F363897

General Info

Members Datasets Scaffolds Average Seq Length
253 161 506 434

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100000021|Ga0070665_100000021186
Length 473
Sequence LRQAEQNVPPNQAWRPKAERPTLKATRPIRAAVSTKEGIISDQPALTAASGAAQRNDLLALFGEAVRAVSADSAMPPAIPLSPHGRNVVIAVGKGAAAMMRVAQARSKGNVVEGLVVTRHGHVPEGTAWPGVEIIEAGHPYPDENSVRAAHRALEIAHTLDAGDRLLVLLSXXXXALLAAPAPGLSLADKQAITRALLQSGATIEEINRVRKHLSLVKGGRLAVAAGAAGVTTWIISDVPGDDPSFVSSGPTVADTSNLDMAREIIERYGIDPSPRVVAALSDPANETPSADSLGIAGSETIVIARARDALAAAGRLARDKGYQVTDIGDNIQAEARHLGAAHAALSRRLAQDGARRVILSGGETTVTVVNKDGRGGRNLEYLLGLAIALDGAPGIWALACDTDGIDGTEDAAGAIITPDTLARAREAGLDPAAYLAANNAYLFFEGIGDLVVSGPTLTNVNDFRAILIDAKA

Samples

Sample ID Description Type Environment
1 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
9 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
10 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
62 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
63 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
64 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
65 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
68 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
100 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
101 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
102 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
103 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
104 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
107 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
108 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
113 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
114 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
115 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
116 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
117 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
118 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
119 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
120 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
121 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
122 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
123 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
124 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
125 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
126 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
127 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
128 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
129 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
130 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
131 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
132 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
133 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
134 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
135 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
136 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
137 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
138 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
139 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
140 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
141 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
142 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
143 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
144 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
145 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
146 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
147 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
148 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
149 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
150 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
151 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
152 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
153 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
154 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
155 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
156 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
157 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
158 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
159 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
160 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
161 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.63
Metatranscriptomes 0
Isolates 2.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.74
Nodule 0
Rhizoplane 7.11
Rhizosphere 77.87
Stem 0
Stem Tuber 0
Unclassified 1.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070665_100000021 3300005548 Bacteria 389668
2 JGI24740J21852_10000521 3300001979 Bacteria 16501
3 JGI24739J22299_10015089 3300001989 Bacteria 2808
4 JGI24735J21928_10006198 3300002067 Bacteria 3949
5 JGI24751J29686_10000273 3300002459 Bacteria 20099
6 JGI25406J46586_10000513 3300003203 Bacteria 18124
7 Ga0055536_1002105 3300003781 Bacteria 11326
8 Ga0055534_1003465 3300003784 Bacteria 4948
9 Ga0055530_10000005 3300003791 Bacteria 206625
10 Ga0055531_10001265 3300003794 Bacteria 19142
11 Ga0055531_10016984 3300003794 Bacteria 3102
12 Ga0070658_10127374 3300005327 Bacteria 2120
13 Ga0070683_100009905 3300005329 Bacteria 8169
14 Ga0070690_100000846 3300005330 Bacteria 15527
15 Ga0070670_100005356 3300005331 Bacteria 10825
16 Ga0070670_100032099 3300005331 Bacteria 4522
17 Ga0070670_100102803 3300005331 Unclassified 2461
18 Ga0070680_100007645 3300005336 Bacteria 8245
19 Ga0070682_100005400 3300005337 Bacteria 7114
20 Ga0068868_100006012 3300005338 Bacteria 8571
21 Ga0070660_100038792 3300005339 Bacteria 3618
22 Ga0070691_10001137 3300005341 Bacteria 11066
23 Ga0070661_100003359 3300005344 Bacteria 11033
24 Ga0070661_100033384 3300005344 Bacteria 3727
25 Ga0070675_100044982 3300005354 Bacteria 3611
26 Ga0070675_100090038 3300005354 Bacteria 2570
27 Ga0070675_100219313 3300005354 Bacteria 1656
28 Ga0070674_100046203 3300005356 Bacteria 2978
29 Ga0070674_100077626 3300005356 Bacteria 2365
30 Ga0070673_100018736 3300005364 Bacteria 4955
31 Ga0070659_100005853 3300005366 Bacteria 8859
32 Ga0070659_100045565 3300005366 Bacteria 3436
33 Ga0070667_100003803 3300005367 Bacteria 12834
34 Ga0070663_100091242 3300005455 Bacteria 2257
35 Ga0070662_100003658 3300005457 Bacteria 9603
36 Ga0070681_10086509 3300005458 Bacteria 3088
37 Ga0068867_100049677 3300005459 Bacteria 3088
38 Ga0068867_100063214 3300005459 Bacteria 2751
39 Ga0070684_100001337 3300005535 Bacteria 17647
40 Ga0070684_100003646 3300005535 Bacteria 11610
41 Ga0068853_100040867 3300005539 Bacteria 3959
42 Ga0070672_100023541 3300005543 Bacteria 4542
43 Ga0070686_100008534 3300005544 Bacteria 5742
44 Ga0070664_100003074 3300005564 Bacteria 13485
45 Ga0070664_100019890 3300005564 Bacteria 5526
46 Ga0070664_100248582 3300005564 Bacteria 1598
47 Ga0068857_100018738 3300005577 Bacteria 6074
48 Ga0068857_100039671 3300005577 Bacteria 4172
49 Ga0068854_100001320 3300005578 Bacteria 14976
50 Ga0068856_100000380 3300005614 Bacteria 48567
51 Ga0068856_100070515 3300005614 Bacteria 3457
52 Ga0068856_100255612 3300005614 Bacteria 1767
53 Ga0068852_100004417 3300005616 Bacteria 9935
54 Ga0068852_100012705 3300005616 Bacteria 6409
55 Ga0068859_100004889 3300005617 Bacteria 13646
56 Ga0068864_100005661 3300005618 Bacteria 10247
57 Ga0068864_100064039 3300005618 Bacteria 3187
58 Ga0068864_100194624 3300005618 Bacteria 1860
59 Ga0068866_10061166 3300005718 Bacteria 1955
60 Ga0068863_100007275 3300005841 Bacteria 10844
61 Ga0068858_100006726 3300005842 Bacteria 11188
62 Ga0068858_100128804 3300005842 Bacteria 2372
63 Ga0081539_10000801 3300005985 Bacteria 61178
64 Ga0070717_10016506 3300006028 Bacteria 5725
65 Ga0097621_100003571 3300006237 Bacteria 10749
66 Ga0097620_100004889 3300006931 Bacteria 13646
67 Ga0075435_100004518 3300007076 Bacteria 9564
68 Ga0105240_10000301 3300009093 Bacteria 96340
69 Ga0105240_10301156 3300009093 Bacteria 1834
70 Ga0105240_10318190 3300009093 Bacteria 1774
71 Ga0105245_10018555 3300009098 Bacteria 6084
72 Ga0105245_10099171 3300009098 Bacteria 2693
73 Ga0105248_10009842 3300009177 Bacteria 10530
74 Ga0105248_10033670 3300009177 Bacteria 5725
75 Ga0105237_10008182 3300009545 Bacteria 11358
76 Ga0105238_10002841 3300009551 Bacteria 17278
77 Ga0105239_10000589 3300010375 Bacteria 51686
78 Ga0157373_10007030 3300013100 Bacteria 8386
79 Ga0157371_10059927 3300013102 Bacteria 2698
80 Ga0157369_10006376 3300013105 Bacteria 13686
81 Ga0157369_10017977 3300013105 Bacteria 7934
82 Ga0157369_10125235 3300013105 Bacteria 2725
83 Ga0157372_10023580 3300013307 Bacteria 6674
84 Ga0157375_10011198 3300013308 Bacteria 7914
85 Ga0157376_10032160 3300014969 Bacteria 4209
86 Ga0163161_10164304 3300017792 Bacteria 1694
87 Ga0213873_10000006 3300021358 Bacteria 408723
88 Ga0213876_10000004 3300021384 Bacteria 943822
89 Ga0213875_10002796 3300021388 Bacteria 10265
90 Ga0213875_10007263 3300021388 Bacteria 5738
91 Ga0213875_10013961 3300021388 Bacteria 3928
92 Ga0209675_1000564 3300025291 Bacteria 26703
93 Ga0209676_1000132 3300025292 Bacteria 185063
94 Ga0209025_1005557 3300025294 Bacteria 10219
95 Ga0209050_1000139 3300025298 Bacteria 173691
96 Ga0209257_1000164 3300025304 Bacteria 173339
97 Ga0209257_1000761 3300025304 Bacteria 48293
98 Ga0209257_1002228 3300025304 Bacteria 19921
99 Ga0207682_10004714 3300025893 Bacteria 5657
100 Ga0207647_10001861 3300025904 Bacteria 16166
101 Ga0207647_10029022 3300025904 Bacteria 3585
102 Ga0207645_10040081 3300025907 Bacteria 3000
103 Ga0207645_10060402 3300025907 Bacteria 2420
104 Ga0207705_10007724 3300025909 Bacteria 7905
105 Ga0207705_10074741 3300025909 Bacteria 2460
106 Ga0207695_10000399 3300025913 Bacteria 97109
107 Ga0207695_10228057 3300025913 Bacteria 1768
108 Ga0207660_10021454 3300025917 Bacteria 4343
109 Ga0207657_10003465 3300025919 Bacteria 16835
110 Ga0207657_10016619 3300025919 Bacteria 7090
111 Ga0207657_10049818 3300025919 Bacteria 3647
112 Ga0207657_10095856 3300025919 Bacteria 2468
113 Ga0207649_10022117 3300025920 Bacteria 3672
114 Ga0207649_10080612 3300025920 Bacteria 2105
115 Ga0207650_10155290 3300025925 Unclassified 1809
116 Ga0207659_10040157 3300025926 Bacteria 3270
117 Ga0207644_10000287 3300025931 Bacteria 33209
118 Ga0207690_10001588 3300025932 Bacteria 14195
119 Ga0207690_10057380 3300025932 Bacteria 2630
120 Ga0207706_10001384 3300025933 Bacteria 24192
121 Ga0207706_10084904 3300025933 Bacteria 2784
122 Ga0207706_10168044 3300025933 Bacteria 1928
123 Ga0207669_10061657 3300025937 Bacteria 2306
124 Ga0207691_10001279 3300025940 Bacteria 25144
125 Ga0207711_10178360 3300025941 Bacteria 1931
126 Ga0207667_10004831 3300025949 Bacteria 16480
127 Ga0207640_10002380 3300025981 Bacteria 10064
128 Ga0207677_10251121 3300026023 Bacteria 1436
129 Ga0207703_10086522 3300026035 Bacteria 2626
130 Ga0207639_10002488 3300026041 Bacteria 12347
131 Ga0207678_10096280 3300026067 Bacteria 2529
132 Ga0207702_10000544 3300026078 Bacteria 42110
133 Ga0207702_10002636 3300026078 Bacteria 16847
134 Ga0207648_10002272 3300026089 Bacteria 20792
135 Ga0207676_10075732 3300026095 Bacteria 2716
136 Ga0207674_10004717 3300026116 Bacteria 16342
137 Ga0207674_10005724 3300026116 Bacteria 14735
138 Ga0207674_10050122 3300026116 Bacteria 4267
139 Ga0207683_10001183 3300026121 Bacteria 23626
140 Ga0207698_10004615 3300026142 Bacteria 8417
141 Ga0207698_10062053 3300026142 Bacteria 2916
142 Ga0207698_10079165 3300026142 Bacteria 2642
143 Ga0268266_10000015 3300028379 Bacteria 630629
144 Ga0307517_10012059 3300028786 Bacteria 11917
145 Ga0307408_100116703 3300031548 Bacteria 2060
146 Ga0307408_100190993 3300031548 Bacteria 1650
147 Ga0307410_10000420 3300031852 Bacteria 16843
148 Ga0307410_10003894 3300031852 Bacteria 7593
149 Ga0307410_10005068 3300031852 Bacteria 6922
150 Ga0307410_10076278 3300031852 Bacteria 2339
151 Ga0307407_10028802 3300031903 Bacteria 2974
152 Ga0307412_10018385 3300031911 Bacteria 4205
153 Ga0307409_100001686 3300031995 Bacteria 11132
154 Ga0307409_100008144 3300031995 Bacteria 6333
155 Ga0307416_100009160 3300032002 Bacteria 6456
156 Ga0307416_100126173 3300032002 Bacteria 2292
157 Ga0307416_100138330 3300032002 Bacteria 2208
158 Ga0307411_10006055 3300032005 Bacteria 6015
159 Ga0307411_10028127 3300032005 Bacteria 3414
160 Ga0307411_10066095 3300032005 Bacteria 2428
161 Ga0307415_100010337 3300032126 Bacteria 5281
162 Ga0307415_100149960 3300032126 Bacteria 1793
163 Ga0395899_0001170 3300037312 Bacteria 23165
164 Ga0395899_0022474 3300037312 Bacteria 4783
165 Ga0395899_0029295 3300037312 Bacteria 4141
166 Ga0395899_0039705 3300037312 Bacteria 3521
167 Ga0395900_0004296 3300037418 Bacteria 15108
168 Ga0395900_0032256 3300037418 Bacteria 5385
169 Ga0395900_0049429 3300037418 Bacteria 4333
170 Ga0395900_0056368 3300037418 Bacteria 4045
171 Ga0395900_0152475 3300037418 Bacteria 2361
172 Ga0395900_0295952 3300037418 Bacteria 1606
173 Ga0395898_0004965 3300037466 Bacteria 14441
174 Ga0395898_0146831 3300037466 Bacteria 2257
175 Ga0395898_0210187 3300037466 Bacteria 1856
176 Ga0395898_0277042 3300037466 Bacteria 1600
177 Ga0395905_0001342 3300037471 Bacteria 29960
178 Ga0395905_0001923 3300037471 Bacteria 23843
179 Ga0395905_0003701 3300037471 Bacteria 16190
180 Ga0395905_0033186 3300037471 Bacteria 4850
181 Ga0395905_0047648 3300037471 Bacteria 4015
182 Ga0395905_0056434 3300037471 Bacteria 3674
183 Ga0395905_0070970 3300037471 Bacteria 3265
184 Ga0395905_0093094 3300037471 Bacteria 2826
185 Ga0395905_0310040 3300037471 Bacteria 1467
186 Ga0436364_0295693 3300037853 Bacteria 5694
187 Ga0436364_0331085 3300037853 Bacteria 17144
188 Ga0436364_0336038 3300037853 Bacteria 1665
189 Ga0436364_0940615 3300037853 Bacteria 6156
190 Ga0436364_1288217 3300037853 Bacteria 30395
191 Ga0395901_0003536 3300038443 Bacteria 15745
192 Ga0395901_0004525 3300038443 Bacteria 14022
193 Ga0395901_0014857 3300038443 Bacteria 7910
194 Ga0395901_0050461 3300038443 Bacteria 4322
195 Ga0395901_0182400 3300038443 Bacteria 2202
196 Ga0395901_0235519 3300038443 Bacteria 1911
197 Ga0395901_0259095 3300038443 Bacteria 1810
198 Ga0395901_0430907 3300038443 Bacteria 1351
199 Ga0436365_0084772 3300039437 Bacteria 1632
200 Ga0436365_0891680 3300039437 Bacteria 1232
201 Ga0436365_0970858 3300039437 Bacteria 175279
202 Ga0436360_0666790 3300039438 Bacteria 7062
203 Ga0436362_0554113 3300039453 Bacteria 162652
204 Ga0453684_0000151 3300044712 Bacteria 306256
205 Ga0451576_0001460 3300045051 Bacteria 40144
206 Ga0495606_0042823 3300046507 Bacteria 3025
207 Ga0495631_0020394 3300046518 Bacteria 3097
208 Ga0495643_0000570 3300046522 Bacteria 45556
209 Ga0495648_0000743 3300046524 Bacteria 34808
210 Ga0495663_0000372 3300046525 Bacteria 16598
211 Ga0495633_0001210 3300046558 Bacteria 20774
212 Ga0495668_0000109 3300046616 Bacteria 132453
213 Ga0495668_0033021 3300046616 Bacteria 2909
214 Ga0495625_0047428 3300046660 Bacteria 3097
215 Ga0495670_0016811 3300046691 Bacteria 3597
216 Ga0495681_0001677 3300047470 Bacteria 16423
217 Ga0496100_0001084 3300048903 Bacteria 13136
218 Ga0496100_0132936 3300048903 Unclassified 1754
219 Ga0496102_0000208 3300048905 Bacteria 78662
220 Ga0496103_0000308 3300048906 Bacteria 45133
221 Ga0496104_0034647 3300048907 Bacteria 4710
222 Ga0496105_0000781 3300048908 Bacteria 21505
223 Ga0496107_0027534 3300048910 Bacteria 4036
224 Ga0496107_0058820 3300048910 Bacteria 2780
225 Ga0496108_0001513 3300048911 Bacteria 18409
226 Ga0496109_0002942 3300048912 Bacteria 14252
227 Ga0496110_0000252 3300048913 Bacteria 34772
228 Ga0496110_0046120 3300048913 Bacteria 3812
229 Ga0496111_0000419 3300048914 Bacteria 21416
230 Ga0496112_0003309 3300048915 Bacteria 13299
231 Ga0496112_0037401 3300048915 Bacteria 4738
232 Ga0496113_0004400 3300048916 Bacteria 8645
233 Ga0496114_0017535 3300048917 Bacteria 5781
234 Ga0496115_0000094 3300048918 Bacteria 83055
235 Ga0496116_0001767 3300048919 Bacteria 23559
236 Ga0496117_0000812 3300048920 Bacteria 48380
237 Ga0496118_0000091 3300048921 Bacteria 173092
238 Ga0496119_0006553 3300048922 Bacteria 10739
239 Ga0496121_0001745 3300048924 Bacteria 35537
240 Ga0496122_0025819 3300048925 Bacteria 5086
241 Ga0496123_0003691 3300048926 Bacteria 16863
242 Ga0496124_0000298 3300048927 Bacteria 92116
243 Ga0496125_0008259 3300048928 Bacteria 10932
244 Ga0496126_0000449 3300048929 Bacteria 82077
245 Ga0501272_002736 3300049769 Bacteria 1758
246 nmdc:mga0n895_39004_c1 3300050512 Bacteria 4605
247 nmdc:mga0rr50_38534_c1 3300050513 Bacteria 3460
248 2842779353 2842775625 Bacteria 5587290
249 2894776925 2894772417 Bacteria 5305674
250 2899279477 2899275550 Bacteria 3958688
251 2928534044 2928531327 Bacteria 5101314
252 2929204185 2929199973 Bacteria 7260745
253 8055911287 8055909800 Bacteria 7278581
254 Ga0070665_100000021
255 JGI24740J21852_10000521
256 JGI24739J22299_10015089
257 JGI24735J21928_10006198
258 JGI24751J29686_10000273
259 JGI25406J46586_10000513
260 Ga0055536_1002105
261 Ga0055534_1003465
262 Ga0055530_10000005
263 Ga0055531_10001265
264 Ga0055531_10016984
265 Ga0070658_10127374
266 Ga0070683_100009905
267 Ga0070690_100000846
268 Ga0070670_100005356
269 Ga0070670_100032099
270 Ga0070670_100102803
271 Ga0070680_100007645
272 Ga0070682_100005400
273 Ga0068868_100006012
274 Ga0070660_100038792
275 Ga0070691_10001137
276 Ga0070661_100003359
277 Ga0070661_100033384
278 Ga0070675_100044982
279 Ga0070675_100090038
280 Ga0070675_100219313
281 Ga0070674_100046203
282 Ga0070674_100077626
283 Ga0070673_100018736
284 Ga0070659_100005853
285 Ga0070659_100045565
286 Ga0070667_100003803
287 Ga0070663_100091242
288 Ga0070662_100003658
289 Ga0070681_10086509
290 Ga0068867_100049677
291 Ga0068867_100063214
292 Ga0070684_100001337
293 Ga0070684_100003646
294 Ga0068853_100040867
295 Ga0070672_100023541
296 Ga0070686_100008534
297 Ga0070664_100003074
298 Ga0070664_100019890
299 Ga0070664_100248582
300 Ga0068857_100018738
301 Ga0068857_100039671
302 Ga0068854_100001320
303 Ga0068856_100000380
304 Ga0068856_100070515
305 Ga0068856_100255612
306 Ga0068852_100004417
307 Ga0068852_100012705
308 Ga0068859_100004889
309 Ga0068864_100005661
310 Ga0068864_100064039
311 Ga0068864_100194624
312 Ga0068866_10061166
313 Ga0068863_100007275
314 Ga0068858_100006726
315 Ga0068858_100128804
316 Ga0081539_10000801
317 Ga0070717_10016506
318 Ga0097621_100003571
319 Ga0097620_100004889
320 Ga0075435_100004518
321 Ga0105240_10000301
322 Ga0105240_10301156
323 Ga0105240_10318190
324 Ga0105245_10018555
325 Ga0105245_10099171
326 Ga0105248_10009842
327 Ga0105248_10033670
328 Ga0105237_10008182
329 Ga0105238_10002841
330 Ga0105239_10000589
331 Ga0157373_10007030
332 Ga0157371_10059927
333 Ga0157369_10006376
334 Ga0157369_10017977
335 Ga0157369_10125235
336 Ga0157372_10023580
337 Ga0157375_10011198
338 Ga0157376_10032160
339 Ga0163161_10164304
340 Ga0213873_10000006
341 Ga0213876_10000004
342 Ga0213875_10002796
343 Ga0213875_10007263
344 Ga0213875_10013961
345 Ga0209675_1000564
346 Ga0209676_1000132
347 Ga0209025_1005557
348 Ga0209050_1000139
349 Ga0209257_1000164
350 Ga0209257_1000761
351 Ga0209257_1002228
352 Ga0207682_10004714
353 Ga0207647_10001861
354 Ga0207647_10029022
355 Ga0207645_10040081
356 Ga0207645_10060402
357 Ga0207705_10007724
358 Ga0207705_10074741
359 Ga0207695_10000399
360 Ga0207695_10228057
361 Ga0207660_10021454
362 Ga0207657_10003465
363 Ga0207657_10016619
364 Ga0207657_10049818
365 Ga0207657_10095856
366 Ga0207649_10022117
367 Ga0207649_10080612
368 Ga0207650_10155290
369 Ga0207659_10040157
370 Ga0207644_10000287
371 Ga0207690_10001588
372 Ga0207690_10057380
373 Ga0207706_10001384
374 Ga0207706_10084904
375 Ga0207706_10168044
376 Ga0207669_10061657
377 Ga0207691_10001279
378 Ga0207711_10178360
379 Ga0207667_10004831
380 Ga0207640_10002380
381 Ga0207677_10251121
382 Ga0207703_10086522
383 Ga0207639_10002488
384 Ga0207678_10096280
385 Ga0207702_10000544
386 Ga0207702_10002636
387 Ga0207648_10002272
388 Ga0207676_10075732
389 Ga0207674_10004717
390 Ga0207674_10005724
391 Ga0207674_10050122
392 Ga0207683_10001183
393 Ga0207698_10004615
394 Ga0207698_10062053
395 Ga0207698_10079165
396 Ga0268266_10000015
397 Ga0307517_10012059
398 Ga0307408_100116703
399 Ga0307408_100190993
400 Ga0307410_10000420
401 Ga0307410_10003894
402 Ga0307410_10005068
403 Ga0307410_10076278
404 Ga0307407_10028802
405 Ga0307412_10018385
406 Ga0307409_100001686
407 Ga0307409_100008144
408 Ga0307416_100009160
409 Ga0307416_100126173
410 Ga0307416_100138330
411 Ga0307411_10006055
412 Ga0307411_10028127
413 Ga0307411_10066095
414 Ga0307415_100010337
415 Ga0307415_100149960
416 Ga0395899_0001170
417 Ga0395899_0022474
418 Ga0395899_0029295
419 Ga0395899_0039705
420 Ga0395900_0004296
421 Ga0395900_0032256
422 Ga0395900_0049429
423 Ga0395900_0056368
424 Ga0395900_0152475
425 Ga0395900_0295952
426 Ga0395898_0004965
427 Ga0395898_0146831
428 Ga0395898_0210187
429 Ga0395898_0277042
430 Ga0395905_0001342
431 Ga0395905_0001923
432 Ga0395905_0003701
433 Ga0395905_0033186
434 Ga0395905_0047648
435 Ga0395905_0056434
436 Ga0395905_0070970
437 Ga0395905_0093094
438 Ga0395905_0310040
439 Ga0436364_0295693
440 Ga0436364_0331085
441 Ga0436364_0336038
442 Ga0436364_0940615
443 Ga0436364_1288217
444 Ga0395901_0003536
445 Ga0395901_0004525
446 Ga0395901_0014857
447 Ga0395901_0050461
448 Ga0395901_0182400
449 Ga0395901_0235519
450 Ga0395901_0259095
451 Ga0395901_0430907
452 Ga0436365_0084772
453 Ga0436365_0891680
454 Ga0436365_0970858
455 Ga0436360_0666790
456 Ga0436362_0554113
457 Ga0453684_0000151
458 Ga0451576_0001460
459 Ga0495606_0042823
460 Ga0495631_0020394
461 Ga0495643_0000570
462 Ga0495648_0000743
463 Ga0495663_0000372
464 Ga0495633_0001210
465 Ga0495668_0000109
466 Ga0495668_0033021
467 Ga0495625_0047428
468 Ga0495670_0016811
469 Ga0495681_0001677
470 Ga0496100_0001084
471 Ga0496100_0132936
472 Ga0496102_0000208
473 Ga0496103_0000308
474 Ga0496104_0034647
475 Ga0496105_0000781
476 Ga0496107_0027534
477 Ga0496107_0058820
478 Ga0496108_0001513
479 Ga0496109_0002942
480 Ga0496110_0000252
481 Ga0496110_0046120
482 Ga0496111_0000419
483 Ga0496112_0003309
484 Ga0496112_0037401
485 Ga0496113_0004400
486 Ga0496114_0017535
487 Ga0496115_0000094
488 Ga0496116_0001767
489 Ga0496117_0000812
490 Ga0496118_0000091
491 Ga0496119_0006553
492 Ga0496121_0001745
493 Ga0496122_0025819
494 Ga0496123_0003691
495 Ga0496124_0000298
496 Ga0496125_0008259
497 Ga0496126_0000449
498 Ga0501272_002736
499 nmdc:mga0n895_39004_c1
500 nmdc:mga0rr50_38534_c1
501 2842779353
502 2894776925
503 2899279477
504 2928534044
505 2929204185
506 8055911287

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05161

MOFRL

MOFRL family

357

463

0.97

PF13660

DUF4147

Domain of unknown function (DUF4147)

57

282

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2b8n-assembly2.cif.gz_B crystal structure of glycerate kinase (ec 2.7.1.31) (tm1585) from thermotoga maritima at 2.70 a resolution 0.8698 3 410
2b8n-assembly2.cif.gz_B crystal structure of glycerate kinase (ec 2.7.1.31) (tm1585) from thermotoga maritima at 2.70 a resolution 0.8504 3 410
1x3l-assembly1.cif.gz_A crystal structure of the ph0495 protein from pyrococccus horikoshii ot3 0.7689 3 412
1x3l-assembly1.cif.gz_A crystal structure of the ph0495 protein from pyrococccus horikoshii ot3 0.7562 3 412
7lrn-assembly2.cif.gz_B structure of the siderophore interacting protein from acinetbacter baumannii 0.5873 22 116
ID Description Score Start End Superfamily
2b8nB01 Alpha Beta;3-Layer(aba) Sandwich;glycerate kinase, domain 1;MOFRL domain 0.9438 249 410 3.40.1480.10
1x3lA01 Alpha Beta;3-Layer(aba) Sandwich;glycerate kinase, domain 1;MOFRL domain 0.9356 249 412 3.40.1480.10
af_Q9VQC4_23_277_3.40.50.10180 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycerate kinase, MOFRL-like N-terminal domain 0.9077 30 225 3.40.50.10180
2b8nB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycerate kinase, MOFRL-like N-terminal domain 0.8853 6 245 3.40.50.10180
af_Q9VQC4_287_486_3.40.1480.10 Alpha Beta;3-Layer(aba) Sandwich;glycerate kinase, domain 1;MOFRL domain 0.8758 253 410 3.40.1480.10
ID Description Score Start End GO Terms
AF-A0A2R7NVM9-F1-model_v4 Glycerate kinase 0.9942 325 410 GO:0005737
GO:0008887
AF-D9PKB4-F1-model_v4 Hydroxypyruvate reductase 0.9903 308 410 GO:0005737
GO:0008887
AF-A0A0A0D497-F1-model_v4 Hydroxypyruvate reductase 0.9868 299 410 GO:0005737
GO:0008887
AF-A0A125QIE6-F1-model_v4 Putative hydroxypyruvate reductase (EC 1.1.1.81) 0.978 327 416 GO:0005737
GO:0008887
GO:0016618
AF-A0A3S2IQ06-F1-model_v4 deleted 0.9728 299 410

Map