F364421

General Info

Members Datasets Scaffolds Average Seq Length
253 157 244 284

Family's Representative Sequence

Representative Sequence 3300049742|Ga0501080_0358753|Ga0501080_0358753_253_1170
Length 305
Sequence VRFTPVAVGVKRCRGTVTRVCEDRTVRVLSIQSHVAYGHVGNSAAVFPLQRLGHEVWPVLTVNFSNHTGYGAWRGPLIDPADVADVVTGIEERGALATCDAVLSGYQGSPAIADVVVDAVRRVKAANPAATYTCDPVMGNAMSGCFVNPEIPPIIRERVVPVADVITPNQFELGFLTGTTPTTLDEVLASADLARAMGPSTILVTSVETGEDTIGLMAVDGDGAWLVQTPRLPMKANGSGDITAALFTAHLHDTKSPATALARTVSSVFAVLKTTFESGERELRLIEAQDAIASPACEFEVRRVR

Samples

Sample ID Description Type Environment
1 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
2 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
3 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
4 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
5 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
6 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
7 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
8 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
9 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
13 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
14 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
15 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
16 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
17 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
18 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
29 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
32 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
33 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
34 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
35 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
39 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
45 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
51 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
52 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
54 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
57 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
71 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
72 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
73 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
74 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
75 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
76 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
77 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
78 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
79 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
80 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
81 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
82 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
83 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
84 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
85 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
86 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
87 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
88 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
89 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
90 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
91 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
92 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
93 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
94 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
95 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
96 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
97 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
98 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
99 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
100 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
101 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
102 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
103 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
104 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
105 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
106 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
107 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
108 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
109 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
110 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
111 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
112 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
113 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
114 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
115 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
116 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
117 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
118 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
119 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
120 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
121 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
122 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
138 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
139 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
140 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
141 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
142 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
145 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
146 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
147 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
148 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
149 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
150 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
151 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
152 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
153 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
154 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
155 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
156 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
157 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.26
Metatranscriptomes 1.19
Isolates 3.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.58
Nodule 0
Rhizoplane 9.49
Rhizosphere 48.22
Stem 0
Stem Tuber 0
Unclassified 23.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10063993 3300001979 Bacteria 1005
2 JGI24739J22299_10051799 3300001989 Bacteria 1323
3 JGI25164J39214_1000369 3300002772 Bacteria 26740
4 JGI25165J46597_1000004 3300003214 Bacteria 667510
5 rootH2_10010853 3300003320 Bacteria 2876
6 Ga0006562J51391_1011017 3300003578 Bacteria 8656
7 Ga0006562J51391_1011018 3300003578 Bacteria 7180
8 Ga0006562J51391_1023897 3300003578 Bacteria 2440
9 Ga0055539_1000008 3300003752 Bacteria 537665
10 Ga0055533_1000001 3300003756 Bacteria 1863437
11 Ga0055525_1000510 3300003759 Bacteria 19192
12 Ga0055527_1000001 3300003760 Bacteria 850044
13 Ga0055529_1000018 3300003763 Bacteria 344344
14 Ga0055541_1001834 3300003841 Bacteria 4432
15 Ga0070682_100105819 3300005337 Bacteria 1866
16 Ga0070668_100184306 3300005347 Bacteria 1707
17 Ga0070673_100284893 3300005364 Bacteria 1450
18 Ga0070667_100043155 3300005367 Bacteria 3784
19 Ga0070713_100323312 3300005436 Bacteria 1425
20 Ga0070710_10000485 3300005437 Bacteria 18735
21 Ga0068853_100182824 3300005539 Bacteria 1902
22 Ga0070665_100480156 3300005548 Bacteria 1254
23 Ga0075365_10029307 3300006038 Bacteria 3517
24 Ga0075368_10010768 3300006042 Bacteria 3314
25 Ga0075363_100002664 3300006048 Bacteria 7372
26 Ga0075364_10003633 3300006051 Bacteria 8798
27 Ga0075364_10022728 3300006051 Bacteria 3964
28 Ga0075364_10031907 3300006051 Bacteria 3384
29 Ga0075362_10019497 3300006177 Bacteria 2822
30 Ga0075367_10002639 3300006178 Bacteria 8248
31 Ga0075369_10012620 3300006186 Bacteria 3338
32 Ga0075370_10010986 3300006353 Bacteria 4748
33 Ga0105244_10016901 3300009036 Bacteria 4142
34 Ga0105244_10019240 3300009036 Bacteria 3819
35 Ga0105244_10130459 3300009036 Bacteria 1213
36 Ga0111539_10386565 3300009094 Bacteria 1629
37 Ga0105243_10043038 3300009148 Bacteria 3539
38 Ga0105243_10053415 3300009148 Bacteria 3205
39 Ga0105246_10014258 3300011119 Bacteria 4996
40 Ga0157371_10060438 3300013102 Bacteria 2687
41 Ga0157370_10511964 3300013104 Bacteria 1102
42 Ga0157369_10124731 3300013105 Bacteria 2731
43 Ga0157369_10616353 3300013105 Bacteria 1120
44 Ga0171462_1003 3300013250 Bacteria 853796
45 Ga0157372_10026195 3300013307 Bacteria 6344
46 Ga0213876_10029568 3300021384 Bacteria 2887
47 Ga0209566_100050 3300025225 Bacteria 234653
48 Ga0209674_100001 3300025226 Bacteria 4013750
49 Ga0209672_100006 3300025228 Bacteria 1004497
50 Ga0209147_100819 3300025229 Bacteria 14772
51 Ga0209563_100001 3300025230 Bacteria 4013775
52 Ga0209563_100909 3300025230 Bacteria 8741
53 Ga0207427_100010 3300025231 Bacteria 648610
54 Ga0209437_100485 3300025233 Bacteria 29431
55 Ga0209258_105496 3300025242 Bacteria 2131
56 Ga0209646_1000099 3300025246 Bacteria 180436
57 Ga0209677_100001 3300025253 Bacteria 4013787
58 Ga0209148_1000015 3300025254 Bacteria 850103
59 Ga0209233_1000001 3300025261 Bacteria 2992747
60 Ga0209455_1000013 3300025272 Bacteria 850103
61 Ga0209455_1002449 3300025272 Bacteria 7188
62 Ga0209051_1036124 3300025303 Bacteria 1829
63 Ga0207655_1003451 3300025728 Bacteria 11754
64 Ga0207655_1018668 3300025728 Bacteria 3664
65 Ga0207692_10005578 3300025898 Bacteria 5050
66 Ga0207692_10042534 3300025898 Bacteria 2256
67 Ga0207688_10099197 3300025901 Bacteria 1680
68 Ga0207647_10011799 3300025904 Bacteria 6107
69 Ga0207647_10017346 3300025904 Bacteria 4894
70 Ga0207700_10226978 3300025928 Bacteria 1586
71 Ga0207664_10131907 3300025929 Bacteria 2104
72 Ga0207689_10171854 3300025942 Bacteria 1787
73 Ga0207712_10102856 3300025961 Bacteria 2127
74 Ga0207668_10175300 3300025972 Bacteria 1686
75 Ga0207658_10032447 3300025986 Bacteria 3717
76 Ga0268266_10444537 3300028379 Bacteria 1232
77 Ga0307516_10001196 3300031730 Bacteria 36254
78 Ga0307405_10229444 3300031731 Bacteria 1368
79 Ga0307410_10098354 3300031852 Bacteria 2093
80 Ga0307406_10001290 3300031901 Bacteria 14052
81 Ga0307406_10004767 3300031901 Bacteria 7386
82 Ga0307414_10347818 3300032004 Bacteria 1271
83 Ga0307415_100142280 3300032126 Bacteria 1834
84 Ga0395899_0056532 3300037312 Bacteria 2900
85 Ga0395900_0004762 3300037418 Bacteria 14300
86 Ga0395898_0001540 3300037466 Bacteria 31698
87 Ga0395898_0086951 3300037466 Bacteria 3012
88 Ga0436365_0119798 3300039437 Bacteria 6924
89 Ga0436361_0784840 3300039447 Bacteria 2839
90 Ga0451789_1032327 3300041443 Bacteria 944
91 Ga0451793_1645126 3300041452 Bacteria 1659
92 Ga0451806_363965 3300041462 Bacteria 3152
93 Ga0451841_1128478 3300041498 Bacteria 1056
94 Ga0439462_0015875 3300042015 Bacteria 1944
95 Ga0466972_0004706 3300044658 Bacteria 6834
96 Ga0466965_0093504 3300044683 Bacteria 1531
97 Ga0466965_0113989 3300044683 Bacteria 1391
98 Ga0466961_0240429 3300044693 Bacteria 1113
99 Ga0466968_0013124 3300044735 Bacteria 3253
100 Ga0466968_0029433 3300044735 Bacteria 2271
101 Ga0466968_0042654 3300044735 Bacteria 1919
102 Ga0466968_0089342 3300044735 Bacteria 1363
103 Ga0466970_0000454 3300044765 Bacteria 20164
104 Ga0466970_0005976 3300044765 Bacteria 6065
105 Ga0466970_0030520 3300044765 Bacteria 2843
106 Ga0466970_0142523 3300044765 Bacteria 1320
107 Ga0466957_0097802 3300044842 Bacteria 1846
108 Ga0466957_0222441 3300044842 Bacteria 1247
109 Ga0466960_0003842 3300044901 Bacteria 5823
110 Ga0466960_0018625 3300044901 Bacteria 3046
111 Ga0466960_0056295 3300044901 Bacteria 1914
112 Ga0466960_0092825 3300044901 Bacteria 1541
113 Ga0466960_0105547 3300044901 Bacteria 1456
114 Ga0466958_0118042 3300045836 Bacteria 1659
115 Ga0495627_000473 3300046453 Bacteria 34381
116 Ga0495585_0059844 3300046492 Bacteria 2098
117 Ga0495645_0055563 3300046543 Bacteria 2875
118 Ga0496100_0014858 3300048903 Bacteria 4531
119 Ga0496100_0377823 3300048903 Bacteria 1075
120 Ga0496101_0002593 3300048904 Bacteria 11108
121 Ga0496102_0156175 3300048905 Bacteria 2145
122 Ga0496102_0352652 3300048905 Bacteria 1385
123 Ga0496103_0050756 3300048906 Bacteria 2566
124 Ga0496104_0121817 3300048907 Bacteria 2504
125 Ga0496105_0075717 3300048908 Bacteria 2779
126 Ga0496105_0130107 3300048908 Bacteria 2075
127 Ga0496107_0004710 3300048910 Bacteria 9267
128 Ga0496107_0381747 3300048910 Bacteria 1048
129 Ga0496108_0000088 3300048911 Bacteria 97568
130 Ga0496108_0240042 3300048911 Bacteria 1576
131 Ga0496109_0030410 3300048912 Bacteria 4840
132 Ga0496111_0003836 3300048914 Bacteria 9388
133 Ga0496112_0043686 3300048915 Bacteria 4388
134 Ga0496113_0003897 3300048916 Bacteria 9042
135 Ga0496113_0130578 3300048916 Bacteria 1971
136 Ga0496114_0006901 3300048917 Bacteria 8945
137 Ga0496114_0066271 3300048917 Bacteria 3027
138 Ga0496115_0014157 3300048918 Bacteria 6035
139 Ga0496116_0011690 3300048919 Bacteria 7234
140 Ga0496117_0001146 3300048920 Bacteria 39905
141 Ga0496117_0004701 3300048920 Bacteria 14836
142 Ga0496117_0012065 3300048920 Bacteria 7671
143 Ga0496117_0016448 3300048920 Bacteria 6244
144 Ga0496117_0112528 3300048920 Bacteria 1692
145 Ga0496118_0006139 3300048921 Bacteria 13336
146 Ga0496118_0007657 3300048921 Bacteria 11371
147 Ga0496118_0011377 3300048921 Bacteria 8695
148 Ga0496118_0021380 3300048921 Bacteria 5697
149 Ga0496119_0002374 3300048922 Bacteria 20694
150 Ga0496119_0002990 3300048922 Bacteria 17940
151 Ga0496119_0013457 3300048922 Bacteria 6517
152 Ga0496119_0021810 3300048922 Bacteria 4611
153 Ga0496119_0047972 3300048922 Bacteria 2652
154 Ga0496119_0078493 3300048922 Bacteria 1909
155 Ga0496119_0136544 3300048922 Bacteria 1329
156 Ga0496120_0000565 3300048923 Bacteria 56440
157 Ga0496120_0001021 3300048923 Bacteria 37451
158 Ga0496120_0002253 3300048923 Bacteria 20131
159 Ga0496120_0009198 3300048923 Bacteria 7041
160 Ga0496121_0000040 3300048924 Bacteria 348494
161 Ga0496122_0000054 3300048925 Bacteria 259135
162 Ga0496122_0000240 3300048925 Bacteria 123001
163 Ga0496122_0033312 3300048925 Bacteria 4241
164 Ga0496122_0117989 3300048925 Bacteria 1721
165 Ga0496122_0162202 3300048925 Bacteria 1361
166 Ga0496122_0174174 3300048925 Bacteria 1292
167 Ga0496123_0000039 3300048926 Bacteria 259107
168 Ga0496123_0000076 3300048926 Bacteria 194050
169 Ga0496123_0029555 3300048926 Bacteria 4030
170 Ga0496124_0002643 3300048927 Bacteria 23026
171 Ga0496124_0002883 3300048927 Bacteria 21715
172 Ga0496124_0005986 3300048927 Bacteria 13424
173 Ga0496125_0000061 3300048928 Bacteria 262739
174 Ga0496125_0000640 3300048928 Bacteria 58381
175 Ga0496125_0025355 3300048928 Bacteria 5431
176 Ga0496125_0028319 3300048928 Bacteria 5064
177 Ga0496125_0056181 3300048928 Bacteria 3199
178 Ga0496125_0170170 3300048928 Bacteria 1466
179 Ga0496126_0005801 3300048929 Bacteria 13962
180 Ga0496126_0009671 3300048929 Bacteria 10217
181 Ga0496126_0027674 3300048929 Bacteria 5411
182 Ga0496126_0043207 3300048929 Bacteria 4158
183 Ga0496126_0043527 3300048929 Bacteria 4141
184 Ga0496126_0079270 3300048929 Bacteria 2908
185 Ga0496126_0139514 3300048929 Bacteria 2088
186 Ga0501031_0034220 3300049568 Bacteria 3316
187 Ga0501032_0078530 3300049569 Bacteria 2197
188 Ga0501032_0360073 3300049569 Bacteria 936
189 Ga0501033_0037698 3300049570 Bacteria 3617
190 Ga0501034_0003532 3300049571 Bacteria 17757
191 Ga0501034_0011108 3300049571 Bacteria 9350
192 Ga0501034_0047014 3300049571 Bacteria 4359
193 Ga0501034_0137752 3300049571 Bacteria 2421
194 Ga0501034_0228729 3300049571 Bacteria 1809
195 Ga0501036_0236153 3300049572 Bacteria 1533
196 Ga0501037_0026046 3300049573 Bacteria 4322
197 Ga0501037_0253128 3300049573 Bacteria 1232
198 Ga0501038_0038143 3300049574 Bacteria 4209
199 Ga0501038_0043317 3300049574 Bacteria 3914
200 Ga0501038_0053258 3300049574 Bacteria 3484
201 Ga0501038_0083856 3300049574 Bacteria 2682
202 Ga0501038_0165018 3300049574 Bacteria 1797
203 Ga0501038_0211044 3300049574 Bacteria 1553
204 Ga0501039_0062917 3300049575 Bacteria 2875
205 Ga0501040_0049535 3300049576 Bacteria 2872
206 Ga0501041_0057911 3300049577 Bacteria 2370
207 Ga0501042_0000959 3300049578 Bacteria 16259
208 Ga0501042_0421236 3300049578 Bacteria 967
209 Ga0501043_0025240 3300049579 Bacteria 4662
210 Ga0501043_0112399 3300049579 Bacteria 2139
211 Ga0501043_0302002 3300049579 Bacteria 1223
212 Ga0501046_0062312 3300049580 Bacteria 2914
213 Ga0501046_0209887 3300049580 Bacteria 1446
214 Ga0501046_0229886 3300049580 Bacteria 1371
215 Ga0501047_0049910 3300049581 Bacteria 4040
216 Ga0501047_0105484 3300049581 Bacteria 2698
217 Ga0501047_0373073 3300049581 Bacteria 1262
218 Ga0501048_0007747 3300049582 Bacteria 8140
219 Ga0501070_0000593 3300049586 Bacteria 33023
220 Ga0501070_0031310 3300049586 Bacteria 4457
221 Ga0501075_0133504 3300049591 Bacteria 1891
222 Ga0501079_0057654 3300049741 Bacteria 2997
223 Ga0501080_0358753 3300049742 Bacteria 1315
224 Ga0501083_0000003 3300049744 Bacteria 235949
225 Ga0501035_0066694 3300049822 Bacteria 3194
226 Ga0501044_0022406 3300049823 Bacteria 6731
227 Ga0501044_0470849 3300049823 Bacteria 1160
228 Ga0501045_0142992 3300049824 Bacteria 1779
229 nmdc:mga03683_30170_c1 3300050489 Bacteria 2168
230 nmdc:mga00v17_18602_c1 3300050491 Bacteria 3950
231 nmdc:mga00v17_220122_c1 3300050491 Bacteria 904
232 nmdc:mga00v17_4121_c1 3300050491 Bacteria 7523
233 nmdc:mga0yw44_28841_c1 3300050492 Bacteria 3197
234 nmdc:mga06z11_7295_c1 3300050494 Bacteria 4540
235 nmdc:mga04h51_7770_c1 3300050495 Bacteria 2844
236 nmdc:mga0sz30_179382_c1 3300050516 Bacteria 939
237 nmdc:mga0sz30_9815_c1 3300050516 Bacteria 3650
238 Ga0500568_0000158 3300053139 Bacteria 58729
239 Ga0500568_0005474 3300053139 Bacteria 6553
240 Ga0500573_0000013 3300053140 Bacteria 196637
241 Ga0500573_0054559 3300053140 Bacteria 2294
242 Ga0500616_0169301 3300053153 Bacteria 994
243 Ga0501084_0060628 3300054114 Bacteria 3167
244 Ga0530510_0044934 3300061734 Bacteria 3192

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005436 Ga0070713_100323312 Ga0070713_1003233121 274
2 3300025928 Ga0207700_10226978 Ga0207700_102269782 274
3 iso_pu_bacteria 2728369276 2729908986 279
4 iso_pu_bacteria 2919443155 2919446298 279
5 iso_pu_bacteria 2919523602 2919524687 279
6 iso_pu_bacteria 2946033335 2946033780 279
7 3300049572 Ga0501036_0236153 Ga0501036_0236153_17_907 280
8 3300049574 Ga0501038_0165018 Ga0501038_0165018_790_1632 280
9 3300049575 Ga0501039_0062917 Ga0501039_0062917_36_878 280
10 3300049576 Ga0501040_0049535 Ga0501040_0049535_80_922 280
11 3300049577 Ga0501041_0057911 Ga0501041_0057911_1500_2342 280
12 3300049578 Ga0501042_0421236 Ga0501042_0421236_84_926 280
13 3300049580 Ga0501046_0229886 Ga0501046_0229886_497_1339 280
14 3300049582 Ga0501048_0007747 Ga0501048_0007747_7253_8095 280
15 3300049591 Ga0501075_0133504 Ga0501075_0133504_246_1088 280
16 3300049741 Ga0501079_0057654 Ga0501079_0057654_2092_2982 280
17 3300049742 Ga0501080_0358753 Ga0501080_0358753_253_1170 280
18 3300049824 Ga0501045_0142992 Ga0501045_0142992_874_1716 280
19 3300054114 Ga0501084_0060628 Ga0501084_0060628_1576_2418 280
20 3300061734 Ga0530510_0044934 Ga0530510_0044934_2262_3104 280
21 3300001979 JGI24740J21852_10063993 JGI24740J21852_100639931 283
22 3300001989 JGI24739J22299_10051799 JGI24739J22299_100517992 283
23 3300002772 JGI25164J39214_1000369 JGI25164J39214_100036928 283
24 3300003214 JGI25165J46597_1000004 JGI25165J46597_1000004541 283
25 3300003320 rootH2_10010853 rootH2_100108532 283
26 3300003578 Ga0006562J51391_1011017 Ga0006562J51391_10110171 283
27 3300003578 Ga0006562J51391_1011018 Ga0006562J51391_10110188 283
28 3300003578 Ga0006562J51391_1023897 Ga0006562J51391_10238972 283
29 3300003752 Ga0055539_1000008 Ga0055539_1000008108 283
30 3300003756 Ga0055533_1000001 Ga0055533_1000001963 283
31 3300003759 Ga0055525_1000510 Ga0055525_100051017 283
32 3300003760 Ga0055527_1000001 Ga0055527_1000001432 283
33 3300003763 Ga0055529_1000018 Ga0055529_100001864 283
34 3300003841 Ga0055541_1001834 Ga0055541_10018344 283
35 3300005337 Ga0070682_100105819 Ga0070682_1001058192 283
36 3300005347 Ga0070668_100184306 Ga0070668_1001843062 283
37 3300005364 Ga0070673_100284893 Ga0070673_1002848931 283
38 3300005367 Ga0070667_100043155 Ga0070667_1000431552 283
39 3300005437 Ga0070710_10000485 Ga0070710_100004853 283
40 3300005539 Ga0068853_100182824 Ga0068853_1001828242 283
41 3300005548 Ga0070665_100480156 Ga0070665_1004801562 283
42 3300006038 Ga0075365_10029307 Ga0075365_100293072 283
43 3300006042 Ga0075368_10010768 Ga0075368_100107682 283
44 3300006048 Ga0075363_100002664 Ga0075363_1000026648 283
45 3300006051 Ga0075364_10003633 Ga0075364_100036332 283
46 3300006051 Ga0075364_10022728 Ga0075364_100227283 283
47 3300006051 Ga0075364_10031907 Ga0075364_100319072 283
48 3300006177 Ga0075362_10019497 Ga0075362_100194973 283
49 3300006178 Ga0075367_10002639 Ga0075367_100026394 283
50 3300006186 Ga0075369_10012620 Ga0075369_100126202 283
51 3300006353 Ga0075370_10010986 Ga0075370_100109863 283
52 3300009036 Ga0105244_10016901 Ga0105244_100169014 283
53 3300009036 Ga0105244_10019240 Ga0105244_100192403 283
54 3300009036 Ga0105244_10130459 Ga0105244_101304591 283
55 3300009094 Ga0111539_10386565 Ga0111539_103865652 283
56 3300009148 Ga0105243_10043038 Ga0105243_100430383 283
57 3300009148 Ga0105243_10053415 Ga0105243_100534153 283
58 3300011119 Ga0105246_10014258 Ga0105246_100142582 283
59 3300013102 Ga0157371_10060438 Ga0157371_100604381 283
60 3300013104 Ga0157370_10511964 Ga0157370_105119641 283
61 3300013105 Ga0157369_10124731 Ga0157369_101247313 283
62 3300013105 Ga0157369_10616353 Ga0157369_106163532 283
63 3300013250 Ga0171462_1003 Ga0171462_1003454 283
64 3300013307 Ga0157372_10026195 Ga0157372_100261958 283
65 3300021384 Ga0213876_10029568 Ga0213876_100295682 283
66 3300025225 Ga0209566_100050 Ga0209566_10005025 283
67 3300025226 Ga0209674_100001 Ga0209674_100001963 283
68 3300025228 Ga0209672_100006 Ga0209672_100006544 283
69 3300025229 Ga0209147_100819 Ga0209147_1008194 283
70 3300025230 Ga0209563_100001 Ga0209563_100001963 283
71 3300025230 Ga0209563_100909 Ga0209563_1009093 283
72 3300025231 Ga0207427_100010 Ga0207427_10001041 283
73 3300025233 Ga0209437_100485 Ga0209437_10048513 283
74 3300025242 Ga0209258_105496 Ga0209258_1054962 283
75 3300025246 Ga0209646_1000099 Ga0209646_10000999 283
76 3300025253 Ga0209677_100001 Ga0209677_100001963 283
77 3300025254 Ga0209148_1000015 Ga0209148_1000015388 283
78 3300025261 Ga0209233_1000001 Ga0209233_10000011909 283
79 3300025272 Ga0209455_1000013 Ga0209455_1000013388 283
80 3300025272 Ga0209455_1002449 Ga0209455_10024494 283
81 3300025303 Ga0209051_1036124 Ga0209051_10361242 283
82 3300025728 Ga0207655_1003451 Ga0207655_10034513 283
83 3300025728 Ga0207655_1018668 Ga0207655_10186683 283
84 3300025898 Ga0207692_10005578 Ga0207692_100055784 283
85 3300025898 Ga0207692_10042534 Ga0207692_100425341 283
86 3300025901 Ga0207688_10099197 Ga0207688_100991972 283
87 3300025904 Ga0207647_10011799 Ga0207647_100117996 283
88 3300025904 Ga0207647_10017346 Ga0207647_100173465 283
89 3300025929 Ga0207664_10131907 Ga0207664_101319072 283
90 3300025942 Ga0207689_10171854 Ga0207689_101718542 283
91 3300025961 Ga0207712_10102856 Ga0207712_101028562 283
92 3300025972 Ga0207668_10175300 Ga0207668_101753002 283
93 3300025986 Ga0207658_10032447 Ga0207658_100324472 283
94 3300028379 Ga0268266_10444537 Ga0268266_104445372 283
95 3300031730 Ga0307516_10001196 Ga0307516_1000119613 283
96 3300031731 Ga0307405_10229444 Ga0307405_102294442 283
97 3300031852 Ga0307410_10098354 Ga0307410_100983542 283
98 3300031901 Ga0307406_10001290 Ga0307406_1000129015 283
99 3300031901 Ga0307406_10004767 Ga0307406_100047677 283
100 3300032004 Ga0307414_10347818 Ga0307414_103478182 283
101 3300032126 Ga0307415_100142280 Ga0307415_1001422802 283
102 3300037312 Ga0395899_0056532 Ga0395899_0056532_1263_2114 283
103 3300037418 Ga0395900_0004762 Ga0395900_0004762_1752_2603 283
104 3300037466 Ga0395898_0001540 Ga0395898_0001540_27163_28014 283
105 3300037466 Ga0395898_0086951 Ga0395898_0086951_914_1768 283
106 3300039437 Ga0436365_0119798 Ga0436365_0119798_462_1334 283
107 3300039447 Ga0436361_0784840 Ga0436361_0784840_773_1624 283
108 3300041443 Ga0451789_1032327 Ga0451789_1032327_49_900 283
109 3300041452 Ga0451793_1645126 Ga0451793_1645126_50_901 283
110 3300041462 Ga0451806_363965 Ga0451806_363965_646_1497 283
111 3300041498 Ga0451841_1128478 Ga0451841_1128478_126_977 283
112 3300042015 Ga0439462_0015875 Ga0439462_0015875_842_1729 283
113 3300044658 Ga0466972_0004706 Ga0466972_0004706_2659_3510 283
114 3300044683 Ga0466965_0093504 Ga0466965_0093504_486_1337 283
115 3300044683 Ga0466965_0113989 Ga0466965_0113989_288_1139 283
116 3300044693 Ga0466961_0240429 Ga0466961_0240429_43_894 283
117 3300044735 Ga0466968_0013124 Ga0466968_0013124_2279_3142 283
118 3300044735 Ga0466968_0029433 Ga0466968_0029433_185_1036 283
119 3300044735 Ga0466968_0042654 Ga0466968_0042654_987_1838 283
120 3300044735 Ga0466968_0089342 Ga0466968_0089342_184_1035 283
121 3300044765 Ga0466970_0000454 Ga0466970_0000454_3412_4266 283
122 3300044765 Ga0466970_0005976 Ga0466970_0005976_2422_3273 283
123 3300044765 Ga0466970_0030520 Ga0466970_0030520_878_1741 283
124 3300044765 Ga0466970_0142523 Ga0466970_0142523_117_968 283
125 3300044842 Ga0466957_0097802 Ga0466957_0097802_609_1460 283
126 3300044842 Ga0466957_0222441 Ga0466957_0222441_351_1205 283
127 3300044901 Ga0466960_0003842 Ga0466960_0003842_829_1680 283
128 3300044901 Ga0466960_0018625 Ga0466960_0018625_341_1192 283
129 3300044901 Ga0466960_0056295 Ga0466960_0056295_354_1205 283
130 3300044901 Ga0466960_0092825 Ga0466960_0092825_41_892 283
131 3300044901 Ga0466960_0105547 Ga0466960_0105547_105_956 283
132 3300045836 Ga0466958_0118042 Ga0466958_0118042_269_1120 283
133 3300046453 Ga0495627_000473 Ga0495627_000473_20935_21786 283
134 3300046492 Ga0495585_0059844 Ga0495585_0059844_240_1115 283
135 3300046543 Ga0495645_0055563 Ga0495645_0055563_1972_2823 283
136 3300048903 Ga0496100_0014858 Ga0496100_0014858_3622_4473 283
137 3300048903 Ga0496100_0377823 Ga0496100_0377823_41_892 283
138 3300048904 Ga0496101_0002593 Ga0496101_0002593_6898_7749 283
139 3300048905 Ga0496102_0156175 Ga0496102_0156175_90_941 283
140 3300048905 Ga0496102_0352652 Ga0496102_0352652_406_1257 283
141 3300048906 Ga0496103_0050756 Ga0496103_0050756_206_1057 283
142 3300048907 Ga0496104_0121817 Ga0496104_0121817_511_1362 283
143 3300048908 Ga0496105_0075717 Ga0496105_0075717_1395_2246 283
144 3300048908 Ga0496105_0130107 Ga0496105_0130107_119_970 283
145 3300048910 Ga0496107_0004710 Ga0496107_0004710_3245_4096 283
146 3300048910 Ga0496107_0381747 Ga0496107_0381747_68_919 283
147 3300048911 Ga0496108_0000088 Ga0496108_0000088_57481_58332 283
148 3300048911 Ga0496108_0240042 Ga0496108_0240042_403_1254 283
149 3300048912 Ga0496109_0030410 Ga0496109_0030410_838_1689 283
150 3300048914 Ga0496111_0003836 Ga0496111_0003836_3431_4282 283
151 3300048915 Ga0496112_0043686 Ga0496112_0043686_2535_3386 283
152 3300048916 Ga0496113_0003897 Ga0496113_0003897_971_1822 283
153 3300048916 Ga0496113_0130578 Ga0496113_0130578_113_964 283
154 3300048917 Ga0496114_0006901 Ga0496114_0006901_4736_5587 283
155 3300048917 Ga0496114_0066271 Ga0496114_0066271_1164_2015 283
156 3300048918 Ga0496115_0014157 Ga0496115_0014157_4844_5695 283
157 3300048919 Ga0496116_0011690 Ga0496116_0011690_4059_4910 283
158 3300048920 Ga0496117_0001146 Ga0496117_0001146_27294_28145 283
159 3300048920 Ga0496117_0004701 Ga0496117_0004701_10921_11772 283
160 3300048920 Ga0496117_0012065 Ga0496117_0012065_1630_2481 283
161 3300048920 Ga0496117_0016448 Ga0496117_0016448_3636_4487 283
162 3300048920 Ga0496117_0112528 Ga0496117_0112528_18_869 283
163 3300048921 Ga0496118_0006139 Ga0496118_0006139_5752_6603 283
164 3300048921 Ga0496118_0007657 Ga0496118_0007657_6692_7543 283
165 3300048921 Ga0496118_0011377 Ga0496118_0011377_7073_7924 283
166 3300048921 Ga0496118_0021380 Ga0496118_0021380_2659_3510 283
167 3300048922 Ga0496119_0002374 Ga0496119_0002374_16329_17180 283
168 3300048922 Ga0496119_0002990 Ga0496119_0002990_3925_4776 283
169 3300048922 Ga0496119_0013457 Ga0496119_0013457_2046_3107 283
170 3300048922 Ga0496119_0021810 Ga0496119_0021810_1366_2217 283
171 3300048922 Ga0496119_0047972 Ga0496119_0047972_1017_1868 283
172 3300048922 Ga0496119_0078493 Ga0496119_0078493_892_1743 283
173 3300048922 Ga0496119_0136544 Ga0496119_0136544_326_1177 283
174 3300048923 Ga0496120_0000565 Ga0496120_0000565_43285_44136 283
175 3300048923 Ga0496120_0001021 Ga0496120_0001021_2333_3184 283
176 3300048923 Ga0496120_0002253 Ga0496120_0002253_7252_8103 283
177 3300048923 Ga0496120_0009198 Ga0496120_0009198_763_1653 283
178 3300048924 Ga0496121_0000040 Ga0496121_0000040_261987_262910 283
179 3300048925 Ga0496122_0000054 Ga0496122_0000054_111376_112227 283
180 3300048925 Ga0496122_0000240 Ga0496122_0000240_89846_90697 283
181 3300048925 Ga0496122_0033312 Ga0496122_0033312_3281_4132 283
182 3300048925 Ga0496122_0117989 Ga0496122_0117989_396_1247 283
183 3300048925 Ga0496122_0162202 Ga0496122_0162202_352_1203 283
184 3300048925 Ga0496122_0174174 Ga0496122_0174174_388_1239 283
185 3300048926 Ga0496123_0000039 Ga0496123_0000039_111376_112227 283
186 3300048926 Ga0496123_0000076 Ga0496123_0000076_27296_28147 283
187 3300048926 Ga0496123_0029555 Ga0496123_0029555_699_1550 283
188 3300048927 Ga0496124_0002643 Ga0496124_0002643_14263_15114 283
189 3300048927 Ga0496124_0002883 Ga0496124_0002883_12602_13453 283
190 3300048927 Ga0496124_0005986 Ga0496124_0005986_5580_6431 283
191 3300048928 Ga0496125_0000061 Ga0496125_0000061_114565_115416 283
192 3300048928 Ga0496125_0000640 Ga0496125_0000640_53955_54806 283
193 3300048928 Ga0496125_0025355 Ga0496125_0025355_2009_2860 283
194 3300048928 Ga0496125_0028319 Ga0496125_0028319_881_1732 283
195 3300048928 Ga0496125_0056181 Ga0496125_0056181_1209_2060 283
196 3300048928 Ga0496125_0170170 Ga0496125_0170170_524_1375 283
197 3300048929 Ga0496126_0005801 Ga0496126_0005801_2593_3444 283
198 3300048929 Ga0496126_0009671 Ga0496126_0009671_6980_7831 283
199 3300048929 Ga0496126_0027674 Ga0496126_0027674_4042_4893 283
200 3300048929 Ga0496126_0043207 Ga0496126_0043207_2209_3060 283
201 3300048929 Ga0496126_0043527 Ga0496126_0043527_1353_2204 283
202 3300048929 Ga0496126_0079270 Ga0496126_0079270_664_1515 283
203 3300048929 Ga0496126_0139514 Ga0496126_0139514_389_1240 283
204 3300049568 Ga0501031_0034220 Ga0501031_0034220_2011_2862 283
205 3300049569 Ga0501032_0078530 Ga0501032_0078530_887_1750 283
206 3300049569 Ga0501032_0360073 Ga0501032_0360073_64_915 283
207 3300049570 Ga0501033_0037698 Ga0501033_0037698_2608_3459 283
208 3300049571 Ga0501034_0003532 Ga0501034_0003532_12802_13653 283
209 3300049571 Ga0501034_0011108 Ga0501034_0011108_110_961 283
210 3300049571 Ga0501034_0047014 Ga0501034_0047014_3023_3874 283
211 3300049571 Ga0501034_0137752 Ga0501034_0137752_1009_1860 283
212 3300049571 Ga0501034_0228729 Ga0501034_0228729_257_1120 283
213 3300049573 Ga0501037_0026046 Ga0501037_0026046_2626_3489 283
214 3300049573 Ga0501037_0253128 Ga0501037_0253128_360_1211 283
215 3300049574 Ga0501038_0038143 Ga0501038_0038143_2045_2896 283
216 3300049574 Ga0501038_0043317 Ga0501038_0043317_660_1511 283
217 3300049574 Ga0501038_0053258 Ga0501038_0053258_2256_3107 283
218 3300049574 Ga0501038_0083856 Ga0501038_0083856_1507_2370 283
219 3300049574 Ga0501038_0211044 Ga0501038_0211044_575_1426 283
220 3300049578 Ga0501042_0000959 Ga0501042_0000959_9522_10373 283
221 3300049579 Ga0501043_0025240 Ga0501043_0025240_460_1323 283
222 3300049579 Ga0501043_0112399 Ga0501043_0112399_344_1207 283
223 3300049579 Ga0501043_0302002 Ga0501043_0302002_260_1111 283
224 3300049580 Ga0501046_0062312 Ga0501046_0062312_1719_2570 283
225 3300049580 Ga0501046_0209887 Ga0501046_0209887_580_1431 283
226 3300049581 Ga0501047_0049910 Ga0501047_0049910_2781_3632 283
227 3300049581 Ga0501047_0105484 Ga0501047_0105484_1684_2568 283
228 3300049581 Ga0501047_0373073 Ga0501047_0373073_374_1237 283
229 3300049586 Ga0501070_0000593 Ga0501070_0000593_8992_9843 283
230 3300049586 Ga0501070_0031310 Ga0501070_0031310_2989_3840 283
231 3300049744 Ga0501083_0000003 Ga0501083_0000003_147221_148072 283
232 3300049822 Ga0501035_0066694 Ga0501035_0066694_1718_2569 283
233 3300049823 Ga0501044_0022406 Ga0501044_0022406_5396_6247 283
234 3300049823 Ga0501044_0470849 Ga0501044_0470849_108_959 283
235 3300050489 nmdc:mga03683_30170_c1 nmdc:mga03683_30170_c1_1206_2072 283
236 3300050491 nmdc:mga00v17_18602_c1 nmdc:mga00v17_18602_c1_1885_2736 283
237 3300050491 nmdc:mga00v17_220122_c1 nmdc:mga00v17_220122_c1_38_889 283
238 3300050491 nmdc:mga00v17_4121_c1 nmdc:mga00v17_4121_c1_2013_2864 283
239 3300050492 nmdc:mga0yw44_28841_c1 nmdc:mga0yw44_28841_c1_880_1743 283
240 3300050494 nmdc:mga06z11_7295_c1 nmdc:mga06z11_7295_c1_1817_2668 283
241 3300050495 nmdc:mga04h51_7770_c1 nmdc:mga04h51_7770_c1_714_1565 283
242 3300050516 nmdc:mga0sz30_179382_c1 nmdc:mga0sz30_179382_c1_41_895 283
243 3300050516 nmdc:mga0sz30_9815_c1 nmdc:mga0sz30_9815_c1_429_1280 283
244 3300053139 Ga0500568_0000158 Ga0500568_0000158_56928_57791 283
245 3300053139 Ga0500568_0005474 Ga0500568_0005474_5300_6166 283
246 3300053140 Ga0500573_0000013 Ga0500573_0000013_179024_179875 283
247 3300053140 Ga0500573_0054559 Ga0500573_0054559_539_1390 283
248 3300053153 Ga0500616_0169301 Ga0500616_0169301_115_966 283
249 iso_pu_bacteria 2808606306 2808631249 283
250 iso_pu_bacteria 2811994872 2812323052 283
251 iso_pu_bacteria 8045830549 8045831523 283
252 iso_pu_bacteria 8046352972 8046353015 283
253 iso_pu_bacteria 8046352972 8046356523 283

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08543

Phos_pyr_kin

Phosphomethylpyrimidine kinase

80

285

0.87

PF00294

PfkB

pfkB family carbohydrate kinase

111

275

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
1td2-assembly1.cif.gz_B crystal structure of the pdxy protein from escherichia coli 0.9675 2 282
1vi9-assembly2.cif.gz_D crystal structure of pyridoxamine kinase 0.9666 2 283
5trw-assembly1.cif.gz_A-2 crystal structure of pyridoxamine kinase pdxy from burkholderia xenovorans 0.9631 2 281
1vi9-assembly2.cif.gz_D crystal structure of pyridoxamine kinase 0.96 2 283
5b6a-assembly1.cif.gz_A-2 structure of pyridoxal kinasefrom pseudomonas aeruginosa 0.959 2 282
ID Description Score Start End Superfamily
1vi9C00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9503 2 283 3.40.1190.20
af_Q55EK9_1_301_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.949 2 280 3.40.1190.20
af_Q7KUC2_7_303_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9469 2 282 3.40.1190.20
af_P40191_1_283_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.943 3 261 3.40.1190.20
1vi9C00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9404 2 283 3.40.1190.20
ID Description Score Start End GO Terms
AF-A0A7W7H7A5-F1-model_v4 pyridoxal kinase (EC 2.7.1.35) 0.9926 1 283 GO:0005829
GO:0008478
GO:0009443
AF-Q6AFC1-F1-model_v4 Pyridoxal kinase PdxY (PL kinase) (EC 2.7.1.35) 0.9924 1 283 GO:0000287
GO:0005524
GO:0005829
GO:0008478
GO:0009443
AF-A0A4R4X2D8-F1-model_v4 pyridoxal kinase (EC 2.7.1.35) 0.9921 1 283 GO:0005829
GO:0008478
GO:0009443
AF-A0A367Y9Q6-F1-model_v4 pyridoxal kinase (EC 2.7.1.35) 0.9921 1 283 GO:0005829
GO:0008478
GO:0009443
AF-A0A6I6DXB0-F1-model_v4 pyridoxal kinase (EC 2.7.1.35) 0.9918 1 283 GO:0005829
GO:0008478
GO:0009443

Feature Viewer

pLDDT pTM Quality
93.86 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map