F364544

General Info

Members Datasets Scaffolds Average Seq Length
254 167 244 202

Family's Representative Sequence

Representative Sequence 3300003187|JGI25151J46595_10025157|JGI25151J46595_100251572
Length 231
Sequence LSLAGPKPVPQQGIALSHNRANIRAMDAKTQKSEMTRAAIIGAGIDLAAAEGLEAITLQAVADRIGISKSGVFSRIGSREALQKAVIEEFGRRFIADVFVPAMQQPKGLPRLDTIVQRWIVRMRDVEIQSGCIYTAGAFELDDRXGELRDTLFGEITRWRAALRRTVLQAVDAGHLRADTDPEQLVSEIYALSVGLLHDARFLRDSRAAERAQASWKRLLRSYQTEASNPQ

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2547132374 Acidovorax radicis N35 Isolate Unclassified
3 2643221596 Acidovorax sp. Root70 Isolate Unclassified
4 2643221609 Acidovorax sp. Root217 Isolate Unclassified
5 2643221611 Acidovorax sp. Root219 Isolate Unclassified
6 2643221717 Acidovorax sp. Root267 Isolate Unclassified
7 2738543012 Acidovorax sp. CF301 Isolate Unclassified
8 2816332133 Acidovorax radicis 2721A Isolate Unclassified
9 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
10 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
11 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
12 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
13 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
14 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
15 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
16 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
17 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
18 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
19 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
20 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
21 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
22 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
23 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
24 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
25 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
26 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
27 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
28 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
48 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
49 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
50 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
51 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
52 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
53 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
54 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
55 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
58 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
61 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
63 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
66 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
79 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
81 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
82 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
83 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
84 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
85 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
86 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
87 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
88 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
89 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
90 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
91 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
92 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
93 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
94 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
95 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
96 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
97 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
98 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
99 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
100 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
101 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
102 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
103 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
104 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
105 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
106 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
107 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
108 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
109 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
110 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
111 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
112 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
113 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
114 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
115 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
116 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
117 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
118 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
119 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
120 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
121 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
122 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
123 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
124 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
125 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
126 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
127 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
128 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
129 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
130 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
131 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
132 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
133 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
134 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
135 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
136 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
137 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
138 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
139 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
140 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
141 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
142 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
143 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
151 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
152 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
154 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
155 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
156 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
157 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
158 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
159 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
160 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
161 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
162 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
163 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
164 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
165 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
166 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
167 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.06
Metatranscriptomes 0
Isolates 3.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 37.4
Nodule 0
Rhizoplane 0.79
Rhizosphere 53.15
Stem 0
Stem Tuber 0
Unclassified 8.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000009 3300002704 Bacteria 224358
2 JGI25156J39149_1000009 3300002705 Bacteria 224379
3 JGI25154J39366_1000024 3300002738 Bacteria 211372
4 JGI25157J39369_1000007 3300002741 Bacteria 224377
5 JGI25150J39212_1003404 3300002774 Bacteria 3723
6 JGI25159J45721_1000551 3300002987 Bacteria 17029
7 JGI25151J46595_10025157 3300003187 Bacteria 2426
8 JGI25151J46595_10044453 3300003187 Bacteria 1577
9 JGI25151J46595_10061482 3300003187 Bacteria 1194
10 JGI25160J50197_1000131 3300003354 Bacteria 67778
11 JGI25161J50226_1000009 3300003374 Bacteria 224699
12 Ga0055537_1000020 3300003773 Bacteria 117325
13 Ga0055524_1000047 3300003775 Bacteria 150887
14 Ga0055536_1004516 3300003781 Bacteria 7079
15 Ga0055536_1013175 3300003781 Bacteria 3006
16 Ga0055536_1017959 3300003781 Bacteria 2288
17 Ga0055534_1001450 3300003784 Bacteria 9434
18 Ga0055534_1002481 3300003784 Bacteria 6354
19 Ga0055530_10001499 3300003791 Bacteria 16950
20 Ga0055530_10016980 3300003791 Bacteria 2295
21 Ga0055540_1000027 3300003792 Bacteria 187454
22 Ga0055540_1003444 3300003792 Bacteria 7643
23 Ga0055531_10000574 3300003794 Bacteria 32094
24 Ga0055531_10004610 3300003794 Bacteria 8293
25 Ga0055543_1001166 3300004625 Bacteria 11186
26 Ga0065165_1005570 3300005262 Bacteria 6999
27 Ga0065165_1006749 3300005262 Bacteria 5883
28 Ga0068868_100010096 3300005338 Bacteria 6821
29 Ga0070707_100686500 3300005468 Bacteria 987
30 Ga0070665_100046460 3300005548 Bacteria 4362
31 Ga0070704_100390873 3300005549 Bacteria 1184
32 Ga0068855_100017665 3300005563 Bacteria 8579
33 Ga0068856_100133011 3300005614 Bacteria 2492
34 Ga0075365_10126159 3300006038 Bacteria 1768
35 Ga0075363_100036158 3300006048 Bacteria 2589
36 Ga0075363_100058138 3300006048 Bacteria 2077
37 Ga0075364_10026467 3300006051 Bacteria 3700
38 Ga0075362_10006230 3300006177 Bacteria 4433
39 Ga0075362_10110688 3300006177 Bacteria 1292
40 Ga0075362_10114995 3300006177 Bacteria 1269
41 Ga0075362_10118394 3300006177 Bacteria 1252
42 Ga0075367_10014036 3300006178 Bacteria 4327
43 Ga0075367_10238216 3300006178 Bacteria 1140
44 Ga0075366_10008026 3300006195 Bacteria 5849
45 Ga0075366_10011769 3300006195 Bacteria 4947
46 Ga0097621_100369459 3300006237 Bacteria 1279
47 Ga0075428_100559736 3300006844 Bacteria 1222
48 Ga0105245_10067598 3300009098 Bacteria 3237
49 Ga0157326_1012961 3300012513 Bacteria 956
50 Ga0157374_10492958 3300013296 Bacteria 1229
51 Ga0157378_10292914 3300013297 Bacteria 1573
52 Ga0182008_10032584 3300014497 Bacteria 2617
53 Ga0157376_10014158 3300014969 Bacteria 5975
54 Ga0209435_100008 3300025206 Bacteria 503644
55 Ga0209436_112402 3300025208 Bacteria 1448
56 Ga0207425_1005006 3300025245 Bacteria 3855
57 Ga0207425_1008513 3300025245 Bacteria 2618
58 Ga0209646_1000029 3300025246 Bacteria 386414
59 Ga0209026_1000016 3300025250 Bacteria 386457
60 Ga0209759_1000016 3300025256 Bacteria 386414
61 Ga0209565_1000061 3300025263 Bacteria 185308
62 Ga0209565_1004036 3300025263 Bacteria 4574
63 Ga0209673_1000298 3300025273 Bacteria 91771
64 Ga0209673_1015619 3300025273 Bacteria 2874
65 Ga0209130_1000014 3300025284 Bacteria 412039
66 Ga0209130_1000862 3300025284 Bacteria 24952
67 Ga0209130_1003952 3300025284 Bacteria 5936
68 Ga0209675_1000105 3300025291 Bacteria 121013
69 Ga0209675_1000386 3300025291 Bacteria 36723
70 Ga0209675_1017383 3300025291 Bacteria 2056
71 Ga0209676_1000013 3300025292 Bacteria 816080
72 Ga0209676_1000153 3300025292 Bacteria 166393
73 Ga0209676_1003978 3300025292 Bacteria 8538
74 Ga0209676_1010501 3300025292 Bacteria 3846
75 Ga0209676_1014023 3300025292 Bacteria 3043
76 Ga0209025_1001613 3300025294 Bacteria 28202
77 Ga0209025_1004966 3300025294 Bacteria 11127
78 Ga0209025_1016644 3300025294 Bacteria 4315
79 Ga0209564_1000181 3300025295 Bacteria 151002
80 Ga0209564_1000247 3300025295 Bacteria 116628
81 Ga0209564_1010445 3300025295 Bacteria 4275
82 Ga0209758_1006772 3300025297 Bacteria 8052
83 Ga0209050_1000008 3300025298 Bacteria 1144179
84 Ga0209050_1002631 3300025298 Bacteria 14752
85 Ga0209050_1041741 3300025298 Bacteria 1261
86 Ga0209256_1000039 3300025299 Bacteria 372337
87 Ga0209256_1036822 3300025299 Bacteria 1280
88 Ga0207426_1000242 3300025302 Bacteria 122839
89 Ga0207426_1000816 3300025302 Bacteria 33430
90 Ga0209051_1000005 3300025303 Bacteria 1142353
91 Ga0209051_1001437 3300025303 Bacteria 20303
92 Ga0209051_1053724 3300025303 Bacteria 1320
93 Ga0209257_1000015 3300025304 Bacteria 908141
94 Ga0209257_1000031 3300025304 Bacteria 688770
95 Ga0209257_1003093 3300025304 Bacteria 14957
96 Ga0209257_1017163 3300025304 Bacteria 2872
97 Ga0209257_1031329 3300025304 Bacteria 1702
98 Ga0207646_10508728 3300025922 Bacteria 1085
99 Ga0207650_10441233 3300025925 Bacteria 1082
100 Ga0207669_10272474 3300025937 Bacteria 1272
101 Ga0207667_11107034 3300025949 Bacteria 775
102 Ga0207677_10001620 3300026023 Bacteria 11948
103 Ga0207677_10049576 3300026023 Bacteria 2834
104 Ga0207702_10125441 3300026078 Bacteria 2304
105 Ga0207674_10185925 3300026116 Bacteria 2028
106 Ga0207683_10052830 3300026121 Bacteria 3561
107 Ga0209970_1001101 3300027614 Bacteria 4766
108 Ga0209974_10023257 3300027876 Bacteria 2051
109 Ga0207428_10092993 3300027907 Bacteria 2340
110 Ga0268266_10007265 3300028379 Bacteria 10015
111 Ga0307513_10000025 3300031456 Bacteria 202918
112 Ga0307513_10000219 3300031456 Bacteria 82663
113 Ga0307408_100000136 3300031548 Bacteria 81550
114 Ga0307408_100001701 3300031548 Bacteria 16175
115 Ga0307408_100017947 3300031548 Bacteria 4745
116 Ga0307408_100488287 3300031548 Bacteria 1076
117 Ga0307408_100552142 3300031548 Bacteria 1017
118 Ga0265314_10174418 3300031711 Bacteria 1294
119 Ga0265342_10024177 3300031712 Bacteria 3837
120 Ga0307516_10283431 3300031730 Bacteria 1338
121 Ga0307405_10055178 3300031731 Bacteria 2485
122 Ga0307413_10881450 3300031824 Bacteria 759
123 Ga0307406_10000105 3300031901 Bacteria 48938
124 Ga0307406_10001165 3300031901 Bacteria 14717
125 Ga0307406_10351223 3300031901 Bacteria 1152
126 Ga0307407_10779077 3300031903 Bacteria 726
127 Ga0307412_10058667 3300031911 Bacteria 2575
128 Ga0307412_10123665 3300031911 Bacteria 1867
129 Ga0307412_10148161 3300031911 Bacteria 1728
130 Ga0307412_10978993 3300031911 Bacteria 746
131 Ga0307510_10249656 3300033180 Bacteria 1263
132 Ga0395899_0006630 3300037312 Bacteria 8974
133 Ga0395900_0022070 3300037418 Bacteria 6511
134 Ga0395900_0038139 3300037418 Bacteria 4954
135 Ga0395900_0929790 3300037418 Bacteria 792
136 Ga0395898_0053503 3300037466 Bacteria 3943
137 Ga0395898_0664010 3300037466 Bacteria 985
138 Ga0395905_0000722 3300037471 Bacteria 43605
139 Ga0395905_0051802 3300037471 Bacteria 3845
140 Ga0395905_0092232 3300037471 Bacteria 2840
141 Ga0395905_0234518 3300037471 Bacteria 1715
142 Ga0395905_0363723 3300037471 Bacteria 1339
143 Ga0395905_0760474 3300037471 Bacteria 871
144 Ga0439436_0000733 3300041404 Bacteria 8841
145 Ga0439436_0008182 3300041404 Bacteria 3213
146 Ga0439436_0027735 3300041404 Bacteria 1656
147 Ga0439439_0015624 3300041406 Bacteria 1855
148 Ga0439447_026189 3300041407 Bacteria 1496
149 Ga0439466_0006559 3300041411 Bacteria 4420
150 Ga0439466_0033761 3300041411 Bacteria 1737
151 Ga0439465_0008752 3300041413 Bacteria 3189
152 Ga0451795_0255969 3300041456 Bacteria 1198
153 Ga0451835_1156809 3300041492 Bacteria 1695
154 Ga0451853_3785689 3300041512 Bacteria 2219
155 Ga0439431_0014236 3300041997 Bacteria 1842
156 Ga0439431_0089601 3300041997 Bacteria 837
157 Ga0439433_0001515 3300041999 Bacteria 4801
158 Ga0439433_0003900 3300041999 Bacteria 3209
159 Ga0439442_023476 3300042002 Bacteria 1282
160 Ga0439445_0000443 3300042004 Bacteria 8398
161 Ga0439432_038564 3300042006 Bacteria 1521
162 Ga0439432_038725 3300042006 Bacteria 1517
163 Ga0439449_0000992 3300042007 Bacteria 11152
164 Ga0439449_0001786 3300042007 Bacteria 8465
165 Ga0439449_0014009 3300042007 Bacteria 3015
166 Ga0439449_0045492 3300042007 Bacteria 1626
167 Ga0439452_015483 3300042010 Bacteria 2091
168 Ga0439457_011451 3300042014 Bacteria 2018
169 Ga0439462_0003162 3300042015 Bacteria 3925
170 Ga0450911_005278 3300042115 Bacteria 2023
171 Ga0450897_010127 3300042128 Bacteria 901
172 Ga0450906_041686 3300042145 Bacteria 810
173 Ga0450910_034842 3300042147 Bacteria 800
174 Ga0439446_0057989 3300042156 Bacteria 1167
175 Ga0450908_006882 3300042184 Bacteria 2152
176 Ga0450909_006200 3300042185 Bacteria 1725
177 Ga0439434_0012041 3300042435 Bacteria 2557
178 Ga0439434_0015159 3300042435 Bacteria 2297
179 Ga0439434_0105591 3300042435 Bacteria 910
180 Ga0439464_0009150 3300042439 Bacteria 2603
181 Ga0450918_012621 3300042531 Bacteria 1472
182 Ga0466969_0161392 3300044656 Bacteria 1030
183 Ga0453683_0002824 3300044673 Bacteria 13192
184 Ga0466965_0018768 3300044683 Bacteria 3318
185 Ga0466965_0088121 3300044683 Bacteria 1576
186 Ga0466965_0229393 3300044683 Bacteria 991
187 Ga0466966_0001199 3300044684 Bacteria 16629
188 Ga0466966_0225804 3300044684 Bacteria 1130
189 Ga0466961_0006484 3300044693 Bacteria 7434
190 Ga0466961_0079888 3300044693 Bacteria 2071
191 Ga0466963_0338524 3300044694 Bacteria 1059
192 Ga0466968_0146374 3300044735 Bacteria 1083
193 Ga0466970_0042360 3300044765 Bacteria 2421
194 Ga0466957_0554928 3300044842 Bacteria 801
195 Ga0466957_0781660 3300044842 Bacteria 677
196 Ga0466960_0033746 3300044901 Bacteria 2380
197 Ga0466959_0014570 3300045049 Bacteria 5719
198 Ga0466959_0256805 3300045049 Bacteria 1204
199 Ga0451576_0044629 3300045051 Bacteria 4672
200 Ga0495650_0042814 3300046471 Bacteria 1926
201 Ga0495643_0208320 3300046522 Bacteria 934
202 Ga0495642_0034037 3300046528 Bacteria 2050
203 Ga0495656_0008913 3300046615 Bacteria 3599
204 Ga0495625_0196384 3300046660 Bacteria 1334
205 Ga0495659_0086792 3300046664 Bacteria 1196
206 Ga0495669_0293332 3300046684 Bacteria 783
207 Ga0495636_0082458 3300047318 Bacteria 1386
208 Ga0496109_0427793 3300048912 Bacteria 1251
209 Ga0501034_0144418 3300049571 Bacteria 2357
210 Ga0501034_0664533 3300049571 Bacteria 943
211 Ga0501036_0840730 3300049572 Bacteria 755
212 Ga0501037_0083209 3300049573 Bacteria 2318
213 Ga0501037_0633157 3300049573 Bacteria 716
214 Ga0501039_0300645 3300049575 Bacteria 1262
215 Ga0501043_0093260 3300049579 Bacteria 2367
216 Ga0501046_0491835 3300049580 Bacteria 879
217 Ga0501047_0234863 3300049581 Bacteria 1685
218 Ga0501073_0149453 3300049589 Bacteria 1619
219 Ga0501223_013322 3300049663 Bacteria 1638
220 Ga0501035_0072822 3300049822 Bacteria 3040
221 Ga0501044_0056980 3300049823 Bacteria 4011
222 Ga0501044_0334191 3300049823 Bacteria 1437
223 Ga0501044_0771485 3300049823 Bacteria 842
224 nmdc:mga03683_124611_c1 3300050489 Bacteria 1148
225 nmdc:mga03683_37575_c1 3300050489 Bacteria 1974
226 nmdc:mga03n38_117709_c1 3300050490 Bacteria 1302
227 nmdc:mga03n38_138889_c1 3300050490 Bacteria 1212
228 nmdc:mga03n38_23582_c1 3300050490 Bacteria 2505
229 nmdc:mga0k408_12335_c1 3300050493 Bacteria 4670
230 nmdc:mga0k408_201837_c1 3300050493 Bacteria 1187
231 nmdc:mga0k408_5576_c1 3300050493 Bacteria 6697
232 nmdc:mga07m45_476204_c1 3300050496 Bacteria 723
233 nmdc:mga07m45_72327_c1 3300050496 Bacteria 1962
234 Ga0500644_0004623 3300053088 Bacteria 3452
235 Ga0500651_0017595 3300053093 Bacteria 4413
236 Ga0500566_0027868 3300053094 Bacteria 3305
237 Ga0500555_040864 3300053103 Bacteria 1291
238 Ga0500593_000434 3300053117 Bacteria 16473
239 Ga0500628_002316 3300053129 Bacteria 3159
240 Ga0500604_0083327 3300053151 Bacteria 1036
241 Ga0500645_000425 3300053730 Bacteria 29203
242 Ga0500645_001616 3300053730 Bacteria 11148
243 Ga0500661_001050 3300055283 Bacteria 5209
244 Ga0590075_037795 3300059424 Bacteria 1231

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2885192300 2885194960 196
2 iso_pu_bacteria 2919704043 2919705903 196
3 3300025284 Ga0209130_1000862 Ga0209130_100086217 197
4 3300025292 Ga0209676_1000013 Ga0209676_1000013592 197
5 3300025292 Ga0209676_1000153 Ga0209676_1000153162 197
6 3300025298 Ga0209050_1000008 Ga0209050_1000008592 197
7 3300025302 Ga0207426_1000816 Ga0207426_100081620 197
8 3300025303 Ga0209051_1000005 Ga0209051_1000005592 197
9 3300025304 Ga0209257_1000031 Ga0209257_1000031182 197
10 iso_pu_bacteria 2547132374 2548500797 197
11 iso_pu_bacteria 2643221609 2644057874 197
12 iso_pu_bacteria 2643221611 2644072910 197
13 iso_pu_bacteria 2643221717 2644646651 197
14 iso_pu_bacteria 2738543012 2739242147 197
15 iso_pu_bacteria 2816332133 2816470236 197
16 3300006178 Ga0075367_10238216 Ga0075367_102382162 199
17 iso_pu_bacteria 2643221596 2643992530 199
18 3300003784 Ga0055534_1002481 Ga0055534_10024812 200
19 3300003792 Ga0055540_1003444 Ga0055540_10034443 200
20 3300003794 Ga0055531_10000574 Ga0055531_100005748 200
21 3300005338 Ga0068868_100010096 Ga0068868_1000100965 200
22 3300005468 Ga0070707_100686500 Ga0070707_1006865002 200
23 3300005548 Ga0070665_100046460 Ga0070665_1000464605 200
24 3300005549 Ga0070704_100390873 Ga0070704_1003908732 200
25 3300005563 Ga0068855_100017665 Ga0068855_1000176658 200
26 3300005614 Ga0068856_100133011 Ga0068856_1001330114 200
27 3300006038 Ga0075365_10126159 Ga0075365_101261593 200
28 3300006048 Ga0075363_100036158 Ga0075363_1000361582 200
29 3300006177 Ga0075362_10006230 Ga0075362_100062307 200
30 3300006177 Ga0075362_10110688 Ga0075362_101106883 200
31 3300006177 Ga0075362_10118394 Ga0075362_101183942 200
32 3300006178 Ga0075367_10014036 Ga0075367_100140365 200
33 3300006195 Ga0075366_10008026 Ga0075366_100080265 200
34 3300006195 Ga0075366_10011769 Ga0075366_100117695 200
35 3300006237 Ga0097621_100369459 Ga0097621_1003694593 200
36 3300006844 Ga0075428_100559736 Ga0075428_1005597361 200
37 3300009098 Ga0105245_10067598 Ga0105245_100675984 200
38 3300013296 Ga0157374_10492958 Ga0157374_104929581 200
39 3300013297 Ga0157378_10292914 Ga0157378_102929142 200
40 3300014969 Ga0157376_10014158 Ga0157376_100141586 200
41 3300025273 Ga0209673_1015619 Ga0209673_10156194 200
42 3300025284 Ga0209130_1003952 Ga0209130_10039528 200
43 3300025291 Ga0209675_1000386 Ga0209675_100038632 200
44 3300025292 Ga0209676_1010501 Ga0209676_10105013 200
45 3300025303 Ga0209051_1001437 Ga0209051_100143721 200
46 3300025303 Ga0209051_1053724 Ga0209051_10537242 200
47 3300025304 Ga0209257_1000015 Ga0209257_1000015106 200
48 3300025304 Ga0209257_1017163 Ga0209257_10171632 200
49 3300025922 Ga0207646_10508728 Ga0207646_105087282 200
50 3300025925 Ga0207650_10441233 Ga0207650_104412331 200
51 3300025937 Ga0207669_10272474 Ga0207669_102724741 200
52 3300025949 Ga0207667_11107034 Ga0207667_111070341 200
53 3300026023 Ga0207677_10001620 Ga0207677_1000162010 200
54 3300026023 Ga0207677_10049576 Ga0207677_100495762 200
55 3300026078 Ga0207702_10125441 Ga0207702_101254413 200
56 3300026116 Ga0207674_10185925 Ga0207674_101859251 200
57 3300026121 Ga0207683_10052830 Ga0207683_100528304 200
58 3300027614 Ga0209970_1001101 Ga0209970_10011014 200
59 3300027907 Ga0207428_10092993 Ga0207428_100929931 200
60 3300028379 Ga0268266_10007265 Ga0268266_100072658 200
61 3300031456 Ga0307513_10000025 Ga0307513_1000002555 200
62 3300031548 Ga0307408_100488287 Ga0307408_1004882871 200
63 3300031548 Ga0307408_100552142 Ga0307408_1005521423 200
64 3300031711 Ga0265314_10174418 Ga0265314_101744182 200
65 3300031712 Ga0265342_10024177 Ga0265342_100241771 200
66 3300031730 Ga0307516_10283431 Ga0307516_102834311 200
67 3300031731 Ga0307405_10055178 Ga0307405_100551783 200
68 3300031824 Ga0307413_10881450 Ga0307413_108814501 200
69 3300031903 Ga0307407_10779077 Ga0307407_107790771 200
70 3300031911 Ga0307412_10058667 Ga0307412_100586674 200
71 3300031911 Ga0307412_10123665 Ga0307412_101236653 200
72 3300031911 Ga0307412_10148161 Ga0307412_101481612 200
73 3300031911 Ga0307412_10978993 Ga0307412_109789931 200
74 3300033180 Ga0307510_10249656 Ga0307510_102496561 200
75 3300037312 Ga0395899_0006630 Ga0395899_0006630_4752_5354 200
76 3300037418 Ga0395900_0022070 Ga0395900_0022070_3357_3959 200
77 3300037418 Ga0395900_0038139 Ga0395900_0038139_3228_3830 200
78 3300037418 Ga0395900_0929790 Ga0395900_0929790_148_750 200
79 3300037466 Ga0395898_0053503 Ga0395898_0053503_92_694 200
80 3300037466 Ga0395898_0664010 Ga0395898_0664010_144_746 200
81 3300037471 Ga0395905_0000722 Ga0395905_0000722_24413_25015 200
82 3300037471 Ga0395905_0051802 Ga0395905_0051802_2230_2832 200
83 3300037471 Ga0395905_0092232 Ga0395905_0092232_1172_1774 200
84 3300037471 Ga0395905_0234518 Ga0395905_0234518_902_1504 200
85 3300037471 Ga0395905_0363723 Ga0395905_0363723_216_827 200
86 3300037471 Ga0395905_0760474 Ga0395905_0760474_113_715 200
87 3300041404 Ga0439436_0000733 Ga0439436_0000733_4281_4883 200
88 3300041404 Ga0439436_0008182 Ga0439436_0008182_1552_2154 200
89 3300041404 Ga0439436_0027735 Ga0439436_0027735_60_662 200
90 3300041406 Ga0439439_0015624 Ga0439439_0015624_608_1210 200
91 3300041407 Ga0439447_026189 Ga0439447_026189_743_1345 200
92 3300041411 Ga0439466_0006559 Ga0439466_0006559_2943_3545 200
93 3300041411 Ga0439466_0033761 Ga0439466_0033761_74_676 200
94 3300041413 Ga0439465_0008752 Ga0439465_0008752_1855_2457 200
95 3300041997 Ga0439431_0014236 Ga0439431_0014236_931_1533 200
96 3300041997 Ga0439431_0089601 Ga0439431_0089601_126_737 200
97 3300041999 Ga0439433_0001515 Ga0439433_0001515_3222_3824 200
98 3300041999 Ga0439433_0003900 Ga0439433_0003900_1596_2198 200
99 3300042002 Ga0439442_023476 Ga0439442_023476_122_724 200
100 3300042004 Ga0439445_0000443 Ga0439445_0000443_2019_2621 200
101 3300042006 Ga0439432_038564 Ga0439432_038564_474_1076 200
102 3300042006 Ga0439432_038725 Ga0439432_038725_464_1066 200
103 3300042007 Ga0439449_0001786 Ga0439449_0001786_5079_5681 200
104 3300042007 Ga0439449_0014009 Ga0439449_0014009_92_694 200
105 3300042007 Ga0439449_0045492 Ga0439449_0045492_14_616 200
106 3300042010 Ga0439452_015483 Ga0439452_015483_1047_1649 200
107 3300042014 Ga0439457_011451 Ga0439457_011451_804_1406 200
108 3300042128 Ga0450897_010127 Ga0450897_010127_80_682 200
109 3300042145 Ga0450906_041686 Ga0450906_041686_134_736 200
110 3300042147 Ga0450910_034842 Ga0450910_034842_10_612 200
111 3300042156 Ga0439446_0057989 Ga0439446_0057989_82_693 200
112 3300042184 Ga0450908_006882 Ga0450908_006882_911_1513 200
113 3300042435 Ga0439434_0012041 Ga0439434_0012041_1296_1907 200
114 3300042435 Ga0439434_0015159 Ga0439434_0015159_724_1326 200
115 3300042435 Ga0439434_0105591 Ga0439434_0105591_208_810 200
116 3300042439 Ga0439464_0009150 Ga0439464_0009150_651_1253 200
117 3300042531 Ga0450918_012621 Ga0450918_012621_633_1235 200
118 3300044673 Ga0453683_0002824 Ga0453683_0002824_1805_2407 200
119 3300044683 Ga0466965_0018768 Ga0466965_0018768_915_1517 200
120 3300044683 Ga0466965_0088121 Ga0466965_0088121_853_1455 200
121 3300044683 Ga0466965_0229393 Ga0466965_0229393_66_668 200
122 3300044684 Ga0466966_0001199 Ga0466966_0001199_826_1428 200
123 3300044684 Ga0466966_0225804 Ga0466966_0225804_274_876 200
124 3300044693 Ga0466961_0006484 Ga0466961_0006484_5220_5822 200
125 3300044694 Ga0466963_0338524 Ga0466963_0338524_221_823 200
126 3300044735 Ga0466968_0146374 Ga0466968_0146374_197_799 200
127 3300044765 Ga0466970_0042360 Ga0466970_0042360_29_631 200
128 3300044842 Ga0466957_0781660 Ga0466957_0781660_37_639 200
129 3300044901 Ga0466960_0033746 Ga0466960_0033746_1748_2350 200
130 3300045049 Ga0466959_0014570 Ga0466959_0014570_4171_4773 200
131 3300045049 Ga0466959_0256805 Ga0466959_0256805_223_825 200
132 3300045051 Ga0451576_0044629 Ga0451576_0044629_2276_2878 200
133 3300046471 Ga0495650_0042814 Ga0495650_0042814_673_1275 200
134 3300046522 Ga0495643_0208320 Ga0495643_0208320_157_759 200
135 3300046528 Ga0495642_0034037 Ga0495642_0034037_586_1188 200
136 3300046615 Ga0495656_0008913 Ga0495656_0008913_2734_3336 200
137 3300046660 Ga0495625_0196384 Ga0495625_0196384_332_934 200
138 3300046664 Ga0495659_0086792 Ga0495659_0086792_165_767 200
139 3300046684 Ga0495669_0293332 Ga0495669_0293332_13_615 200
140 3300047318 Ga0495636_0082458 Ga0495636_0082458_39_641 200
141 3300048912 Ga0496109_0427793 Ga0496109_0427793_524_1126 200
142 3300049571 Ga0501034_0144418 Ga0501034_0144418_469_1071 200
143 3300049571 Ga0501034_0664533 Ga0501034_0664533_80_682 200
144 3300049572 Ga0501036_0840730 Ga0501036_0840730_88_690 200
145 3300049573 Ga0501037_0083209 Ga0501037_0083209_259_861 200
146 3300049573 Ga0501037_0633157 Ga0501037_0633157_91_693 200
147 3300049575 Ga0501039_0300645 Ga0501039_0300645_357_1022 200
148 3300049579 Ga0501043_0093260 Ga0501043_0093260_1367_1969 200
149 3300049580 Ga0501046_0491835 Ga0501046_0491835_247_849 200
150 3300049581 Ga0501047_0234863 Ga0501047_0234863_702_1304 200
151 3300049589 Ga0501073_0149453 Ga0501073_0149453_949_1551 200
152 3300049822 Ga0501035_0072822 Ga0501035_0072822_1857_2459 200
153 3300049823 Ga0501044_0056980 Ga0501044_0056980_2315_2917 200
154 3300049823 Ga0501044_0334191 Ga0501044_0334191_741_1406 200
155 3300049823 Ga0501044_0771485 Ga0501044_0771485_58_660 200
156 3300050489 nmdc:mga03683_124611_c1 nmdc:mga03683_124611_c1_490_1092 200
157 3300050489 nmdc:mga03683_37575_c1 nmdc:mga03683_37575_c1_1361_1963 200
158 3300050490 nmdc:mga03n38_117709_c1 nmdc:mga03n38_117709_c1_647_1249 200
159 3300050490 nmdc:mga03n38_138889_c1 nmdc:mga03n38_138889_c1_251_853 200
160 3300050490 nmdc:mga03n38_23582_c1 nmdc:mga03n38_23582_c1_1293_1895 200
161 3300050493 nmdc:mga0k408_12335_c1 nmdc:mga0k408_12335_c1_1737_2339 200
162 3300050493 nmdc:mga0k408_5576_c1 nmdc:mga0k408_5576_c1_1860_2462 200
163 3300050496 nmdc:mga07m45_476204_c1 nmdc:mga07m45_476204_c1_11_613 200
164 3300053093 Ga0500651_0017595 Ga0500651_0017595_2164_2766 200
165 3300027876 Ga0209974_10023257 Ga0209974_100232572 201
166 3300031548 Ga0307408_100000136 Ga0307408_10000013635 201
167 3300031548 Ga0307408_100017947 Ga0307408_1000179475 201
168 3300031901 Ga0307406_10000105 Ga0307406_1000010517 201
169 3300042007 Ga0439449_0000992 Ga0439449_0000992_9313_9918 201
170 3300042015 Ga0439462_0003162 Ga0439462_0003162_371_976 201
171 3300042115 Ga0450911_005278 Ga0450911_005278_1198_1803 201
172 3300042185 Ga0450909_006200 Ga0450909_006200_843_1448 201
173 3300044656 Ga0466969_0161392 Ga0466969_0161392_219_824 201
174 3300044693 Ga0466961_0079888 Ga0466961_0079888_243_848 201
175 3300044842 Ga0466957_0554928 Ga0466957_0554928_97_702 201
176 3300049663 Ga0501223_013322 Ga0501223_013322_79_684 201
177 3300059424 Ga0590075_037795 Ga0590075_037795_262_867 201
178 iso_pu_bacteria 2511231002 2511246567 202
179 3300014497 Ga0182008_10032584 Ga0182008_100325844 203
180 3300002704 JGI25155J39150_1000009 JGI25155J39150_100000956 206
181 3300002705 JGI25156J39149_1000009 JGI25156J39149_1000009164 206
182 3300002738 JGI25154J39366_1000024 JGI25154J39366_1000024164 206
183 3300002741 JGI25157J39369_1000007 JGI25157J39369_1000007164 206
184 3300002774 JGI25150J39212_1003404 JGI25150J39212_10034043 206
185 3300002987 JGI25159J45721_1000551 JGI25159J45721_100055113 206
186 3300003187 JGI25151J46595_10025157 JGI25151J46595_100251572 206
187 3300003187 JGI25151J46595_10044453 JGI25151J46595_100444532 206
188 3300003187 JGI25151J46595_10061482 JGI25151J46595_100614822 206
189 3300003354 JGI25160J50197_1000131 JGI25160J50197_100013113 206
190 3300003374 JGI25161J50226_1000009 JGI25161J50226_100000959 206
191 3300003773 Ga0055537_1000020 Ga0055537_100002098 206
192 3300003775 Ga0055524_1000047 Ga0055524_1000047127 206
193 3300003781 Ga0055536_1004516 Ga0055536_10045166 206
194 3300003781 Ga0055536_1013175 Ga0055536_10131752 206
195 3300003781 Ga0055536_1017959 Ga0055536_10179592 206
196 3300003784 Ga0055534_1001450 Ga0055534_10014503 206
197 3300003791 Ga0055530_10001499 Ga0055530_100014992 206
198 3300003791 Ga0055530_10016980 Ga0055530_100169802 206
199 3300003792 Ga0055540_1000027 Ga0055540_100002717 206
200 3300003794 Ga0055531_10004610 Ga0055531_100046104 206
201 3300004625 Ga0055543_1001166 Ga0055543_10011669 206
202 3300005262 Ga0065165_1005570 Ga0065165_10055705 206
203 3300005262 Ga0065165_1006749 Ga0065165_10067495 206
204 3300006048 Ga0075363_100058138 Ga0075363_1000581383 206
205 3300006051 Ga0075364_10026467 Ga0075364_100264673 206
206 3300006177 Ga0075362_10114995 Ga0075362_101149952 206
207 3300012513 Ga0157326_1012961 Ga0157326_10129612 206
208 3300025206 Ga0209435_100008 Ga0209435_10000870 206
209 3300025208 Ga0209436_112402 Ga0209436_1124022 206
210 3300025245 Ga0207425_1005006 Ga0207425_10050063 206
211 3300025245 Ga0207425_1008513 Ga0207425_10085133 206
212 3300025246 Ga0209646_1000029 Ga0209646_1000029208 206
213 3300025250 Ga0209026_1000016 Ga0209026_1000016208 206
214 3300025256 Ga0209759_1000016 Ga0209759_1000016208 206
215 3300025263 Ga0209565_1000061 Ga0209565_1000061128 206
216 3300025263 Ga0209565_1004036 Ga0209565_10040361 206
217 3300025273 Ga0209673_1000298 Ga0209673_100029868 206
218 3300025284 Ga0209130_1000014 Ga0209130_1000014167 206
219 3300025291 Ga0209675_1000105 Ga0209675_100010598 206
220 3300025291 Ga0209675_1017383 Ga0209675_10173832 206
221 3300025292 Ga0209676_1003978 Ga0209676_10039784 206
222 3300025292 Ga0209676_1014023 Ga0209676_10140232 206
223 3300025294 Ga0209025_1001613 Ga0209025_100161311 206
224 3300025294 Ga0209025_1004966 Ga0209025_10049663 206
225 3300025294 Ga0209025_1016644 Ga0209025_10166444 206
226 3300025295 Ga0209564_1000181 Ga0209564_1000181104 206
227 3300025295 Ga0209564_1000247 Ga0209564_100024735 206
228 3300025295 Ga0209564_1010445 Ga0209564_10104452 206
229 3300025297 Ga0209758_1006772 Ga0209758_10067726 206
230 3300025298 Ga0209050_1002631 Ga0209050_100263112 206
231 3300025298 Ga0209050_1041741 Ga0209050_10417411 206
232 3300025299 Ga0209256_1000039 Ga0209256_1000039191 206
233 3300025299 Ga0209256_1036822 Ga0209256_10368223 206
234 3300025302 Ga0207426_1000242 Ga0207426_100024254 206
235 3300025304 Ga0209257_1003093 Ga0209257_10030934 206
236 3300025304 Ga0209257_1031329 Ga0209257_10313293 206
237 3300031456 Ga0307513_10000219 Ga0307513_1000021977 206
238 3300031548 Ga0307408_100001701 Ga0307408_10000170113 206
239 3300031901 Ga0307406_10001165 Ga0307406_1000116510 206
240 3300031901 Ga0307406_10351223 Ga0307406_103512232 206
241 3300041456 Ga0451795_0255969 Ga0451795_0255969_190_810 206
242 3300041492 Ga0451835_1156809 Ga0451835_1156809_137_757 206
243 3300041512 Ga0451853_3785689 Ga0451853_3785689_1062_1682 206
244 3300050493 nmdc:mga0k408_201837_c1 nmdc:mga0k408_201837_c1_49_669 206
245 3300050496 nmdc:mga07m45_72327_c1 nmdc:mga07m45_72327_c1_862_1482 206
246 3300053088 Ga0500644_0004623 Ga0500644_0004623_1178_1798 206
247 3300053094 Ga0500566_0027868 Ga0500566_0027868_1341_1961 206
248 3300053103 Ga0500555_040864 Ga0500555_040864_227_847 206
249 3300053117 Ga0500593_000434 Ga0500593_000434_6946_7566 206
250 3300053129 Ga0500628_002316 Ga0500628_002316_2448_3068 206
251 3300053151 Ga0500604_0083327 Ga0500604_0083327_121_741 206
252 3300053730 Ga0500645_000425 Ga0500645_000425_20923_21543 206
253 3300053730 Ga0500645_001616 Ga0500645_001616_7252_7872 206
254 3300055283 Ga0500661_001050 Ga0500661_001050_1546_2166 206

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16925

TetR_C_13

Tetracyclin repressor-like, C-terminal domain

108

216

0.98

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

40

86

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hyj-assembly1.cif.gz_A-2 the crystal structure of a tetr-family transcriptional regulator from streptomyces coelicolor 0.951 7 200
2hyj-assembly1.cif.gz_A-2 the crystal structure of a tetr-family transcriptional regulator from streptomyces coelicolor 0.942 7 200
3qbm-assembly1.cif.gz_B crystal structure of a tetr transcriptional regulator (caur_2221) from chloroflexus aurantiacus j-10-fl at 1.80 a resolution 0.8776 6 199
3g7r-assembly1.cif.gz_A crystal structure of sco4454, a tetr-family transcriptional regulator from streptomyces coelicolor 0.8764 12 204
2g7s-assembly1.cif.gz_A-2 the crystal structure of transcriptional regulator, tetr family, from agrobacterium tumefaciens 0.8587 8 200
ID Description Score Start End Superfamily
2y31B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9528 12 64 1.10.10.60
2y2zA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9528 12 64 1.10.10.60
2y30B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9379 15 64 1.10.10.60
2hyjA02 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;Tetracycline Repressor, domain 2 0.9346 52 200 1.10.357.10
2y31A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9345 12 64 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A7V8GB45-F1-model_v4 HTH tetR-type domain-containing protein 0.9949 1 200 GO:0003677
GO:0006355
AF-A0A4Q3N5V3-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9944 1 200 GO:0003677
GO:0006355
AF-A0A0Q7LS20-F1-model_v4 TetR family transcriptional regulator 0.9941 1 200 GO:0003677
GO:0006355
AF-A0A0Q5ZHF9-F1-model_v4 TetR family transcriptional regulator 0.9938 1 200 GO:0003677
GO:0006355
AF-A0A542RZF9-F1-model_v4 deleted 0.9917 1 201

Feature Viewer

pLDDT pTM Quality
92.93 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map