496107_0000038
413 Ga0496108_0374372
414 Ga0496109_0147307
415 Ga0496115_0003309
416 Ga0496115_0057575
417 Ga0496115_0260287
418 Ga0496124_0029889
419 Ga0496125_0020573
420 Ga0495678_000903
421 Ga0501032_0106289
422 Ga0501037_0009345
423 Ga0501039_0003630
424 Ga0501040_0006561
425 Ga0501042_0008197
426 Ga0501043_0017002
427 Ga0501046_0011419
428 Ga0501071_0039262
429 Ga0501072_0013860
430 Ga0501073_0034328
431 Ga0501074_0004427
432 Ga0501075_0001110
433 Ga0501076_0019524
434 Ga0501077_0001182
435 Ga0501080_0002136
436 Ga0501081_0010673
437 Ga0501083_0015413
438 Ga0501035_0022926
439 Ga0501045_0015661
440 nmdc:mga0k408_32189_c1
441 nmdc:mga07m45_32569_c1
442 nmdc:mga0sz30_4740_c1
443 Ga0500578_0000070
444 Ga0500578_0220878
445 Ga0500643_012246
446 Ga0500644_0000082
447 Ga0500644_0006720
448 Ga0500554_006676
449 Ga0500556_0001096
450 Ga0500594_0000158
451 Ga0500595_052379
452 Ga0500608_000072
453 Ga0500658_0000824
454 Ga0500559_0000304
455 Ga0500559_0002780
456 Ga0500564_000232
457 Ga0500577_0004215
458 Ga0500616_0073654
459 Ga0500622_0001700
460 Ga0500622_0006548
461 Ga0500622_0054162
462 Ga0500627_0024604
463 Ga0500636_0116826
464 Ga0500611_001493
465 Ga0500645_001056
466 Ga0500645_001569
467 Ga0500609_000110
468 Ga0500587_000592
469 Ga0501084_0003575
470 Ga0501082_0067204
471 Ga0530510_0007152
472 2511121987
473 2512643346
474 2585147915
475 2585194721
476 2587918324
477 2643748422
478 2643782381
479 2643924154
480 2643930787
481 2644086916
482 2644227784
483 2644233955
484 2644341870
485 2644368157
486 2644510095
487 2792459049
488 2819540124
489 2819649162
490 2843746579
491 2849563689
492 2849576017
493 2851153381
494 2857505471
495 2884962265
496 2898331555
497 2928029549
498 2928533070
499 2984557475
500 2993359208
501 3007254145
502 3007317117

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00962

A_deaminase

Adenosine deaminase

13

333

0.97

PF19326

AMP_deaminase

AMP deaminase

186

330

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pbm-assembly1.cif.gz_A the crystal structure of adenosine deaminase in complex with chloropurine from pseudomonas aeruginosa 0.9866 10 321
3rys-assembly2.cif.gz_B the crystal structure of adenine deaminase (aaur1117) from arthrobacter aurescens 0.9828 15 339
3pbm-assembly1.cif.gz_A the crystal structure of adenosine deaminase in complex with chloropurine from pseudomonas aeruginosa 0.9804 10 321
3rys-assembly2.cif.gz_B the crystal structure of adenine deaminase (aaur1117) from arthrobacter aurescens 0.9739 15 339
6n9m-assembly1.cif.gz_A crystal structure of adenosine deaminase from salmonella typhimurium with pentostatin (deoxycoformycin) 0.9444 13 334
ID Description Score Start End Superfamily
af_Q9P6I7_4_353_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9829 8 340 3.20.20.140
3rysB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9828 15 339 3.20.20.140
af_P53909_2_346_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9765 9 340 3.20.20.140
af_E9AHV7_5_359_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9739 8 340 3.20.20.140
3rysB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9739 15 339 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A7Y2BR73-F1-model_v4 Adenosine deaminase 0.9986 183 340 GO:0000034
GO:0005829
GO:0006146
GO:0043103
AF-A0A6M0F672-F1-model_v4 Adenosine deaminase (EC 3.5.4.4) 0.9972 79 340 GO:0000034
GO:0004000
GO:0005829
GO:0006146
GO:0043103
GO:0046936
AF-A0A3L7T771-F1-model_v4 Adenosine deaminase 0.9972 178 341 GO:0000034
GO:0005829
GO:0006146
GO:0009168
GO:0043103
AF-A0A4Q2LBT3-F1-model_v4 deleted 0.9966 238 340
AF-A0A6N7D3B3-F1-model_v4 Adenine deaminase (ADE) (EC 3.5.4.2) (Adenine aminohydrolase) (AAH) 0.9958 75 340 GO:0000034
GO:0005829
GO:0006146
GO:0009117
GO:0043103

Map