F364421
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 253 | 157 | 244 | 284 |
Family's Representative Sequence
| Representative Sequence | 3300049742|Ga0501080_0358753|Ga0501080_0358753_253_1170 |
| Length | 305 |
| Sequence | VRFTPVAVGVKRCRGTVTRVCEDRTVRVLSIQSHVAYGHVGNSAAVFPLQRLGHEVWPVLTVNFSNHTGYGAWRGPLIDPADVADVVTGIEERGALATCDAVLSGYQGSPAIADVVVDAVRRVKAANPAATYTCDPVMGNAMSGCFVNPEIPPIIRERVVPVADVITPNQFELGFLTGTTPTTLDEVLASADLARAMGPSTILVTSVETGEDTIGLMAVDGDGAWLVQTPRLPMKANGSGDITAALFTAHLHDTKSPATALARTVSSVFAVLKTTFESGERELRLIEAQDAIASPACEFEVRRVR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2728369276 | Kineococcus rhizosphaerae DSM 19711 | Isolate | Rhizosphere |
| 2 | 2808606306 | Microbacterium sp. SLBN-146 | Isolate | Unclassified |
| 3 | 2811994872 | Microbacterium sp. MU4Y-5-1 | Isolate | Unclassified |
| 4 | 2919443155 | Agromyces sp. 3263 | Isolate | Rhizosphere |
| 5 | 2919523602 | Leifsonia shinshuensis 3821 | Isolate | Unclassified |
| 6 | 2946033335 | Microbacterium sp. W4I4 | Isolate | Rhizosphere |
| 7 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 8 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 9 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 10 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 11 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 12 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 13 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 15 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 17 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 26 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 28 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 29 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 30 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 31 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 32 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 33 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 34 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 35 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 43 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 45 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 46 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 47 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 48 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 49 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 50 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 51 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 52 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 53 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 54 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 55 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 56 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 57 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 71 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 72 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 73 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 74 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 75 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 76 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 77 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 78 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 79 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 80 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 81 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 82 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 83 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 84 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 85 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 86 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 87 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 88 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 89 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 90 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 91 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 92 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 93 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 94 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 98 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 99 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 100 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 101 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 102 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 103 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 104 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 105 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 106 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 107 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 108 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 109 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 110 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 111 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 112 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 113 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 114 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 115 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 116 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 117 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 118 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 119 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 120 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 121 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 122 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 123 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 124 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 125 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 126 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 127 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 128 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 129 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 130 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 131 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 132 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 133 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 134 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 135 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 136 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 137 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 138 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 139 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 140 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 141 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 142 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 143 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 144 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 145 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 146 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 147 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 148 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 149 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 150 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 151 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 152 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 153 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 154 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 155 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 156 | 8045830549 | Microbacterium yannicii DSM 23203 | Isolate | Unclassified |
| 157 | 8046352972 | Agromyces mangrovi NBRC 112812 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.26 |
| Metatranscriptomes | 1.19 |
| Isolates | 3.56 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 18.58 |
| Nodule | 0 |
| Rhizoplane | 9.49 |
| Rhizosphere | 48.22 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 23.72 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10063993 | 3300001979 | Bacteria | 1005 |
| 2 | JGI24739J22299_10051799 | 3300001989 | Bacteria | 1323 |
| 3 | JGI25164J39214_1000369 | 3300002772 | Bacteria | 26740 |
| 4 | JGI25165J46597_1000004 | 3300003214 | Bacteria | 667510 |
| 5 | rootH2_10010853 | 3300003320 | Bacteria | 2876 |
| 6 | Ga0006562J51391_1011017 | 3300003578 | Bacteria | 8656 |
| 7 | Ga0006562J51391_1011018 | 3300003578 | Bacteria | 7180 |
| 8 | Ga0006562J51391_1023897 | 3300003578 | Bacteria | 2440 |
| 9 | Ga0055539_1000008 | 3300003752 | Bacteria | 537665 |
| 10 | Ga0055533_1000001 | 3300003756 | Bacteria | 1863437 |
| 11 | Ga0055525_1000510 | 3300003759 | Bacteria | 19192 |
| 12 | Ga0055527_1000001 | 3300003760 | Bacteria | 850044 |
| 13 | Ga0055529_1000018 | 3300003763 | Bacteria | 344344 |
| 14 | Ga0055541_1001834 | 3300003841 | Bacteria | 4432 |
| 15 | Ga0070682_100105819 | 3300005337 | Bacteria | 1866 |
| 16 | Ga0070668_100184306 | 3300005347 | Bacteria | 1707 |
| 17 | Ga0070673_100284893 | 3300005364 | Bacteria | 1450 |
| 18 | Ga0070667_100043155 | 3300005367 | Bacteria | 3784 |
| 19 | Ga0070713_100323312 | 3300005436 | Bacteria | 1425 |
| 20 | Ga0070710_10000485 | 3300005437 | Bacteria | 18735 |
| 21 | Ga0068853_100182824 | 3300005539 | Bacteria | 1902 |
| 22 | Ga0070665_100480156 | 3300005548 | Bacteria | 1254 |
| 23 | Ga0075365_10029307 | 3300006038 | Bacteria | 3517 |
| 24 | Ga0075368_10010768 | 3300006042 | Bacteria | 3314 |
| 25 | Ga0075363_100002664 | 3300006048 | Bacteria | 7372 |
| 26 | Ga0075364_10003633 | 3300006051 | Bacteria | 8798 |
| 27 | Ga0075364_10022728 | 3300006051 | Bacteria | 3964 |
| 28 | Ga0075364_10031907 | 3300006051 | Bacteria | 3384 |
| 29 | Ga0075362_10019497 | 3300006177 | Bacteria | 2822 |
| 30 | Ga0075367_10002639 | 3300006178 | Bacteria | 8248 |
| 31 | Ga0075369_10012620 | 3300006186 | Bacteria | 3338 |
| 32 | Ga0075370_10010986 | 3300006353 | Bacteria | 4748 |
| 33 | Ga0105244_10016901 | 3300009036 | Bacteria | 4142 |
| 34 | Ga0105244_10019240 | 3300009036 | Bacteria | 3819 |
| 35 | Ga0105244_10130459 | 3300009036 | Bacteria | 1213 |
| 36 | Ga0111539_10386565 | 3300009094 | Bacteria | 1629 |
| 37 | Ga0105243_10043038 | 3300009148 | Bacteria | 3539 |
| 38 | Ga0105243_10053415 | 3300009148 | Bacteria | 3205 |
| 39 | Ga0105246_10014258 | 3300011119 | Bacteria | 4996 |
| 40 | Ga0157371_10060438 | 3300013102 | Bacteria | 2687 |
| 41 | Ga0157370_10511964 | 3300013104 | Bacteria | 1102 |
| 42 | Ga0157369_10124731 | 3300013105 | Bacteria | 2731 |
| 43 | Ga0157369_10616353 | 3300013105 | Bacteria | 1120 |
| 44 | Ga0171462_1003 | 3300013250 | Bacteria | 853796 |
| 45 | Ga0157372_10026195 | 3300013307 | Bacteria | 6344 |
| 46 | Ga0213876_10029568 | 3300021384 | Bacteria | 2887 |
| 47 | Ga0209566_100050 | 3300025225 | Bacteria | 234653 |
| 48 | Ga0209674_100001 | 3300025226 | Bacteria | 4013750 |
| 49 | Ga0209672_100006 | 3300025228 | Bacteria | 1004497 |
| 50 | Ga0209147_100819 | 3300025229 | Bacteria | 14772 |
| 51 | Ga0209563_100001 | 3300025230 | Bacteria | 4013775 |
| 52 | Ga0209563_100909 | 3300025230 | Bacteria | 8741 |
| 53 | Ga0207427_100010 | 3300025231 | Bacteria | 648610 |
| 54 | Ga0209437_100485 | 3300025233 | Bacteria | 29431 |
| 55 | Ga0209258_105496 | 3300025242 | Bacteria | 2131 |
| 56 | Ga0209646_1000099 | 3300025246 | Bacteria | 180436 |
| 57 | Ga0209677_100001 | 3300025253 | Bacteria | 4013787 |
| 58 | Ga0209148_1000015 | 3300025254 | Bacteria | 850103 |
| 59 | Ga0209233_1000001 | 3300025261 | Bacteria | 2992747 |
| 60 | Ga0209455_1000013 | 3300025272 | Bacteria | 850103 |
| 61 | Ga0209455_1002449 | 3300025272 | Bacteria | 7188 |
| 62 | Ga0209051_1036124 | 3300025303 | Bacteria | 1829 |
| 63 | Ga0207655_1003451 | 3300025728 | Bacteria | 11754 |
| 64 | Ga0207655_1018668 | 3300025728 | Bacteria | 3664 |
| 65 | Ga0207692_10005578 | 3300025898 | Bacteria | 5050 |
| 66 | Ga0207692_10042534 | 3300025898 | Bacteria | 2256 |
| 67 | Ga0207688_10099197 | 3300025901 | Bacteria | 1680 |
| 68 | Ga0207647_10011799 | 3300025904 | Bacteria | 6107 |
| 69 | Ga0207647_10017346 | 3300025904 | Bacteria | 4894 |
| 70 | Ga0207700_10226978 | 3300025928 | Bacteria | 1586 |
| 71 | Ga0207664_10131907 | 3300025929 | Bacteria | 2104 |
| 72 | Ga0207689_10171854 | 3300025942 | Bacteria | 1787 |
| 73 | Ga0207712_10102856 | 3300025961 | Bacteria | 2127 |
| 74 | Ga0207668_10175300 | 3300025972 | Bacteria | 1686 |
| 75 | Ga0207658_10032447 | 3300025986 | Bacteria | 3717 |
| 76 | Ga0268266_10444537 | 3300028379 | Bacteria | 1232 |
| 77 | Ga0307516_10001196 | 3300031730 | Bacteria | 36254 |
| 78 | Ga0307405_10229444 | 3300031731 | Bacteria | 1368 |
| 79 | Ga0307410_10098354 | 3300031852 | Bacteria | 2093 |
| 80 | Ga0307406_10001290 | 3300031901 | Bacteria | 14052 |
| 81 | Ga0307406_10004767 | 3300031901 | Bacteria | 7386 |
| 82 | Ga0307414_10347818 | 3300032004 | Bacteria | 1271 |
| 83 | Ga0307415_100142280 | 3300032126 | Bacteria | 1834 |
| 84 | Ga0395899_0056532 | 3300037312 | Bacteria | 2900 |
| 85 | Ga0395900_0004762 | 3300037418 | Bacteria | 14300 |
| 86 | Ga0395898_0001540 | 3300037466 | Bacteria | 31698 |
| 87 | Ga0395898_0086951 | 3300037466 | Bacteria | 3012 |
| 88 | Ga0436365_0119798 | 3300039437 | Bacteria | 6924 |
| 89 | Ga0436361_0784840 | 3300039447 | Bacteria | 2839 |
| 90 | Ga0451789_1032327 | 3300041443 | Bacteria | 944 |
| 91 | Ga0451793_1645126 | 3300041452 | Bacteria | 1659 |
| 92 | Ga0451806_363965 | 3300041462 | Bacteria | 3152 |
| 93 | Ga0451841_1128478 | 3300041498 | Bacteria | 1056 |
| 94 | Ga0439462_0015875 | 3300042015 | Bacteria | 1944 |
| 95 | Ga0466972_0004706 | 3300044658 | Bacteria | 6834 |
| 96 | Ga0466965_0093504 | 3300044683 | Bacteria | 1531 |
| 97 | Ga0466965_0113989 | 3300044683 | Bacteria | 1391 |
| 98 | Ga0466961_0240429 | 3300044693 | Bacteria | 1113 |
| 99 | Ga0466968_0013124 | 3300044735 | Bacteria | 3253 |
| 100 | Ga0466968_0029433 | 3300044735 | Bacteria | 2271 |
| 101 | Ga0466968_0042654 | 3300044735 | Bacteria | 1919 |
| 102 | Ga0466968_0089342 | 3300044735 | Bacteria | 1363 |
| 103 | Ga0466970_0000454 | 3300044765 | Bacteria | 20164 |
| 104 | Ga0466970_0005976 | 3300044765 | Bacteria | 6065 |
| 105 | Ga0466970_0030520 | 3300044765 | Bacteria | 2843 |
| 106 | Ga0466970_0142523 | 3300044765 | Bacteria | 1320 |
| 107 | Ga0466957_0097802 | 3300044842 | Bacteria | 1846 |
| 108 | Ga0466957_0222441 | 3300044842 | Bacteria | 1247 |
| 109 | Ga0466960_0003842 | 3300044901 | Bacteria | 5823 |
| 110 | Ga0466960_0018625 | 3300044901 | Bacteria | 3046 |
| 111 | Ga0466960_0056295 | 3300044901 | Bacteria | 1914 |
| 112 | Ga0466960_0092825 | 3300044901 | Bacteria | 1541 |
| 113 | Ga0466960_0105547 | 3300044901 | Bacteria | 1456 |
| 114 | Ga0466958_0118042 | 3300045836 | Bacteria | 1659 |
| 115 | Ga0495627_000473 | 3300046453 | Bacteria | 34381 |
| 116 | Ga0495585_0059844 | 3300046492 | Bacteria | 2098 |
| 117 | Ga0495645_0055563 | 3300046543 | Bacteria | 2875 |
| 118 | Ga0496100_0014858 | 3300048903 | Bacteria | 4531 |
| 119 | Ga0496100_0377823 | 3300048903 | Bacteria | 1075 |
| 120 | Ga0496101_0002593 | 3300048904 | Bacteria | 11108 |
| 121 | Ga0496102_0156175 | 3300048905 | Bacteria | 2145 |
| 122 | Ga0496102_0352652 | 3300048905 | Bacteria | 1385 |
| 123 | Ga0496103_0050756 | 3300048906 | Bacteria | 2566 |
| 124 | Ga0496104_0121817 | 3300048907 | Bacteria | 2504 |
| 125 | Ga0496105_0075717 | 3300048908 | Bacteria | 2779 |
| 126 | Ga0496105_0130107 | 3300048908 | Bacteria | 2075 |
| 127 | Ga0496107_0004710 | 3300048910 | Bacteria | 9267 |
| 128 | Ga0496107_0381747 | 3300048910 | Bacteria | 1048 |
| 129 | Ga0496108_0000088 | 3300048911 | Bacteria | 97568 |
| 130 | Ga0496108_0240042 | 3300048911 | Bacteria | 1576 |
| 131 | Ga0496109_0030410 | 3300048912 | Bacteria | 4840 |
| 132 | Ga0496111_0003836 | 3300048914 | Bacteria | 9388 |
| 133 | Ga0496112_0043686 | 3300048915 | Bacteria | 4388 |
| 134 | Ga0496113_0003897 | 3300048916 | Bacteria | 9042 |
| 135 | Ga0496113_0130578 | 3300048916 | Bacteria | 1971 |
| 136 | Ga0496114_0006901 | 3300048917 | Bacteria | 8945 |
| 137 | Ga0496114_0066271 | 3300048917 | Bacteria | 3027 |
| 138 | Ga0496115_0014157 | 3300048918 | Bacteria | 6035 |
| 139 | Ga0496116_0011690 | 3300048919 | Bacteria | 7234 |
| 140 | Ga0496117_0001146 | 3300048920 | Bacteria | 39905 |
| 141 | Ga0496117_0004701 | 3300048920 | Bacteria | 14836 |
| 142 | Ga0496117_0012065 | 3300048920 | Bacteria | 7671 |
| 143 | Ga0496117_0016448 | 3300048920 | Bacteria | 6244 |
| 144 | Ga0496117_0112528 | 3300048920 | Bacteria | 1692 |
| 145 | Ga0496118_0006139 | 3300048921 | Bacteria | 13336 |
| 146 | Ga0496118_0007657 | 3300048921 | Bacteria | 11371 |
| 147 | Ga0496118_0011377 | 3300048921 | Bacteria | 8695 |
| 148 | Ga0496118_0021380 | 3300048921 | Bacteria | 5697 |
| 149 | Ga0496119_0002374 | 3300048922 | Bacteria | 20694 |
| 150 | Ga0496119_0002990 | 3300048922 | Bacteria | 17940 |
| 151 | Ga0496119_0013457 | 3300048922 | Bacteria | 6517 |
| 152 | Ga0496119_0021810 | 3300048922 | Bacteria | 4611 |
| 153 | Ga0496119_0047972 | 3300048922 | Bacteria | 2652 |
| 154 | Ga0496119_0078493 | 3300048922 | Bacteria | 1909 |
| 155 | Ga0496119_0136544 | 3300048922 | Bacteria | 1329 |
| 156 | Ga0496120_0000565 | 3300048923 | Bacteria | 56440 |
| 157 | Ga0496120_0001021 | 3300048923 | Bacteria | 37451 |
| 158 | Ga0496120_0002253 | 3300048923 | Bacteria | 20131 |
| 159 | Ga0496120_0009198 | 3300048923 | Bacteria | 7041 |
| 160 | Ga0496121_0000040 | 3300048924 | Bacteria | 348494 |
| 161 | Ga0496122_0000054 | 3300048925 | Bacteria | 259135 |
| 162 | Ga0496122_0000240 | 3300048925 | Bacteria | 123001 |
| 163 | Ga0496122_0033312 | 3300048925 | Bacteria | 4241 |
| 164 | Ga0496122_0117989 | 3300048925 | Bacteria | 1721 |
| 165 | Ga0496122_0162202 | 3300048925 | Bacteria | 1361 |
| 166 | Ga0496122_0174174 | 3300048925 | Bacteria | 1292 |
| 167 | Ga0496123_0000039 | 3300048926 | Bacteria | 259107 |
| 168 | Ga0496123_0000076 | 3300048926 | Bacteria | 194050 |
| 169 | Ga0496123_0029555 | 3300048926 | Bacteria | 4030 |
| 170 | Ga0496124_0002643 | 3300048927 | Bacteria | 23026 |
| 171 | Ga0496124_0002883 | 3300048927 | Bacteria | 21715 |
| 172 | Ga0496124_0005986 | 3300048927 | Bacteria | 13424 |
| 173 | Ga0496125_0000061 | 3300048928 | Bacteria | 262739 |
| 174 | Ga0496125_0000640 | 3300048928 | Bacteria | 58381 |
| 175 | Ga0496125_0025355 | 3300048928 | Bacteria | 5431 |
| 176 | Ga0496125_0028319 | 3300048928 | Bacteria | 5064 |
| 177 | Ga0496125_0056181 | 3300048928 | Bacteria | 3199 |
| 178 | Ga0496125_0170170 | 3300048928 | Bacteria | 1466 |
| 179 | Ga0496126_0005801 | 3300048929 | Bacteria | 13962 |
| 180 | Ga0496126_0009671 | 3300048929 | Bacteria | 10217 |
| 181 | Ga0496126_0027674 | 3300048929 | Bacteria | 5411 |
| 182 | Ga0496126_0043207 | 3300048929 | Bacteria | 4158 |
| 183 | Ga0496126_0043527 | 3300048929 | Bacteria | 4141 |
| 184 | Ga0496126_0079270 | 3300048929 | Bacteria | 2908 |
| 185 | Ga0496126_0139514 | 3300048929 | Bacteria | 2088 |
| 186 | Ga0501031_0034220 | 3300049568 | Bacteria | 3316 |
| 187 | Ga0501032_0078530 | 3300049569 | Bacteria | 2197 |
| 188 | Ga0501032_0360073 | 3300049569 | Bacteria | 936 |
| 189 | Ga0501033_0037698 | 3300049570 | Bacteria | 3617 |
| 190 | Ga0501034_0003532 | 3300049571 | Bacteria | 17757 |
| 191 | Ga0501034_0011108 | 3300049571 | Bacteria | 9350 |
| 192 | Ga0501034_0047014 | 3300049571 | Bacteria | 4359 |
| 193 | Ga0501034_0137752 | 3300049571 | Bacteria | 2421 |
| 194 | Ga0501034_0228729 | 3300049571 | Bacteria | 1809 |
| 195 | Ga0501036_0236153 | 3300049572 | Bacteria | 1533 |
| 196 | Ga0501037_0026046 | 3300049573 | Bacteria | 4322 |
| 197 | Ga0501037_0253128 | 3300049573 | Bacteria | 1232 |
| 198 | Ga0501038_0038143 | 3300049574 | Bacteria | 4209 |
| 199 | Ga0501038_0043317 | 3300049574 | Bacteria | 3914 |
| 200 | Ga0501038_0053258 | 3300049574 | Bacteria | 3484 |
| 201 | Ga0501038_0083856 | 3300049574 | Bacteria | 2682 |
| 202 | Ga0501038_0165018 | 3300049574 | Bacteria | 1797 |
| 203 | Ga0501038_0211044 | 3300049574 | Bacteria | 1553 |
| 204 | Ga0501039_0062917 | 3300049575 | Bacteria | 2875 |
| 205 | Ga0501040_0049535 | 3300049576 | Bacteria | 2872 |
| 206 | Ga0501041_0057911 | 3300049577 | Bacteria | 2370 |
| 207 | Ga0501042_0000959 | 3300049578 | Bacteria | 16259 |
| 208 | Ga0501042_0421236 | 3300049578 | Bacteria | 967 |
| 209 | Ga0501043_0025240 | 3300049579 | Bacteria | 4662 |
| 210 | Ga0501043_0112399 | 3300049579 | Bacteria | 2139 |
| 211 | Ga0501043_0302002 | 3300049579 | Bacteria | 1223 |
| 212 | Ga0501046_0062312 | 3300049580 | Bacteria | 2914 |
| 213 | Ga0501046_0209887 | 3300049580 | Bacteria | 1446 |
| 214 | Ga0501046_0229886 | 3300049580 | Bacteria | 1371 |
| 215 | Ga0501047_0049910 | 3300049581 | Bacteria | 4040 |
| 216 | Ga0501047_0105484 | 3300049581 | Bacteria | 2698 |
| 217 | Ga0501047_0373073 | 3300049581 | Bacteria | 1262 |
| 218 | Ga0501048_0007747 | 3300049582 | Bacteria | 8140 |
| 219 | Ga0501070_0000593 | 3300049586 | Bacteria | 33023 |
| 220 | Ga0501070_0031310 | 3300049586 | Bacteria | 4457 |
| 221 | Ga0501075_0133504 | 3300049591 | Bacteria | 1891 |
| 222 | Ga0501079_0057654 | 3300049741 | Bacteria | 2997 |
| 223 | Ga0501080_0358753 | 3300049742 | Bacteria | 1315 |
| 224 | Ga0501083_0000003 | 3300049744 | Bacteria | 235949 |
| 225 | Ga0501035_0066694 | 3300049822 | Bacteria | 3194 |
| 226 | Ga0501044_0022406 | 3300049823 | Bacteria | 6731 |
| 227 | Ga0501044_0470849 | 3300049823 | Bacteria | 1160 |
| 228 | Ga0501045_0142992 | 3300049824 | Bacteria | 1779 |
| 229 | nmdc:mga03683_30170_c1 | 3300050489 | Bacteria | 2168 |
| 230 | nmdc:mga00v17_18602_c1 | 3300050491 | Bacteria | 3950 |
| 231 | nmdc:mga00v17_220122_c1 | 3300050491 | Bacteria | 904 |
| 232 | nmdc:mga00v17_4121_c1 | 3300050491 | Bacteria | 7523 |
| 233 | nmdc:mga0yw44_28841_c1 | 3300050492 | Bacteria | 3197 |
| 234 | nmdc:mga06z11_7295_c1 | 3300050494 | Bacteria | 4540 |
| 235 | nmdc:mga04h51_7770_c1 | 3300050495 | Bacteria | 2844 |
| 236 | nmdc:mga0sz30_179382_c1 | 3300050516 | Bacteria | 939 |
| 237 | nmdc:mga0sz30_9815_c1 | 3300050516 | Bacteria | 3650 |
| 238 | Ga0500568_0000158 | 3300053139 | Bacteria | 58729 |
| 239 | Ga0500568_0005474 | 3300053139 | Bacteria | 6553 |
| 240 | Ga0500573_0000013 | 3300053140 | Bacteria | 196637 |
| 241 | Ga0500573_0054559 | 3300053140 | Bacteria | 2294 |
| 242 | Ga0500616_0169301 | 3300053153 | Bacteria | 994 |
| 243 | Ga0501084_0060628 | 3300054114 | Bacteria | 3167 |
| 244 | Ga0530510_0044934 | 3300061734 | Bacteria | 3192 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005436 | Ga0070713_100323312 | Ga0070713_1003233121 | 274 |
| 2 | 3300025928 | Ga0207700_10226978 | Ga0207700_102269782 | 274 |
| 3 | iso_pu_bacteria | 2728369276 | 2729908986 | 279 |
| 4 | iso_pu_bacteria | 2919443155 | 2919446298 | 279 |
| 5 | iso_pu_bacteria | 2919523602 | 2919524687 | 279 |
| 6 | iso_pu_bacteria | 2946033335 | 2946033780 | 279 |
| 7 | 3300049572 | Ga0501036_0236153 | Ga0501036_0236153_17_907 | 280 |
| 8 | 3300049574 | Ga0501038_0165018 | Ga0501038_0165018_790_1632 | 280 |
| 9 | 3300049575 | Ga0501039_0062917 | Ga0501039_0062917_36_878 | 280 |
| 10 | 3300049576 | Ga0501040_0049535 | Ga0501040_0049535_80_922 | 280 |
| 11 | 3300049577 | Ga0501041_0057911 | Ga0501041_0057911_1500_2342 | 280 |
| 12 | 3300049578 | Ga0501042_0421236 | Ga0501042_0421236_84_926 | 280 |
| 13 | 3300049580 | Ga0501046_0229886 | Ga0501046_0229886_497_1339 | 280 |
| 14 | 3300049582 | Ga0501048_0007747 | Ga0501048_0007747_7253_8095 | 280 |
| 15 | 3300049591 | Ga0501075_0133504 | Ga0501075_0133504_246_1088 | 280 |
| 16 | 3300049741 | Ga0501079_0057654 | Ga0501079_0057654_2092_2982 | 280 |
| 17 | 3300049742 | Ga0501080_0358753 | Ga0501080_0358753_253_1170 | 280 |
| 18 | 3300049824 | Ga0501045_0142992 | Ga0501045_0142992_874_1716 | 280 |
| 19 | 3300054114 | Ga0501084_0060628 | Ga0501084_0060628_1576_2418 | 280 |
| 20 | 3300061734 | Ga0530510_0044934 | Ga0530510_0044934_2262_3104 | 280 |
| 21 | 3300001979 | JGI24740J21852_10063993 | JGI24740J21852_100639931 | 283 |
| 22 | 3300001989 | JGI24739J22299_10051799 | JGI24739J22299_100517992 | 283 |
| 23 | 3300002772 | JGI25164J39214_1000369 | JGI25164J39214_100036928 | 283 |
| 24 | 3300003214 | JGI25165J46597_1000004 | JGI25165J46597_1000004541 | 283 |
| 25 | 3300003320 | rootH2_10010853 | rootH2_100108532 | 283 |
| 26 | 3300003578 | Ga0006562J51391_1011017 | Ga0006562J51391_10110171 | 283 |
| 27 | 3300003578 | Ga0006562J51391_1011018 | Ga0006562J51391_10110188 | 283 |
| 28 | 3300003578 | Ga0006562J51391_1023897 | Ga0006562J51391_10238972 | 283 |
| 29 | 3300003752 | Ga0055539_1000008 | Ga0055539_1000008108 | 283 |
| 30 | 3300003756 | Ga0055533_1000001 | Ga0055533_1000001963 | 283 |
| 31 | 3300003759 | Ga0055525_1000510 | Ga0055525_100051017 | 283 |
| 32 | 3300003760 | Ga0055527_1000001 | Ga0055527_1000001432 | 283 |
| 33 | 3300003763 | Ga0055529_1000018 | Ga0055529_100001864 | 283 |
| 34 | 3300003841 | Ga0055541_1001834 | Ga0055541_10018344 | 283 |
| 35 | 3300005337 | Ga0070682_100105819 | Ga0070682_1001058192 | 283 |
| 36 | 3300005347 | Ga0070668_100184306 | Ga0070668_1001843062 | 283 |
| 37 | 3300005364 | Ga0070673_100284893 | Ga0070673_1002848931 | 283 |
| 38 | 3300005367 | Ga0070667_100043155 | Ga0070667_1000431552 | 283 |
| 39 | 3300005437 | Ga0070710_10000485 | Ga0070710_100004853 | 283 |
| 40 | 3300005539 | Ga0068853_100182824 | Ga0068853_1001828242 | 283 |
| 41 | 3300005548 | Ga0070665_100480156 | Ga0070665_1004801562 | 283 |
| 42 | 3300006038 | Ga0075365_10029307 | Ga0075365_100293072 | 283 |
| 43 | 3300006042 | Ga0075368_10010768 | Ga0075368_100107682 | 283 |
| 44 | 3300006048 | Ga0075363_100002664 | Ga0075363_1000026648 | 283 |
| 45 | 3300006051 | Ga0075364_10003633 | Ga0075364_100036332 | 283 |
| 46 | 3300006051 | Ga0075364_10022728 | Ga0075364_100227283 | 283 |
| 47 | 3300006051 | Ga0075364_10031907 | Ga0075364_100319072 | 283 |
| 48 | 3300006177 | Ga0075362_10019497 | Ga0075362_100194973 | 283 |
| 49 | 3300006178 | Ga0075367_10002639 | Ga0075367_100026394 | 283 |
| 50 | 3300006186 | Ga0075369_10012620 | Ga0075369_100126202 | 283 |
| 51 | 3300006353 | Ga0075370_10010986 | Ga0075370_100109863 | 283 |
| 52 | 3300009036 | Ga0105244_10016901 | Ga0105244_100169014 | 283 |
| 53 | 3300009036 | Ga0105244_10019240 | Ga0105244_100192403 | 283 |
| 54 | 3300009036 | Ga0105244_10130459 | Ga0105244_101304591 | 283 |
| 55 | 3300009094 | Ga0111539_10386565 | Ga0111539_103865652 | 283 |
| 56 | 3300009148 | Ga0105243_10043038 | Ga0105243_100430383 | 283 |
| 57 | 3300009148 | Ga0105243_10053415 | Ga0105243_100534153 | 283 |
| 58 | 3300011119 | Ga0105246_10014258 | Ga0105246_100142582 | 283 |
| 59 | 3300013102 | Ga0157371_10060438 | Ga0157371_100604381 | 283 |
| 60 | 3300013104 | Ga0157370_10511964 | Ga0157370_105119641 | 283 |
| 61 | 3300013105 | Ga0157369_10124731 | Ga0157369_101247313 | 283 |
| 62 | 3300013105 | Ga0157369_10616353 | Ga0157369_106163532 | 283 |
| 63 | 3300013250 | Ga0171462_1003 | Ga0171462_1003454 | 283 |
| 64 | 3300013307 | Ga0157372_10026195 | Ga0157372_100261958 | 283 |
| 65 | 3300021384 | Ga0213876_10029568 | Ga0213876_100295682 | 283 |
| 66 | 3300025225 | Ga0209566_100050 | Ga0209566_10005025 | 283 |
| 67 | 3300025226 | Ga0209674_100001 | Ga0209674_100001963 | 283 |
| 68 | 3300025228 | Ga0209672_100006 | Ga0209672_100006544 | 283 |
| 69 | 3300025229 | Ga0209147_100819 | Ga0209147_1008194 | 283 |
| 70 | 3300025230 | Ga0209563_100001 | Ga0209563_100001963 | 283 |
| 71 | 3300025230 | Ga0209563_100909 | Ga0209563_1009093 | 283 |
| 72 | 3300025231 | Ga0207427_100010 | Ga0207427_10001041 | 283 |
| 73 | 3300025233 | Ga0209437_100485 | Ga0209437_10048513 | 283 |
| 74 | 3300025242 | Ga0209258_105496 | Ga0209258_1054962 | 283 |
| 75 | 3300025246 | Ga0209646_1000099 | Ga0209646_10000999 | 283 |
| 76 | 3300025253 | Ga0209677_100001 | Ga0209677_100001963 | 283 |
| 77 | 3300025254 | Ga0209148_1000015 | Ga0209148_1000015388 | 283 |
| 78 | 3300025261 | Ga0209233_1000001 | Ga0209233_10000011909 | 283 |
| 79 | 3300025272 | Ga0209455_1000013 | Ga0209455_1000013388 | 283 |
| 80 | 3300025272 | Ga0209455_1002449 | Ga0209455_10024494 | 283 |
| 81 | 3300025303 | Ga0209051_1036124 | Ga0209051_10361242 | 283 |
| 82 | 3300025728 | Ga0207655_1003451 | Ga0207655_10034513 | 283 |
| 83 | 3300025728 | Ga0207655_1018668 | Ga0207655_10186683 | 283 |
| 84 | 3300025898 | Ga0207692_10005578 | Ga0207692_100055784 | 283 |
| 85 | 3300025898 | Ga0207692_10042534 | Ga0207692_100425341 | 283 |
| 86 | 3300025901 | Ga0207688_10099197 | Ga0207688_100991972 | 283 |
| 87 | 3300025904 | Ga0207647_10011799 | Ga0207647_100117996 | 283 |
| 88 | 3300025904 | Ga0207647_10017346 | Ga0207647_100173465 | 283 |
| 89 | 3300025929 | Ga0207664_10131907 | Ga0207664_101319072 | 283 |
| 90 | 3300025942 | Ga0207689_10171854 | Ga0207689_101718542 | 283 |
| 91 | 3300025961 | Ga0207712_10102856 | Ga0207712_101028562 | 283 |
| 92 | 3300025972 | Ga0207668_10175300 | Ga0207668_101753002 | 283 |
| 93 | 3300025986 | Ga0207658_10032447 | Ga0207658_100324472 | 283 |
| 94 | 3300028379 | Ga0268266_10444537 | Ga0268266_104445372 | 283 |
| 95 | 3300031730 | Ga0307516_10001196 | Ga0307516_1000119613 | 283 |
| 96 | 3300031731 | Ga0307405_10229444 | Ga0307405_102294442 | 283 |
| 97 | 3300031852 | Ga0307410_10098354 | Ga0307410_100983542 | 283 |
| 98 | 3300031901 | Ga0307406_10001290 | Ga0307406_1000129015 | 283 |
| 99 | 3300031901 | Ga0307406_10004767 | Ga0307406_100047677 | 283 |
| 100 | 3300032004 | Ga0307414_10347818 | Ga0307414_103478182 | 283 |
| 101 | 3300032126 | Ga0307415_100142280 | Ga0307415_1001422802 | 283 |
| 102 | 3300037312 | Ga0395899_0056532 | Ga0395899_0056532_1263_2114 | 283 |
| 103 | 3300037418 | Ga0395900_0004762 | Ga0395900_0004762_1752_2603 | 283 |
| 104 | 3300037466 | Ga0395898_0001540 | Ga0395898_0001540_27163_28014 | 283 |
| 105 | 3300037466 | Ga0395898_0086951 | Ga0395898_0086951_914_1768 | 283 |
| 106 | 3300039437 | Ga0436365_0119798 | Ga0436365_0119798_462_1334 | 283 |
| 107 | 3300039447 | Ga0436361_0784840 | Ga0436361_0784840_773_1624 | 283 |
| 108 | 3300041443 | Ga0451789_1032327 | Ga0451789_1032327_49_900 | 283 |
| 109 | 3300041452 | Ga0451793_1645126 | Ga0451793_1645126_50_901 | 283 |
| 110 | 3300041462 | Ga0451806_363965 | Ga0451806_363965_646_1497 | 283 |
| 111 | 3300041498 | Ga0451841_1128478 | Ga0451841_1128478_126_977 | 283 |
| 112 | 3300042015 | Ga0439462_0015875 | Ga0439462_0015875_842_1729 | 283 |
| 113 | 3300044658 | Ga0466972_0004706 | Ga0466972_0004706_2659_3510 | 283 |
| 114 | 3300044683 | Ga0466965_0093504 | Ga0466965_0093504_486_1337 | 283 |
| 115 | 3300044683 | Ga0466965_0113989 | Ga0466965_0113989_288_1139 | 283 |
| 116 | 3300044693 | Ga0466961_0240429 | Ga0466961_0240429_43_894 | 283 |
| 117 | 3300044735 | Ga0466968_0013124 | Ga0466968_0013124_2279_3142 | 283 |
| 118 | 3300044735 | Ga0466968_0029433 | Ga0466968_0029433_185_1036 | 283 |
| 119 | 3300044735 | Ga0466968_0042654 | Ga0466968_0042654_987_1838 | 283 |
| 120 | 3300044735 | Ga0466968_0089342 | Ga0466968_0089342_184_1035 | 283 |
| 121 | 3300044765 | Ga0466970_0000454 | Ga0466970_0000454_3412_4266 | 283 |
| 122 | 3300044765 | Ga0466970_0005976 | Ga0466970_0005976_2422_3273 | 283 |
| 123 | 3300044765 | Ga0466970_0030520 | Ga0466970_0030520_878_1741 | 283 |
| 124 | 3300044765 | Ga0466970_0142523 | Ga0466970_0142523_117_968 | 283 |
| 125 | 3300044842 | Ga0466957_0097802 | Ga0466957_0097802_609_1460 | 283 |
| 126 | 3300044842 | Ga0466957_0222441 | Ga0466957_0222441_351_1205 | 283 |
| 127 | 3300044901 | Ga0466960_0003842 | Ga0466960_0003842_829_1680 | 283 |
| 128 | 3300044901 | Ga0466960_0018625 | Ga0466960_0018625_341_1192 | 283 |
| 129 | 3300044901 | Ga0466960_0056295 | Ga0466960_0056295_354_1205 | 283 |
| 130 | 3300044901 | Ga0466960_0092825 | Ga0466960_0092825_41_892 | 283 |
| 131 | 3300044901 | Ga0466960_0105547 | Ga0466960_0105547_105_956 | 283 |
| 132 | 3300045836 | Ga0466958_0118042 | Ga0466958_0118042_269_1120 | 283 |
| 133 | 3300046453 | Ga0495627_000473 | Ga0495627_000473_20935_21786 | 283 |
| 134 | 3300046492 | Ga0495585_0059844 | Ga0495585_0059844_240_1115 | 283 |
| 135 | 3300046543 | Ga0495645_0055563 | Ga0495645_0055563_1972_2823 | 283 |
| 136 | 3300048903 | Ga0496100_0014858 | Ga0496100_0014858_3622_4473 | 283 |
| 137 | 3300048903 | Ga0496100_0377823 | Ga0496100_0377823_41_892 | 283 |
| 138 | 3300048904 | Ga0496101_0002593 | Ga0496101_0002593_6898_7749 | 283 |
| 139 | 3300048905 | Ga0496102_0156175 | Ga0496102_0156175_90_941 | 283 |
| 140 | 3300048905 | Ga0496102_0352652 | Ga0496102_0352652_406_1257 | 283 |
| 141 | 3300048906 | Ga0496103_0050756 | Ga0496103_0050756_206_1057 | 283 |
| 142 | 3300048907 | Ga0496104_0121817 | Ga0496104_0121817_511_1362 | 283 |
| 143 | 3300048908 | Ga0496105_0075717 | Ga0496105_0075717_1395_2246 | 283 |
| 144 | 3300048908 | Ga0496105_0130107 | Ga0496105_0130107_119_970 | 283 |
| 145 | 3300048910 | Ga0496107_0004710 | Ga0496107_0004710_3245_4096 | 283 |
| 146 | 3300048910 | Ga0496107_0381747 | Ga0496107_0381747_68_919 | 283 |
| 147 | 3300048911 | Ga0496108_0000088 | Ga0496108_0000088_57481_58332 | 283 |
| 148 | 3300048911 | Ga0496108_0240042 | Ga0496108_0240042_403_1254 | 283 |
| 149 | 3300048912 | Ga0496109_0030410 | Ga0496109_0030410_838_1689 | 283 |
| 150 | 3300048914 | Ga0496111_0003836 | Ga0496111_0003836_3431_4282 | 283 |
| 151 | 3300048915 | Ga0496112_0043686 | Ga0496112_0043686_2535_3386 | 283 |
| 152 | 3300048916 | Ga0496113_0003897 | Ga0496113_0003897_971_1822 | 283 |
| 153 | 3300048916 | Ga0496113_0130578 | Ga0496113_0130578_113_964 | 283 |
| 154 | 3300048917 | Ga0496114_0006901 | Ga0496114_0006901_4736_5587 | 283 |
| 155 | 3300048917 | Ga0496114_0066271 | Ga0496114_0066271_1164_2015 | 283 |
| 156 | 3300048918 | Ga0496115_0014157 | Ga0496115_0014157_4844_5695 | 283 |
| 157 | 3300048919 | Ga0496116_0011690 | Ga0496116_0011690_4059_4910 | 283 |
| 158 | 3300048920 | Ga0496117_0001146 | Ga0496117_0001146_27294_28145 | 283 |
| 159 | 3300048920 | Ga0496117_0004701 | Ga0496117_0004701_10921_11772 | 283 |
| 160 | 3300048920 | Ga0496117_0012065 | Ga0496117_0012065_1630_2481 | 283 |
| 161 | 3300048920 | Ga0496117_0016448 | Ga0496117_0016448_3636_4487 | 283 |
| 162 | 3300048920 | Ga0496117_0112528 | Ga0496117_0112528_18_869 | 283 |
| 163 | 3300048921 | Ga0496118_0006139 | Ga0496118_0006139_5752_6603 | 283 |
| 164 | 3300048921 | Ga0496118_0007657 | Ga0496118_0007657_6692_7543 | 283 |
| 165 | 3300048921 | Ga0496118_0011377 | Ga0496118_0011377_7073_7924 | 283 |
| 166 | 3300048921 | Ga0496118_0021380 | Ga0496118_0021380_2659_3510 | 283 |
| 167 | 3300048922 | Ga0496119_0002374 | Ga0496119_0002374_16329_17180 | 283 |
| 168 | 3300048922 | Ga0496119_0002990 | Ga0496119_0002990_3925_4776 | 283 |
| 169 | 3300048922 | Ga0496119_0013457 | Ga0496119_0013457_2046_3107 | 283 |
| 170 | 3300048922 | Ga0496119_0021810 | Ga0496119_0021810_1366_2217 | 283 |
| 171 | 3300048922 | Ga0496119_0047972 | Ga0496119_0047972_1017_1868 | 283 |
| 172 | 3300048922 | Ga0496119_0078493 | Ga0496119_0078493_892_1743 | 283 |
| 173 | 3300048922 | Ga0496119_0136544 | Ga0496119_0136544_326_1177 | 283 |
| 174 | 3300048923 | Ga0496120_0000565 | Ga0496120_0000565_43285_44136 | 283 |
| 175 | 3300048923 | Ga0496120_0001021 | Ga0496120_0001021_2333_3184 | 283 |
| 176 | 3300048923 | Ga0496120_0002253 | Ga0496120_0002253_7252_8103 | 283 |
| 177 | 3300048923 | Ga0496120_0009198 | Ga0496120_0009198_763_1653 | 283 |
| 178 | 3300048924 | Ga0496121_0000040 | Ga0496121_0000040_261987_262910 | 283 |
| 179 | 3300048925 | Ga0496122_0000054 | Ga0496122_0000054_111376_112227 | 283 |
| 180 | 3300048925 | Ga0496122_0000240 | Ga0496122_0000240_89846_90697 | 283 |
| 181 | 3300048925 | Ga0496122_0033312 | Ga0496122_0033312_3281_4132 | 283 |
| 182 | 3300048925 | Ga0496122_0117989 | Ga0496122_0117989_396_1247 | 283 |
| 183 | 3300048925 | Ga0496122_0162202 | Ga0496122_0162202_352_1203 | 283 |
| 184 | 3300048925 | Ga0496122_0174174 | Ga0496122_0174174_388_1239 | 283 |
| 185 | 3300048926 | Ga0496123_0000039 | Ga0496123_0000039_111376_112227 | 283 |
| 186 | 3300048926 | Ga0496123_0000076 | Ga0496123_0000076_27296_28147 | 283 |
| 187 | 3300048926 | Ga0496123_0029555 | Ga0496123_0029555_699_1550 | 283 |
| 188 | 3300048927 | Ga0496124_0002643 | Ga0496124_0002643_14263_15114 | 283 |
| 189 | 3300048927 | Ga0496124_0002883 | Ga0496124_0002883_12602_13453 | 283 |
| 190 | 3300048927 | Ga0496124_0005986 | Ga0496124_0005986_5580_6431 | 283 |
| 191 | 3300048928 | Ga0496125_0000061 | Ga0496125_0000061_114565_115416 | 283 |
| 192 | 3300048928 | Ga0496125_0000640 | Ga0496125_0000640_53955_54806 | 283 |
| 193 | 3300048928 | Ga0496125_0025355 | Ga0496125_0025355_2009_2860 | 283 |
| 194 | 3300048928 | Ga0496125_0028319 | Ga0496125_0028319_881_1732 | 283 |
| 195 | 3300048928 | Ga0496125_0056181 | Ga0496125_0056181_1209_2060 | 283 |
| 196 | 3300048928 | Ga0496125_0170170 | Ga0496125_0170170_524_1375 | 283 |
| 197 | 3300048929 | Ga0496126_0005801 | Ga0496126_0005801_2593_3444 | 283 |
| 198 | 3300048929 | Ga0496126_0009671 | Ga0496126_0009671_6980_7831 | 283 |
| 199 | 3300048929 | Ga0496126_0027674 | Ga0496126_0027674_4042_4893 | 283 |
| 200 | 3300048929 | Ga0496126_0043207 | Ga0496126_0043207_2209_3060 | 283 |
| 201 | 3300048929 | Ga0496126_0043527 | Ga0496126_0043527_1353_2204 | 283 |
| 202 | 3300048929 | Ga0496126_0079270 | Ga0496126_0079270_664_1515 | 283 |
| 203 | 3300048929 | Ga0496126_0139514 | Ga0496126_0139514_389_1240 | 283 |
| 204 | 3300049568 | Ga0501031_0034220 | Ga0501031_0034220_2011_2862 | 283 |
| 205 | 3300049569 | Ga0501032_0078530 | Ga0501032_0078530_887_1750 | 283 |
| 206 | 3300049569 | Ga0501032_0360073 | Ga0501032_0360073_64_915 | 283 |
| 207 | 3300049570 | Ga0501033_0037698 | Ga0501033_0037698_2608_3459 | 283 |
| 208 | 3300049571 | Ga0501034_0003532 | Ga0501034_0003532_12802_13653 | 283 |
| 209 | 3300049571 | Ga0501034_0011108 | Ga0501034_0011108_110_961 | 283 |
| 210 | 3300049571 | Ga0501034_0047014 | Ga0501034_0047014_3023_3874 | 283 |
| 211 | 3300049571 | Ga0501034_0137752 | Ga0501034_0137752_1009_1860 | 283 |
| 212 | 3300049571 | Ga0501034_0228729 | Ga0501034_0228729_257_1120 | 283 |
| 213 | 3300049573 | Ga0501037_0026046 | Ga0501037_0026046_2626_3489 | 283 |
| 214 | 3300049573 | Ga0501037_0253128 | Ga0501037_0253128_360_1211 | 283 |
| 215 | 3300049574 | Ga0501038_0038143 | Ga0501038_0038143_2045_2896 | 283 |
| 216 | 3300049574 | Ga0501038_0043317 | Ga0501038_0043317_660_1511 | 283 |
| 217 | 3300049574 | Ga0501038_0053258 | Ga0501038_0053258_2256_3107 | 283 |
| 218 | 3300049574 | Ga0501038_0083856 | Ga0501038_0083856_1507_2370 | 283 |
| 219 | 3300049574 | Ga0501038_0211044 | Ga0501038_0211044_575_1426 | 283 |
| 220 | 3300049578 | Ga0501042_0000959 | Ga0501042_0000959_9522_10373 | 283 |
| 221 | 3300049579 | Ga0501043_0025240 | Ga0501043_0025240_460_1323 | 283 |
| 222 | 3300049579 | Ga0501043_0112399 | Ga0501043_0112399_344_1207 | 283 |
| 223 | 3300049579 | Ga0501043_0302002 | Ga0501043_0302002_260_1111 | 283 |
| 224 | 3300049580 | Ga0501046_0062312 | Ga0501046_0062312_1719_2570 | 283 |
| 225 | 3300049580 | Ga0501046_0209887 | Ga0501046_0209887_580_1431 | 283 |
| 226 | 3300049581 | Ga0501047_0049910 | Ga0501047_0049910_2781_3632 | 283 |
| 227 | 3300049581 | Ga0501047_0105484 | Ga0501047_0105484_1684_2568 | 283 |
| 228 | 3300049581 | Ga0501047_0373073 | Ga0501047_0373073_374_1237 | 283 |
| 229 | 3300049586 | Ga0501070_0000593 | Ga0501070_0000593_8992_9843 | 283 |
| 230 | 3300049586 | Ga0501070_0031310 | Ga0501070_0031310_2989_3840 | 283 |
| 231 | 3300049744 | Ga0501083_0000003 | Ga0501083_0000003_147221_148072 | 283 |
| 232 | 3300049822 | Ga0501035_0066694 | Ga0501035_0066694_1718_2569 | 283 |
| 233 | 3300049823 | Ga0501044_0022406 | Ga0501044_0022406_5396_6247 | 283 |
| 234 | 3300049823 | Ga0501044_0470849 | Ga0501044_0470849_108_959 | 283 |
| 235 | 3300050489 | nmdc:mga03683_30170_c1 | nmdc:mga03683_30170_c1_1206_2072 | 283 |
| 236 | 3300050491 | nmdc:mga00v17_18602_c1 | nmdc:mga00v17_18602_c1_1885_2736 | 283 |
| 237 | 3300050491 | nmdc:mga00v17_220122_c1 | nmdc:mga00v17_220122_c1_38_889 | 283 |
| 238 | 3300050491 | nmdc:mga00v17_4121_c1 | nmdc:mga00v17_4121_c1_2013_2864 | 283 |
| 239 | 3300050492 | nmdc:mga0yw44_28841_c1 | nmdc:mga0yw44_28841_c1_880_1743 | 283 |
| 240 | 3300050494 | nmdc:mga06z11_7295_c1 | nmdc:mga06z11_7295_c1_1817_2668 | 283 |
| 241 | 3300050495 | nmdc:mga04h51_7770_c1 | nmdc:mga04h51_7770_c1_714_1565 | 283 |
| 242 | 3300050516 | nmdc:mga0sz30_179382_c1 | nmdc:mga0sz30_179382_c1_41_895 | 283 |
| 243 | 3300050516 | nmdc:mga0sz30_9815_c1 | nmdc:mga0sz30_9815_c1_429_1280 | 283 |
| 244 | 3300053139 | Ga0500568_0000158 | Ga0500568_0000158_56928_57791 | 283 |
| 245 | 3300053139 | Ga0500568_0005474 | Ga0500568_0005474_5300_6166 | 283 |
| 246 | 3300053140 | Ga0500573_0000013 | Ga0500573_0000013_179024_179875 | 283 |
| 247 | 3300053140 | Ga0500573_0054559 | Ga0500573_0054559_539_1390 | 283 |
| 248 | 3300053153 | Ga0500616_0169301 | Ga0500616_0169301_115_966 | 283 |
| 249 | iso_pu_bacteria | 2808606306 | 2808631249 | 283 |
| 250 | iso_pu_bacteria | 2811994872 | 2812323052 | 283 |
| 251 | iso_pu_bacteria | 8045830549 | 8045831523 | 283 |
| 252 | iso_pu_bacteria | 8046352972 | 8046353015 | 283 |
| 253 | iso_pu_bacteria | 8046352972 | 8046356523 | 283 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1td2-assembly1.cif.gz_B | crystal structure of the pdxy protein from escherichia coli | 0.9675 | 2 | 282 |
| 1vi9-assembly2.cif.gz_D | crystal structure of pyridoxamine kinase | 0.9666 | 2 | 283 |
| 5trw-assembly1.cif.gz_A-2 | crystal structure of pyridoxamine kinase pdxy from burkholderia xenovorans | 0.9631 | 2 | 281 |
| 1vi9-assembly2.cif.gz_D | crystal structure of pyridoxamine kinase | 0.96 | 2 | 283 |
| 5b6a-assembly1.cif.gz_A-2 | structure of pyridoxal kinasefrom pseudomonas aeruginosa | 0.959 | 2 | 282 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1vi9C00 | Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase | 0.9503 | 2 | 283 | 3.40.1190.20 |
| af_Q55EK9_1_301_3.40.1190.20 | Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase | 0.949 | 2 | 280 | 3.40.1190.20 |
| af_Q7KUC2_7_303_3.40.1190.20 | Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase | 0.9469 | 2 | 282 | 3.40.1190.20 |
| af_P40191_1_283_3.40.1190.20 | Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase | 0.943 | 3 | 261 | 3.40.1190.20 |
| 1vi9C00 | Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase | 0.9404 | 2 | 283 | 3.40.1190.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W7H7A5-F1-model_v4 | pyridoxal kinase (EC 2.7.1.35) | 0.9926 | 1 | 283 |
GO:0005829
GO:0008478 GO:0009443 |
| AF-Q6AFC1-F1-model_v4 | Pyridoxal kinase PdxY (PL kinase) (EC 2.7.1.35) | 0.9924 | 1 | 283 |
GO:0000287
GO:0005524 GO:0005829 GO:0008478 GO:0009443 |
| AF-A0A4R4X2D8-F1-model_v4 | pyridoxal kinase (EC 2.7.1.35) | 0.9921 | 1 | 283 |
GO:0005829
GO:0008478 GO:0009443 |
| AF-A0A367Y9Q6-F1-model_v4 | pyridoxal kinase (EC 2.7.1.35) | 0.9921 | 1 | 283 |
GO:0005829
GO:0008478 GO:0009443 |
| AF-A0A6I6DXB0-F1-model_v4 | pyridoxal kinase (EC 2.7.1.35) | 0.9918 | 1 | 283 |
GO:0005829
GO:0008478 GO:0009443 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar