F363453

General Info

Members Datasets Scaffolds Average Seq Length
252 138 504 396

Family's Representative Sequence

Representative Sequence 3300044735|Ga0466968_0036592|Ga0466968_0036592_162_1337
Length 391
Sequence MYQFEQTMRWFGPSDPVSLADIRQAGCTGVVSALHHVPNGAVWTKEEILQRKKIIEAAGLTWSVVESVPVHEEIKTQKGRYQEYIANYCESIRNLAACGIYIVTYNFMPVLDWTRTDLAYTVADGSKALRFEKAAMVAFDVYMLKRPGAEKDYTAADLAKAQQRLAAMSDDEKQLLQRNIIAGLPGSEESFTLQKFQAALDTYAGIDAKKLQQHLIYFLQQVSPVADEVGVKLVVHPDDPPYAIFGLPRVVSTAEHVQQLFDAVPNASNGLCFCTGSFGVRADNNLPAMVQQFGDRINFIHLRSTQRDAEGNFYEANHLEGDVDMYNVVKNLVKVMQKRQINIAMRPDHGHQMLDDLNKKTNPGYSAIGRLRGLAELRGLEMGIARSMASQ

Samples

Sample ID Description Type Environment
1 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
46 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
55 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
56 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
57 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
58 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
59 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
88 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
89 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
90 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
91 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
92 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
93 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
94 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
95 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
96 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
97 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
98 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
99 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
100 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
101 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
102 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
103 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
104 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
105 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
106 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
107 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
108 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
109 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
110 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
111 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
112 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
113 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
114 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
115 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
116 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
117 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
118 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
119 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
120 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
122 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
123 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
124 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
125 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
126 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
127 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
128 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
129 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
130 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
131 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
132 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
133 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
134 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
135 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
136 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
137 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
138 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.43
Metatranscriptomes 0.4
Isolates 3.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.75
Nodule 0
Rhizoplane 0.4
Rhizosphere 85.71
Stem 0
Stem Tuber 0
Unclassified 0.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466968_0036592 3300044735 Bacteria 2057
2 JGI24743J22301_10012607 3300001991 Bacteria 1540
3 JGI25162J39368_1000012 3300002737 Bacteria 373191
4 rootH1_10005394 3300003316 Bacteria 34329
5 rootH2_10036808 3300003320 Bacteria 14194
6 rootL2_10165306 3300003322 Bacteria 2354
7 rootL2_10212956 3300003322 Bacteria 3605
8 rootH1_10035299 3300003323 Bacteria 54644
9 rootH1_10062487 3300003323 Bacteria 1961
10 rootH1_10157693 3300003323 Bacteria 4022
11 rootH1_10279903 3300003323 Bacteria 2747
12 Ga0058863_11774510 3300004799 Bacteria 1320
13 Ga0065714_10018180 3300005288 Bacteria 2246
14 Ga0070658_10000113 3300005327 Bacteria 72221
15 Ga0070658_10072052 3300005327 Bacteria 2831
16 Ga0070676_10000430 3300005328 Bacteria 19880
17 Ga0070683_100338598 3300005329 Bacteria 1432
18 Ga0070680_100001180 3300005336 Bacteria 18795
19 Ga0070682_100000632 3300005337 Bacteria 21377
20 Ga0068868_100004489 3300005338 Bacteria 9793
21 Ga0068868_100007397 3300005338 Bacteria 7823
22 Ga0070660_100015440 3300005339 Bacteria 5516
23 Ga0070691_10001554 3300005341 Bacteria 9896
24 Ga0070671_100014322 3300005355 Bacteria 6406
25 Ga0070659_100000119 3300005366 Bacteria 59333
26 Ga0070659_100001920 3300005366 Bacteria 14847
27 Ga0070659_100014255 3300005366 Bacteria 5934
28 Ga0070659_100061997 3300005366 Bacteria 2955
29 Ga0070678_100021914 3300005456 Bacteria 4223
30 Ga0070662_100000003 3300005457 Bacteria 239813
31 Ga0070681_10003572 3300005458 Bacteria 14581
32 Ga0070681_10003681 3300005458 Bacteria 14383
33 Ga0068867_100000725 3300005459 Bacteria 22054
34 Ga0070698_100001608 3300005471 Bacteria 25137
35 Ga0070679_100002597 3300005530 Bacteria 16419
36 Ga0070679_100034759 3300005530 Unclassified 4997
37 Ga0070684_100028398 3300005535 Bacteria 4733
38 Ga0068853_100002099 3300005539 Bacteria 14786
39 Ga0068853_100002412 3300005539 Bacteria 13959
40 Ga0070665_100000012 3300005548 Bacteria 508937
41 Ga0068855_100000019 3300005563 Bacteria 205963
42 Ga0068855_100002739 3300005563 Bacteria 21701
43 Ga0068855_100005291 3300005563 Bacteria 15758
44 Ga0068855_100009031 3300005563 Bacteria 12044
45 Ga0068855_100033806 3300005563 Bacteria 6100
46 Ga0068855_100042148 3300005563 Bacteria 5409
47 Ga0068855_100080114 3300005563 Bacteria 3787
48 Ga0068855_100245017 3300005563 Bacteria 2001
49 Ga0068857_100039587 3300005577 Bacteria 4176
50 Ga0068857_100063872 3300005577 Bacteria 3273
51 Ga0068854_100120797 3300005578 Bacteria 1989
52 Ga0068856_100000014 3300005614 Bacteria 163480
53 Ga0068856_100004414 3300005614 Bacteria 14023
54 Ga0068856_100242444 3300005614 Bacteria 1818
55 Ga0068852_100001570 3300005616 Bacteria 15506
56 Ga0075366_10000884 3300006195 Bacteria 14482
57 Ga0075366_10008311 3300006195 Bacteria 5765
58 Ga0097621_100000076 3300006237 Bacteria 51192
59 Ga0068871_100000070 3300006358 Bacteria 57286
60 Ga0068865_100000763 3300006881 Bacteria 18076
61 Ga0105240_10000515 3300009093 Bacteria 71183
62 Ga0105240_10001256 3300009093 Bacteria 44019
63 Ga0105240_10038058 3300009093 Bacteria 6175
64 Ga0105240_10077499 3300009093 Bacteria 4095
65 Ga0114129_10004260 3300009147 Bacteria 20220
66 Ga0105241_10000832 3300009174 Bacteria 23374
67 Ga0105241_10003983 3300009174 Bacteria 10917
68 Ga0105241_10018989 3300009174 Bacteria 5067
69 Ga0105242_10073812 3300009176 Bacteria 2837
70 Ga0105237_10000709 3300009545 Bacteria 46102
71 Ga0105237_10000779 3300009545 Bacteria 43629
72 Ga0105237_10001498 3300009545 Bacteria 30756
73 Ga0105237_10002541 3300009545 Bacteria 22572
74 Ga0105237_10003398 3300009545 Bacteria 18931
75 Ga0105237_10007988 3300009545 Bacteria 11517
76 Ga0105237_10012354 3300009545 Bacteria 8996
77 Ga0105237_10012690 3300009545 Bacteria 8866
78 Ga0105237_10024030 3300009545 Bacteria 6235
79 Ga0105238_10001588 3300009551 Bacteria 22750
80 Ga0105238_10127126 3300009551 Bacteria 2527
81 Ga0105238_10179454 3300009551 Bacteria 2094
82 Ga0105239_10000001 3300010375 Bacteria 617353
83 Ga0105239_10000010 3300010375 Bacteria 341545
84 Ga0105239_10000117 3300010375 Bacteria 112291
85 Ga0105239_10001338 3300010375 Bacteria 33217
86 Ga0105239_10001441 3300010375 Bacteria 31694
87 Ga0105239_10009681 3300010375 Bacteria 10836
88 Ga0105239_10148052 3300010375 Bacteria 2619
89 Ga0157373_10000045 3300013100 Bacteria 112207
90 Ga0157373_10001737 3300013100 Bacteria 16561
91 Ga0157371_10002765 3300013102 Bacteria 16489
92 Ga0157371_10034616 3300013102 Bacteria 3622
93 Ga0157370_10000440 3300013104 Bacteria 51946
94 Ga0157370_10023652 3300013104 Bacteria 6098
95 Ga0157370_10114730 3300013104 Bacteria 2516
96 Ga0157369_10003209 3300013105 Bacteria 19502
97 Ga0157369_10054288 3300013105 Bacteria 4328
98 Ga0157369_10127403 3300013105 Bacteria 2698
99 Ga0157374_10000147 3300013296 Bacteria 63762
100 Ga0157374_10002011 3300013296 Bacteria 17066
101 Ga0157374_10002735 3300013296 Bacteria 14808
102 Ga0157378_10057614 3300013297 Bacteria 3463
103 Ga0163162_10000044 3300013306 Bacteria 128200
104 Ga0163162_10048214 3300013306 Bacteria 4268
105 Ga0157372_10000015 3300013307 Bacteria 225365
106 Ga0157372_10001436 3300013307 Bacteria 25757
107 Ga0157372_10002432 3300013307 Bacteria 20167
108 Ga0157372_10008737 3300013307 Bacteria 10754
109 Ga0157372_10138186 3300013307 Bacteria 2807
110 Ga0157372_10173782 3300013307 Bacteria 2493
111 Ga0157375_10052879 3300013308 Bacteria 3995
112 Ga0182006_1000313 3300015261 Bacteria 42556
113 Ga0209437_100041 3300025233 Bacteria 444465
114 Ga0209646_1004200 3300025246 Bacteria 2659
115 Ga0209026_1000507 3300025250 Bacteria 27632
116 Ga0209026_1001979 3300025250 Bacteria 8185
117 Ga0209026_1007297 3300025250 Bacteria 2520
118 Ga0209233_1002896 3300025261 Bacteria 6132
119 Ga0209455_1007878 3300025272 Bacteria 2955
120 Ga0207647_10000049 3300025904 Bacteria 88392
121 Ga0207647_10000128 3300025904 Bacteria 59284
122 Ga0207645_10000300 3300025907 Bacteria 41495
123 Ga0207705_10000160 3300025909 Bacteria 72235
124 Ga0207705_10061570 3300025909 Bacteria 2711
125 Ga0207654_10000480 3300025911 Bacteria 22898
126 Ga0207654_10003537 3300025911 Bacteria 7900
127 Ga0207654_10003927 3300025911 Bacteria 7484
128 Ga0207707_10000026 3300025912 Bacteria 175026
129 Ga0207707_10000067 3300025912 Bacteria 105764
130 Ga0207695_10000267 3300025913 Bacteria 131133
131 Ga0207695_10008564 3300025913 Bacteria 12782
132 Ga0207695_10026137 3300025913 Bacteria 6519
133 Ga0207695_10028933 3300025913 Bacteria 6133
134 Ga0207695_10042219 3300025913 Bacteria 4874
135 Ga0207695_10206848 3300025913 Bacteria 1875
136 Ga0207671_10000244 3300025914 Bacteria 81258
137 Ga0207671_10001051 3300025914 Bacteria 33539
138 Ga0207671_10004337 3300025914 Bacteria 13623
139 Ga0207671_10009252 3300025914 Bacteria 8252
140 Ga0207671_10039782 3300025914 Bacteria 3482
141 Ga0207660_10008151 3300025917 Bacteria 6778
142 Ga0207657_10100717 3300025919 Bacteria 2398
143 Ga0207652_10000109 3300025921 Bacteria 89337
144 Ga0207694_10010575 3300025924 Bacteria 6965
145 Ga0207694_10284477 3300025924 Bacteria 1359
146 Ga0207644_10024838 3300025931 Bacteria 4116
147 Ga0207690_10001206 3300025932 Bacteria 16325
148 Ga0207690_10209060 3300025932 Bacteria 1486
149 Ga0207706_10000111 3300025933 Bacteria 87282
150 Ga0207704_10000016 3300025938 Bacteria 158362
151 Ga0207661_10075502 3300025944 Bacteria 2766
152 Ga0207667_10000020 3300025949 Bacteria 374770
153 Ga0207667_10003000 3300025949 Bacteria 20942
154 Ga0207667_10024953 3300025949 Bacteria 6554
155 Ga0207651_10009234 3300025960 Bacteria 5383
156 Ga0207640_10102672 3300025981 Bacteria 2009
157 Ga0207677_10010114 3300026023 Bacteria 5326
158 Ga0207677_10033257 3300026023 Bacteria 3324
159 Ga0207639_10001710 3300026041 Bacteria 14786
160 Ga0207639_10014325 3300026041 Bacteria 5574
161 Ga0207702_10000036 3300026078 Bacteria 154106
162 Ga0207702_10026139 3300026078 Bacteria 4846
163 Ga0207648_10000661 3300026089 Bacteria 38618
164 Ga0207674_10037579 3300026116 Bacteria 5034
165 Ga0207683_10005303 3300026121 Bacteria 11054
166 Ga0207698_10008542 3300026142 Bacteria 6486
167 Ga0268266_10000080 3300028379 Bacteria 210179
168 Ga0307515_10003035 3300028794 Bacteria 35572
169 Ga0307515_10004651 3300028794 Bacteria 28175
170 Ga0307515_10158386 3300028794 Bacteria 2323
171 Ga0265338_10070972 3300028800 Bacteria 2983
172 Ga0265327_10012357 3300031251 Bacteria 5772
173 Ga0307509_10070219 3300031507 Bacteria 3659
174 Ga0307507_10000015 3300033179 Bacteria 237419
175 Ga0395899_0000002 3300037312 Bacteria 1324310
176 Ga0395899_0000050 3300037312 Bacteria 224591
177 Ga0395899_0000534 3300037312 Bacteria 41504
178 Ga0395899_0000615 3300037312 Bacteria 37072
179 Ga0395899_0013779 3300037312 Bacteria 6180
180 Ga0395900_0000493 3300037418 Bacteria 55751
181 Ga0395900_0001751 3300037418 Bacteria 24946
182 Ga0395900_0005952 3300037418 Bacteria 12734
183 Ga0395898_0042542 3300037466 Bacteria 4481
184 Ga0395898_0066854 3300037466 Bacteria 3481
185 Ga0395905_0000461 3300037471 Bacteria 56680
186 Ga0395905_0002338 3300037471 Bacteria 21140
187 Ga0395901_0049355 3300038443 Bacteria 4372
188 Ga0395901_0072331 3300038443 Bacteria 3595
189 Ga0436361_0112281 3300039447 Bacteria 3381
190 Ga0439457_002520 3300042014 Bacteria 5213
191 Ga0439462_0009006 3300042015 Bacteria 2525
192 Ga0466966_0000113 3300044684 Bacteria 49984
193 Ga0466966_0060854 3300044684 Bacteria 2383
194 Ga0466970_0089532 3300044765 Bacteria 1670
195 Ga0466959_0000015 3300045049 Bacteria 149242
196 Ga0495650_0051670 3300046471 Bacteria 1692
197 Ga0495585_0000138 3300046492 Bacteria 79479
198 Ga0495585_0000904 3300046492 Bacteria 25136
199 Ga0495606_0010350 3300046507 Bacteria 7752
200 Ga0495606_0010588 3300046507 Bacteria 7632
201 Ga0495610_0000302 3300046512 Bacteria 51984
202 Ga0495616_0009129 3300046513 Bacteria 5817
203 Ga0495616_0012774 3300046513 Bacteria 4753
204 Ga0495616_0022057 3300046513 Bacteria 3441
205 Ga0495648_0001856 3300046524 Bacteria 20231
206 Ga0495648_0013499 3300046524 Bacteria 6032
207 Ga0495652_0115908 3300046529 Bacteria 2146
208 Ga0495652_0125385 3300046529 Bacteria 2041
209 Ga0495609_0032228 3300046538 Bacteria 2381
210 Ga0495633_0000069 3300046558 Bacteria 135128
211 Ga0495668_0000494 3300046616 Bacteria 49401
212 Ga0495625_0000067 3300046660 Bacteria 171483
213 Ga0495625_0002630 3300046660 Bacteria 19183
214 Ga0495625_0003210 3300046660 Bacteria 16599
215 Ga0495625_0010306 3300046660 Bacteria 7749
216 Ga0495625_0010978 3300046660 Bacteria 7435
217 Ga0495625_0025194 3300046660 Bacteria 4515
218 Ga0495625_0114831 3300046660 Bacteria 1838
219 Ga0495649_0000054 3300046694 Bacteria 107048
220 Ga0495589_0042862 3300046794 Bacteria 2254
221 Ga0495600_0106615 3300046809 Bacteria 1826
222 Ga0495687_005648 3300047443 Bacteria 7900
223 Ga0495686_0000083 3300047472 Bacteria 198933
224 Ga0495686_0001829 3300047472 Bacteria 21405
225 Ga0495686_0002235 3300047472 Bacteria 18711
226 Ga0495686_0009256 3300047472 Bacteria 7114
227 Ga0495686_0027974 3300047472 Bacteria 3676
228 Ga0495686_0126675 3300047472 Bacteria 1518
229 Ga0496115_0314628 3300048918 Bacteria 1281
230 Ga0501036_0024031 3300049572 Bacteria 5137
231 Ga0501044_0085689 3300049823 Bacteria 3183
232 nmdc:mga0k408_53_c1 3300050493 Bacteria 57877
233 nmdc:mga0k408_80_c1 3300050493 Bacteria 45357
234 nmdc:mga05p37_2426_c1 3300050507 Bacteria 6274
235 Ga0500578_0000457 3300053086 Bacteria 49613
236 Ga0500578_0060472 3300053086 Bacteria 2420
237 Ga0500583_0000028 3300053092 Bacteria 108276
238 Ga0500608_005504 3300053122 Bacteria 5043
239 Ga0500618_000002 3300053125 Bacteria 370822
240 Ga0500652_076675 3300053131 Bacteria 1390
241 Ga0500622_0000333 3300053156 Bacteria 46554
242 Ga0500622_0045879 3300053156 Bacteria 2261
243 Ga0500636_0118851 3300053177 Bacteria 1485
244 Ga0501084_0008228 3300054114 Bacteria 8603
245 2852625122 2852623160 Bacteria 4376875
246 2852629883 2852627209 Bacteria 5896285
247 2884934139 2884933994 Bacteria 4535041
248 2919188046 2919186247 Bacteria 6244071
249 2919439185 2919437846 Bacteria 6199444
250 2919439322 2919437846 Bacteria 6199444
251 2939664687 2939664404 Bacteria 6364494
252 2977232077 2977232053 Bacteria 5485925
253 Ga0466968_0036592
254 JGI24743J22301_10012607
255 JGI25162J39368_1000012
256 rootH1_10005394
257 rootH2_10036808
258 rootL2_10165306
259 rootL2_10212956
260 rootH1_10035299
261 rootH1_10062487
262 rootH1_10157693
263 rootH1_10279903
264 Ga0058863_11774510
265 Ga0065714_10018180
266 Ga0070658_10000113
267 Ga0070658_10072052
268 Ga0070676_10000430
269 Ga0070683_100338598
270 Ga0070680_100001180
271 Ga0070682_100000632
272 Ga0068868_100004489
273 Ga0068868_100007397
274 Ga0070660_100015440
275 Ga0070691_10001554
276 Ga0070671_100014322
277 Ga0070659_100000119
278 Ga0070659_100001920
279 Ga0070659_100014255
280 Ga0070659_100061997
281 Ga0070678_100021914
282 Ga0070662_100000003
283 Ga0070681_10003572
284 Ga0070681_10003681
285 Ga0068867_100000725
286 Ga0070698_100001608
287 Ga0070679_100002597
288 Ga0070679_100034759
289 Ga0070684_100028398
290 Ga0068853_100002099
291 Ga0068853_100002412
292 Ga0070665_100000012
293 Ga0068855_100000019
294 Ga0068855_100002739
295 Ga0068855_100005291
296 Ga0068855_100009031
297 Ga0068855_100033806
298 Ga0068855_100042148
299 Ga0068855_100080114
300 Ga0068855_100245017
301 Ga0068857_100039587
302 Ga0068857_100063872
303 Ga0068854_100120797
304 Ga0068856_100000014
305 Ga0068856_100004414
306 Ga0068856_100242444
307 Ga0068852_100001570
308 Ga0075366_10000884
309 Ga0075366_10008311
310 Ga0097621_100000076
311 Ga0068871_100000070
312 Ga0068865_100000763
313 Ga0105240_10000515
314 Ga0105240_10001256
315 Ga0105240_10038058
316 Ga0105240_10077499
317 Ga0114129_10004260
318 Ga0105241_10000832
319 Ga0105241_10003983
320 Ga0105241_10018989
321 Ga0105242_10073812
322 Ga0105237_10000709
323 Ga0105237_10000779
324 Ga0105237_10001498
325 Ga0105237_10002541
326 Ga0105237_10003398
327 Ga0105237_10007988
328 Ga0105237_10012354
329 Ga0105237_10012690
330 Ga0105237_10024030
331 Ga0105238_10001588
332 Ga0105238_10127126
333 Ga0105238_10179454
334 Ga0105239_10000001
335 Ga0105239_10000010
336 Ga0105239_10000117
337 Ga0105239_10001338
338 Ga0105239_10001441
339 Ga0105239_10009681
340 Ga0105239_10148052
341 Ga0157373_10000045
342 Ga0157373_10001737
343 Ga0157371_10002765
344 Ga0157371_10034616
345 Ga0157370_10000440
346 Ga0157370_10023652
347 Ga0157370_10114730
348 Ga0157369_10003209
349 Ga0157369_10054288
350 Ga0157369_10127403
351 Ga0157374_10000147
352 Ga0157374_10002011
353 Ga0157374_10002735
354 Ga0157378_10057614
355 Ga0163162_10000044
356 Ga0163162_10048214
357 Ga0157372_10000015
358 Ga0157372_10001436
359 Ga0157372_10002432
360 Ga0157372_10008737
361 Ga0157372_10138186
362 Ga0157372_10173782
363 Ga0157375_10052879
364 Ga0182006_1000313
365 Ga0209437_100041
366 Ga0209646_1004200
367 Ga0209026_1000507
368 Ga0209026_1001979
369 Ga0209026_1007297
370 Ga0209233_1002896
371 Ga0209455_1007878
372 Ga0207647_10000049
373 Ga0207647_10000128
374 Ga0207645_10000300
375 Ga0207705_10000160
376 Ga0207705_10061570
377 Ga0207654_10000480
378 Ga0207654_10003537
379 Ga0207654_10003927
380 Ga0207707_10000026
381 Ga0207707_10000067
382 Ga0207695_10000267
383 Ga0207695_10008564
384 Ga0207695_10026137
385 Ga0207695_10028933
386 Ga0207695_10042219
387 Ga0207695_10206848
388 Ga0207671_10000244
389 Ga0207671_10001051
390 Ga0207671_10004337
391 Ga0207671_10009252
392 Ga0207671_10039782
393 Ga0207660_10008151
394 Ga0207657_10100717
395 Ga0207652_10000109
396 Ga0207694_10010575
397 Ga0207694_10284477
398 Ga0207644_10024838
399 Ga0207690_10001206
400 Ga0207690_10209060
401 Ga0207706_10000111
402 Ga0207704_10000016
403 Ga0207661_10075502
404 Ga0207667_10000020
405 Ga0207667_10003000
406 Ga0207667_10024953
407 Ga0207651_10009234
408 Ga0207640_10102672
409 Ga0207677_10010114
410 Ga0207677_10033257
411 Ga0207639_10001710
412 Ga0207639_10014325
413 Ga0207702_10000036
414 Ga0207702_10026139
415 Ga0207648_10000661
416 Ga0207674_10037579
417 Ga0207683_10005303
418 Ga0207698_10008542
419 Ga0268266_10000080
420 Ga0307515_10003035
421 Ga0307515_10004651
422 Ga0307515_10158386
423 Ga0265338_10070972
424 Ga0265327_10012357
425 Ga0307509_10070219
426 Ga0307507_10000015
427 Ga0395899_0000002
428 Ga0395899_0000050
429 Ga0395899_0000534
430 Ga0395899_0000615
431 Ga0395899_0013779
432 Ga0395900_0000493
433 Ga0395900_0001751
434 Ga0395900_0005952
435 Ga0395898_0042542
436 Ga0395898_0066854
437 Ga0395905_0000461
438 Ga0395905_0002338
439 Ga0395901_0049355
440 Ga0395901_0072331
441 Ga0436361_0112281
442 Ga0439457_002520
443 Ga0439462_0009006
444 Ga0466966_0000113
445 Ga0466966_0060854
446 Ga0466970_0089532
447 Ga0466959_0000015
448 Ga0495650_0051670
449 Ga0495585_0000138
450 Ga0495585_0000904
451 Ga0495606_0010350
452 Ga0495606_0010588
453 Ga0495610_0000302
454 Ga0495616_0009129
455 Ga0495616_0012774
456 Ga0495616_0022057
457 Ga0495648_0001856
458 Ga0495648_0013499
459 Ga0495652_0115908
460 Ga0495652_0125385
461 Ga0495609_0032228
462 Ga0495633_0000069
463 Ga0495668_0000494
464 Ga0495625_0000067
465 Ga0495625_0002630
466 Ga0495625_0003210
467 Ga0495625_0010306
468 Ga0495625_0010978
469 Ga0495625_0025194
470 Ga0495625_0114831
471 Ga0495649_0000054
472 Ga0495589_0042862
473 Ga0495600_0106615
474 Ga0495687_005648
475 Ga0495686_0000083
476 Ga0495686_0001829
477 Ga0495686_0002235
478 Ga0495686_0009256
479 Ga0495686_0027974
480 Ga0495686_0126675
481 Ga0496115_0314628
482 Ga0501036_0024031
483 Ga0501044_0085689
484 nmdc:mga0k408_53_c1
485 nmdc:mga0k408_80_c1
486 nmdc:mga05p37_2426_c1
487 Ga0500578_0000457
488 Ga0500578_0060472
489 Ga0500583_0000028
490 Ga0500608_005504
491 Ga0500618_000002
492 Ga0500652_076675
493 Ga0500622_0000333
494 Ga0500622_0045879
495 Ga0500636_0118851
496 Ga0501084_0008228
497 2852625122
498 2852629883
499 2884934139
500 2919188046
501 2919439185
502 2919439322
503 2939664687
504 2977232077

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03786

UxuA

D-mannonate dehydratase (UxuA)

4

386

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4eay-assembly1.cif.gz_A crystal structures of mannonate dehydratase from escherichia coli strain k12 complexed with d-mannonate 0.9718 3 397
4eay-assembly1.cif.gz_A crystal structures of mannonate dehydratase from escherichia coli strain k12 complexed with d-mannonate 0.9694 3 397
3ban-assembly1.cif.gz_B the crystal structure of mannonate dehydratase from streptococcus suis serotype2 0.9204 3 394
3ban-assembly1.cif.gz_A the crystal structure of mannonate dehydratase from streptococcus suis serotype2 0.9042 3 397
1tz9-assembly1.cif.gz_B crystal structure of the putative mannonate dehydratase from enterococcus faecalis, northeast structural genomics target efr41 0.8999 5 393
ID Description Score Start End Superfamily
4eayC01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9752 3 397 3.20.20.150
4eayC01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9679 3 397 3.20.20.150
af_P24215_172_393_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9601 177 397 3.20.20.150
af_P24215_172_393_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9517 177 397 3.20.20.150
3banB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9204 3 394 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A7X0DXS7-F1-model_v4 Mannonate dehydratase (EC 4.2.1.8) (D-mannonate hydro-lyase) 0.9915 1 395 GO:0008198
GO:0008927
GO:0030145
GO:0042840
AF-A0A4R4GZ66-F1-model_v4 deleted 0.9914 207 317
AF-A0A530M004-F1-model_v4 deleted 0.9905 261 344
AF-A0A7X0DXS7-F1-model_v4 Mannonate dehydratase (EC 4.2.1.8) (D-mannonate hydro-lyase) 0.989 1 395 GO:0008198
GO:0008927
GO:0030145
GO:0042840
AF-A0A7Y2DG78-F1-model_v4 Mannonate dehydratase (EC 4.2.1.8) 0.987 5 291 GO:0008198
GO:0008927
GO:0030145
GO:0042840

Map