F364550

General Info

Members Datasets Scaffolds Average Seq Length
254 146 248 82

Family's Representative Sequence

Representative Sequence 3300003214|JGI25165J46597_1011795|JGI25165J46597_10117952
Length 94
Sequence MKISDIIASIGVIILLIAFLLNLYKKLSANSRPYCFMNFLGAGLCCYSSYLISFYPFVVLEAIWASFAIVSFFKVPRGTQEDDKKDVPRGTSAE

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
3 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
4 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
5 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
6 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
7 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
8 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
9 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
10 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
11 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
12 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
15 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
16 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
17 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
18 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
32 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
33 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
41 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
50 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
51 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
52 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
54 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
77 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
78 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
79 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
80 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
81 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
82 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
83 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
84 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
85 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
86 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
87 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
88 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
89 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
90 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
91 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
92 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
93 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
94 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
95 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
96 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
97 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
98 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
99 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
100 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
101 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
102 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
103 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
104 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
105 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
106 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
107 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
108 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
109 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
110 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
111 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
112 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
113 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
114 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
115 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
116 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
117 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
118 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
119 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
120 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
121 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
122 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
123 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
124 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
125 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
126 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
127 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
128 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
129 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
130 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
131 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
132 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
133 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
134 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
135 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
136 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
137 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
138 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
139 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
140 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
141 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
142 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
143 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
144 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
145 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
146 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.24
Metatranscriptomes 0
Isolates 2.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.81
Nodule 0
Rhizoplane 1.18
Rhizosphere 78.74
Stem 0
Stem Tuber 0
Unclassified 8.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10007632 3300001979 Bacteria 4381
2 JGI24739J22299_10179345 3300001989 Bacteria 623
3 JGI24737J22298_10000017 3300001990 Bacteria 46988
4 JGI24735J21928_10000024 3300002067 Bacteria 95227
5 JGI25157J39369_1006591 3300002741 Bacteria 1750
6 JGI25165J46597_1011795 3300003214 Bacteria 1239
7 rootH1_10174641 3300003316 Bacteria 2845
8 rootH2_10000579 3300003320 Bacteria 178428
9 rootL2_10004122 3300003322 Bacteria 5530
10 rootL2_10083352 3300003322 Bacteria 10639
11 rootH1_10007203 3300003323 Bacteria 15899
12 rootH1_10028466 3300003316 Bacteria 8480
13 rootH1_10028466 3300003323 Bacteria 1398
14 Ga0065714_10270683 3300005288 Unclassified 722
15 Ga0065714_10520355 3300005288 Bacteria 513
16 Ga0070658_10328781 3300005327 Bacteria 1306
17 Ga0070658_10594113 3300005327 Bacteria 959
18 Ga0070660_100019609 3300005339 Bacteria 4959
19 Ga0070673_100017902 3300005364 Bacteria 5049
20 Ga0070673_100554429 3300005364 Bacteria 1044
21 Ga0070673_101014983 3300005364 Bacteria 773
22 Ga0070659_100265844 3300005366 Bacteria 1424
23 Ga0070663_100020353 3300005455 Bacteria 4392
24 Ga0070662_100000374 3300005457 Bacteria 26690
25 Ga0070679_100171105 3300005530 Bacteria 2145
26 Ga0068853_100181072 3300005539 Bacteria 1911
27 Ga0068853_102475061 3300005539 Bacteria 503
28 Ga0068855_100060890 3300005563 Bacteria 4412
29 Ga0068855_100117189 3300005563 Bacteria 3052
30 Ga0068855_100158651 3300005563 Bacteria 2569
31 Ga0068855_100238656 3300005563 Bacteria 2032
32 Ga0068857_100751942 3300005577 Bacteria 929
33 Ga0068854_100089129 3300005578 Bacteria 2292
34 Ga0068852_100851382 3300005616 Bacteria 927
35 Ga0075369_10426716 3300006186 Bacteria 626
36 Ga0075366_10008691 3300006195 Bacteria 5655
37 Ga0075366_10010110 3300006195 Bacteria 5290
38 Ga0075366_10074389 3300006195 Bacteria 2026
39 Ga0075366_10447247 3300006195 Bacteria 797
40 Ga0075370_10053200 3300006353 Bacteria 2298
41 Ga0105240_10000083 3300009093 Bacteria 192934
42 Ga0105240_10013206 3300009093 Bacteria 11364
43 Ga0105240_10455221 3300009093 Bacteria 1431
44 Ga0105240_10494576 3300009093 Bacteria 1361
45 Ga0105240_10565979 3300009093 Bacteria 1255
46 Ga0105240_12522342 3300009093 Bacteria 531
47 Ga0105240_12764598 3300009093 Bacteria 505
48 Ga0105245_10963928 3300009098 Bacteria 896
49 Ga0105245_11999689 3300009098 Bacteria 633
50 Ga0105241_10014903 3300009174 Bacteria 5690
51 Ga0105241_10156523 3300009174 Bacteria 1869
52 Ga0105241_10525332 3300009174 Bacteria 1059
53 Ga0105237_10000138 3300009545 Bacteria 102411
54 Ga0105237_10002767 3300009545 Bacteria 21321
55 Ga0105237_10189764 3300009545 Bacteria 2055
56 Ga0105237_11479807 3300009545 Bacteria 686
57 Ga0105237_12694408 3300009545 Bacteria 508
58 Ga0105238_10075634 3300009551 Bacteria 3359
59 Ga0105239_10000014 3300010375 Bacteria 325391
60 Ga0105239_10000161 3300010375 Bacteria 97242
61 Ga0105239_10007896 3300010375 Bacteria 12163
62 Ga0105239_10288207 3300010375 Bacteria 1849
63 Ga0105239_10289013 3300010375 Bacteria 1846
64 Ga0105239_11463453 3300010375 Bacteria 789
65 Ga0105239_11731717 3300010375 Bacteria 724
66 Ga0105239_13253492 3300010375 Bacteria 529
67 Ga0157373_10066385 3300013100 Bacteria 2553
68 Ga0157371_10002147 3300013102 Bacteria 19224
69 Ga0157371_10021272 3300013102 Bacteria 4764
70 Ga0157371_10292122 3300013102 Bacteria 1179
71 Ga0157370_10024832 3300013104 Bacteria 5935
72 Ga0157370_10319964 3300013104 Bacteria 1431
73 Ga0157370_11463626 3300013104 Bacteria 614
74 Ga0157369_10003611 3300013105 Bacteria 18378
75 Ga0157369_10087982 3300013105 Bacteria 3316
76 Ga0157369_11431406 3300013105 Bacteria 703
77 Ga0157374_10000122 3300013296 Bacteria 70398
78 Ga0157374_10003748 3300013296 Bacteria 12773
79 Ga0157374_11859481 3300013296 Unclassified 628
80 Ga0157378_10286226 3300013297 Bacteria 1590
81 Ga0163162_10000071 3300013306 Bacteria 94831
82 Ga0163162_10013031 3300013306 Bacteria 8115
83 Ga0163162_10085668 3300013306 Bacteria 3228
84 Ga0163162_10576898 3300013306 Bacteria 1252
85 Ga0163162_11910318 3300013306 Bacteria 680
86 Ga0157372_10000037 3300013307 Bacteria 172444
87 Ga0157372_10016883 3300013307 Bacteria 7836
88 Ga0157372_10086778 3300013307 Bacteria 3550
89 Ga0157372_10986201 3300013307 Bacteria 976
90 Ga0157375_10034268 3300013308 Bacteria 4836
91 Ga0157375_11388321 3300013308 Bacteria 827
92 Ga0157377_10000731 3300014745 Bacteria 13552
93 Ga0163161_10426740 3300017792 Bacteria 1068
94 Ga0209437_100124 3300025233 Bacteria 199789
95 Ga0209258_121135 3300025242 Bacteria 675
96 Ga0209026_1000881 3300025250 Bacteria 15631
97 Ga0209026_1009891 3300025250 Bacteria 1826
98 Ga0209148_1018938 3300025254 Bacteria 1149
99 Ga0207647_10000146 3300025904 Bacteria 56177
100 Ga0207647_10069055 3300025904 Bacteria 2137
101 Ga0207647_10491220 3300025904 Bacteria 685
102 Ga0207705_10288164 3300025909 Bacteria 1258
103 Ga0207654_10029874 3300025911 Bacteria 2988
104 Ga0207654_10667845 3300025911 Bacteria 745
105 Ga0207695_10003909 3300025913 Bacteria 20614
106 Ga0207695_10116187 3300025913 Bacteria 2650
107 Ga0207695_10323813 3300025913 Bacteria 1431
108 Ga0207695_10627009 3300025913 Bacteria 956
109 Ga0207695_11079680 3300025913 Bacteria 682
110 Ga0207695_11280669 3300025913 Bacteria 613
111 Ga0207671_10000635 3300025914 Bacteria 45980
112 Ga0207671_10000979 3300025914 Bacteria 35379
113 Ga0207671_10287178 3300025914 Bacteria 1298
114 Ga0207671_10293705 3300025914 Bacteria 1283
115 Ga0207671_10814929 3300025914 Bacteria 740
116 Ga0207657_10012630 3300025919 Bacteria 8324
117 Ga0207652_10142385 3300025921 Bacteria 2145
118 Ga0207694_10052463 3300025924 Bacteria 3161
119 Ga0207687_10532750 3300025927 Bacteria 983
120 Ga0207687_10649488 3300025927 Bacteria 892
121 Ga0207644_10083695 3300025931 Bacteria 2363
122 Ga0207706_10000007 3300025933 Bacteria 211081
123 Ga0207709_10253095 3300025935 Bacteria 1287
124 Ga0207661_12160793 3300025944 Bacteria 503
125 Ga0207667_10020056 3300025949 Bacteria 7443
126 Ga0207667_10064048 3300025949 Bacteria 3840
127 Ga0207667_10549878 3300025949 Bacteria 1168
128 Ga0207667_11783222 3300025949 Bacteria 580
129 Ga0207651_11694763 3300025960 Bacteria 569
130 Ga0207640_10085885 3300025981 Bacteria 2165
131 Ga0207639_10289944 3300026041 Bacteria 1443
132 Ga0207678_10285235 3300026067 Bacteria 1418
133 Ga0207702_10141987 3300026078 Bacteria 2174
134 Ga0207674_10426733 3300026116 Bacteria 1281
135 Ga0207698_11040195 3300026142 Bacteria 830
136 Ga0307517_10000335 3300028786 Bacteria 81908
137 Ga0307515_10000528 3300028794 Bacteria 90438
138 Ga0307515_10003943 3300028794 Bacteria 30968
139 Ga0307515_10179843 3300028794 Bacteria 2070
140 Ga0307414_10052103 3300032004 Bacteria 2846
141 Ga0307414_10063673 3300032004 Bacteria 2622
142 Ga0307414_10578176 3300032004 Bacteria 1005
143 Ga0307411_10319358 3300032005 Bacteria 1253
144 Ga0307507_10001000 3300033179 Bacteria 62890
145 Ga0307510_10034837 3300033180 Bacteria 5628
146 Ga0395899_0000152 3300037312 Bacteria 105233
147 Ga0395899_0001541 3300037312 Bacteria 19451
148 Ga0395899_0022125 3300037312 Bacteria 4821
149 Ga0395900_0000288 3300037418 Bacteria 75715
150 Ga0395900_0048652 3300037418 Bacteria 4368
151 Ga0395898_0097397 3300037466 Bacteria 2825
152 Ga0395898_0864804 3300037466 Bacteria 843
153 Ga0395905_0000411 3300037471 Bacteria 60254
154 Ga0395905_0143258 3300037471 Bacteria 2248
155 Ga0395901_0020522 3300038443 Bacteria 6763
156 Ga0395901_0074376 3300038443 Bacteria 3544
157 Ga0451787_300023 3300041441 Bacteria 647
158 Ga0451793_0483236 3300041452 Bacteria 1042
159 Ga0451833_0813482 3300041491 Bacteria 1043
160 Ga0451833_1092879 3300041491 Bacteria 535
161 Ga0451839_0202085 3300041496 Bacteria 567
162 Ga0439445_0244391 3300042004 Bacteria 535
163 Ga0439448_0065335 3300042005 Bacteria 1206
164 Ga0439455_0059747 3300042012 Bacteria 1009
165 Ga0466982_0236371 3300044672 Unclassified 1076
166 Ga0466966_0031871 3300044684 Bacteria 3418
167 Ga0466961_0037993 3300044693 Bacteria 3089
168 Ga0466971_0238420 3300044719 Bacteria 865
169 Ga0466959_0029921 3300045049 Bacteria 4033
170 Ga0466958_0030403 3300045836 Bacteria 3208
171 Ga0495627_199722 3300046453 Bacteria 551
172 Ga0495629_0669353 3300046459 Bacteria 691
173 Ga0495641_0563766 3300046461 Unclassified 520
174 Ga0495651_0261138 3300046462 Bacteria 1178
175 Ga0495651_0703413 3300046462 Bacteria 630
176 Ga0495650_0000095 3300046471 Bacteria 218020
177 Ga0495650_0200278 3300046471 Bacteria 694
178 Ga0495585_0000034 3300046492 Bacteria 143120
179 Ga0495585_0000313 3300046492 Bacteria 48193
180 Ga0495596_0019260 3300046500 Bacteria 2806
181 Ga0495583_0006806 3300046506 Bacteria 7383
182 Ga0495606_0000009 3300046507 Bacteria 306313
183 Ga0495606_0040465 3300046507 Bacteria 3133
184 Ga0495606_0067445 3300046507 Bacteria 2265
185 Ga0495606_0146691 3300046507 Bacteria 1388
186 Ga0495606_0321621 3300046507 Bacteria 831
187 Ga0495606_0580951 3300046507 Bacteria 553
188 Ga0495610_0014539 3300046512 Bacteria 4619
189 Ga0495616_0019585 3300046513 Bacteria 3691
190 Ga0495616_0108959 3300046513 Bacteria 1288
191 Ga0495631_0012686 3300046518 Bacteria 4110
192 Ga0495637_0051534 3300046520 Bacteria 1722
193 Ga0495637_0106457 3300046520 Bacteria 1091
194 Ga0495648_0019226 3300046524 Bacteria 4811
195 Ga0495648_0072937 3300046524 Bacteria 1984
196 Ga0495652_0105080 3300046529 Bacteria 2283
197 Ga0495609_0037689 3300046538 Bacteria 2181
198 Ga0495633_0000074 3300046558 Bacteria 130197
199 Ga0495633_0021566 3300046558 Bacteria 3220
200 Ga0495668_0000017 3300046616 Bacteria 434025
201 Ga0495625_0000007 3300046660 Bacteria 565749
202 Ga0495625_0000679 3300046660 Bacteria 48394
203 Ga0495625_0006979 3300046660 Bacteria 9959
204 Ga0495625_0059893 3300046660 Bacteria 2700
205 Ga0495625_0223500 3300046660 Bacteria 1232
206 Ga0495625_0627171 3300046660 Bacteria 642
207 Ga0495661_0001074 3300046665 Bacteria 24060
208 Ga0495661_0015307 3300046665 Bacteria 5121
209 Ga0495661_0019656 3300046665 Bacteria 4422
210 Ga0495661_0048950 3300046665 Bacteria 2566
211 Ga0495671_0217290 3300046692 Bacteria 926
212 Ga0495649_0000007 3300046694 Bacteria 518037
213 Ga0495589_0098253 3300046794 Bacteria 1418
214 Ga0495600_0177962 3300046809 Bacteria 1371
215 Ga0495660_0003408 3300046810 Bacteria 9840
216 Ga0495683_0043231 3300047323 Bacteria 2270
217 Ga0495683_0359487 3300047323 Bacteria 613
218 Ga0495687_000713 3300047443 Bacteria 36805
219 Ga0495687_064440 3300047443 Bacteria 1496
220 Ga0495679_198189 3300047446 Bacteria 528
221 Ga0495681_0270826 3300047470 Bacteria 665
222 Ga0495686_0000614 3300047472 Bacteria 49242
223 Ga0495686_0001530 3300047472 Bacteria 24840
224 Ga0495686_0063077 3300047472 Bacteria 2297
225 Ga0495686_0142211 3300047472 Bacteria 1415
226 Ga0495682_0043682 3300049460 Bacteria 1641
227 Ga0501238_053308 3300049671 Bacteria 609
228 Ga0501035_1412862 3300049822 Bacteria 533
229 nmdc:mga0k408_183703_c1 3300050493 Bacteria 1247
230 nmdc:mga0k408_50_c1 3300050493 Bacteria 59317
231 nmdc:mga0k408_8022_c1 3300050493 Bacteria 5660
232 nmdc:mga0k408_98019_c1 3300050493 Bacteria 1727
233 nmdc:mga07m45_662237_c1 3300050496 Bacteria 601
234 nmdc:mga0sz30_352572_c1 3300050516 Bacteria 658
235 Ga0500635_0015989 3300053080 Bacteria 2224
236 Ga0500650_0395019 3300053098 Bacteria 599
237 Ga0500608_029615 3300053122 Bacteria 2590
238 Ga0500618_000011 3300053125 Bacteria 198091
239 Ga0500618_015439 3300053125 Bacteria 1930
240 Ga0500652_094586 3300053131 Bacteria 1248
241 Ga0500652_282679 3300053131 Bacteria 647
242 Ga0500564_127102 3300053138 Bacteria 1106
243 Ga0500573_0379755 3300053140 Bacteria 676
244 Ga0500579_172116 3300053143 Bacteria 878
245 Ga0500616_0098591 3300053153 Bacteria 1433
246 Ga0500622_0002680 3300053156 Bacteria 12622
247 Ga0500622_0130589 3300053156 Bacteria 1208
248 Ga0500624_000349 3300053157 Bacteria 15065

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003322 rootL2_10083352 rootL2_100833525 77
2 3300003323 rootH1_10007203 rootH1_100072039 77
3 3300044672 Ga0466982_0236371 Ga0466982_0236371_10_243 77
4 iso_pu_bacteria 2599185184 2599480810 77
5 iso_pu_bacteria 2852623160 2852626568 77
6 iso_pu_bacteria 2884933994 2884934997 77
7 iso_pu_bacteria 2919437846 2919439695 77
8 iso_pu_bacteria 2928078545 2928081706 77
9 iso_pu_bacteria 2928147474 2928150265 77
10 iso_pu_bacteria 2932082852 2932085091 77
11 3300005327 Ga0070658_10594113 Ga0070658_105941132 79
12 3300009093 Ga0105240_12764598 Ga0105240_127645982 79
13 3300009174 Ga0105241_10156523 Ga0105241_101565232 79
14 3300025913 Ga0207695_10116187 Ga0207695_101161872 79
15 3300041452 Ga0451793_0483236 Ga0451793_0483236_259_498 79
16 3300041491 Ga0451833_0813482 Ga0451833_0813482_99_338 79
17 3300046459 Ga0495629_0669353 Ga0495629_0669353_70_309 79
18 3300046461 Ga0495641_0563766 Ga0495641_0563766_255_494 79
19 3300046492 Ga0495585_0000313 Ga0495585_0000313_25238_25477 79
20 3300046524 Ga0495648_0019226 Ga0495648_0019226_1286_1525 79
21 3300046524 Ga0495648_0072937 Ga0495648_0072937_1399_1638 79
22 3300046660 Ga0495625_0000679 Ga0495625_0000679_23461_23700 79
23 3300046809 Ga0495600_0177962 Ga0495600_0177962_234_473 79
24 3300049460 Ga0495682_0043682 Ga0495682_0043682_340_579 79
25 3300053122 Ga0500608_029615 Ga0500608_029615_1450_1689 79
26 3300003323 rootH1_10028466 rootH1_100284662 80
27 3300013104 Ga0157370_10024832 Ga0157370_100248326 80
28 3300001990 JGI24737J22298_10000017 JGI24737J22298_1000001721 81
29 3300002067 JGI24735J21928_10000024 JGI24735J21928_1000002462 81
30 3300003322 rootL2_10004122 rootL2_100041225 81
31 3300005288 Ga0065714_10520355 Ga0065714_105203551 81
32 3300005539 Ga0068853_100181072 Ga0068853_1001810722 81
33 3300005563 Ga0068855_100117189 Ga0068855_1001171892 81
34 3300005563 Ga0068855_100158651 Ga0068855_1001586512 81
35 3300005577 Ga0068857_100751942 Ga0068857_1007519422 81
36 3300005578 Ga0068854_100089129 Ga0068854_1000891292 81
37 3300006186 Ga0075369_10426716 Ga0075369_104267162 81
38 3300006195 Ga0075366_10010110 Ga0075366_100101105 81
39 3300006195 Ga0075366_10074389 Ga0075366_100743892 81
40 3300006353 Ga0075370_10053200 Ga0075370_100532002 81
41 3300009093 Ga0105240_12522342 Ga0105240_125223421 81
42 3300010375 Ga0105239_10000161 Ga0105239_1000016146 81
43 3300010375 Ga0105239_10288207 Ga0105239_102882072 81
44 3300010375 Ga0105239_10289013 Ga0105239_102890132 81
45 3300010375 Ga0105239_11463453 Ga0105239_114634532 81
46 3300013102 Ga0157371_10021272 Ga0157371_100212723 81
47 3300013102 Ga0157371_10292122 Ga0157371_102921222 81
48 3300013104 Ga0157370_11463626 Ga0157370_114636262 81
49 3300013105 Ga0157369_10087982 Ga0157369_100879821 81
50 3300013105 Ga0157369_11431406 Ga0157369_114314062 81
51 3300013306 Ga0163162_10013031 Ga0163162_100130314 81
52 3300013306 Ga0163162_10576898 Ga0163162_105768982 81
53 3300013306 Ga0163162_11910318 Ga0163162_119103182 81
54 3300013307 Ga0157372_10016883 Ga0157372_100168836 81
55 3300017792 Ga0163161_10426740 Ga0163161_104267402 81
56 3300025233 Ga0209437_100124 Ga0209437_100124128 81
57 3300025242 Ga0209258_121135 Ga0209258_1211351 81
58 3300025904 Ga0207647_10069055 Ga0207647_100690552 81
59 3300025914 Ga0207671_10814929 Ga0207671_108149292 81
60 3300025949 Ga0207667_10020056 Ga0207667_100200564 81
61 3300025949 Ga0207667_10549878 Ga0207667_105498782 81
62 3300025981 Ga0207640_10085885 Ga0207640_100858852 81
63 3300026041 Ga0207639_10289944 Ga0207639_102899441 81
64 3300026116 Ga0207674_10426733 Ga0207674_104267332 81
65 3300028794 Ga0307515_10000528 Ga0307515_100005288 81
66 3300028794 Ga0307515_10003943 Ga0307515_1000394320 81
67 3300032004 Ga0307414_10578176 Ga0307414_105781762 81
68 3300033179 Ga0307507_10001000 Ga0307507_1000100021 81
69 3300041441 Ga0451787_300023 Ga0451787_300023_72_317 81
70 3300041491 Ga0451833_1092879 Ga0451833_1092879_243_488 81
71 3300041496 Ga0451839_0202085 Ga0451839_0202085_79_324 81
72 3300042004 Ga0439445_0244391 Ga0439445_0244391_68_313 81
73 3300046453 Ga0495627_199722 Ga0495627_199722_239_484 81
74 3300046462 Ga0495651_0261138 Ga0495651_0261138_86_331 81
75 3300046471 Ga0495650_0000095 Ga0495650_0000095_177695_177940 81
76 3300046471 Ga0495650_0200278 Ga0495650_0200278_72_317 81
77 3300046492 Ga0495585_0000034 Ga0495585_0000034_24536_24781 81
78 3300046506 Ga0495583_0006806 Ga0495583_0006806_4253_4498 81
79 3300046507 Ga0495606_0000009 Ga0495606_0000009_73297_73542 81
80 3300046507 Ga0495606_0040465 Ga0495606_0040465_163_408 81
81 3300046507 Ga0495606_0067445 Ga0495606_0067445_1544_1789 81
82 3300046507 Ga0495606_0146691 Ga0495606_0146691_580_825 81
83 3300046507 Ga0495606_0321621 Ga0495606_0321621_469_714 81
84 3300046507 Ga0495606_0580951 Ga0495606_0580951_134_379 81
85 3300046512 Ga0495610_0014539 Ga0495610_0014539_3601_3846 81
86 3300046513 Ga0495616_0019585 Ga0495616_0019585_3388_3633 81
87 3300046513 Ga0495616_0108959 Ga0495616_0108959_796_1041 81
88 3300046520 Ga0495637_0051534 Ga0495637_0051534_412_657 81
89 3300046520 Ga0495637_0106457 Ga0495637_0106457_62_307 81
90 3300046529 Ga0495652_0105080 Ga0495652_0105080_1386_1631 81
91 3300046538 Ga0495609_0037689 Ga0495609_0037689_1867_2112 81
92 3300046558 Ga0495633_0000074 Ga0495633_0000074_11148_11393 81
93 3300046558 Ga0495633_0021566 Ga0495633_0021566_1024_1269 81
94 3300046616 Ga0495668_0000017 Ga0495668_0000017_328308_328553 81
95 3300046660 Ga0495625_0000007 Ga0495625_0000007_259903_260148 81
96 3300046660 Ga0495625_0006979 Ga0495625_0006979_1876_2121 81
97 3300046660 Ga0495625_0059893 Ga0495625_0059893_559_804 81
98 3300046660 Ga0495625_0223500 Ga0495625_0223500_307_552 81
99 3300046660 Ga0495625_0627171 Ga0495625_0627171_307_552 81
100 3300046665 Ga0495661_0001074 Ga0495661_0001074_19217_19462 81
101 3300046665 Ga0495661_0015307 Ga0495661_0015307_3045_3290 81
102 3300046665 Ga0495661_0019656 Ga0495661_0019656_812_1057 81
103 3300046665 Ga0495661_0048950 Ga0495661_0048950_58_303 81
104 3300046692 Ga0495671_0217290 Ga0495671_0217290_92_337 81
105 3300046694 Ga0495649_0000007 Ga0495649_0000007_192206_192451 81
106 3300046794 Ga0495589_0098253 Ga0495589_0098253_846_1091 81
107 3300046810 Ga0495660_0003408 Ga0495660_0003408_9076_9321 81
108 3300047323 Ga0495683_0359487 Ga0495683_0359487_206_451 81
109 3300047443 Ga0495687_000713 Ga0495687_000713_22598_22843 81
110 3300047443 Ga0495687_064440 Ga0495687_064440_1197_1442 81
111 3300047446 Ga0495679_198189 Ga0495679_198189_244_489 81
112 3300047470 Ga0495681_0270826 Ga0495681_0270826_80_325 81
113 3300047472 Ga0495686_0000614 Ga0495686_0000614_6060_6305 81
114 3300047472 Ga0495686_0001530 Ga0495686_0001530_22569_22814 81
115 3300047472 Ga0495686_0063077 Ga0495686_0063077_62_307 81
116 3300049671 Ga0501238_053308 Ga0501238_053308_21_266 81
117 3300050493 nmdc:mga0k408_183703_c1 nmdc:mga0k408_183703_c1_476_721 81
118 3300050493 nmdc:mga0k408_50_c1 nmdc:mga0k408_50_c1_4792_5037 81
119 3300050493 nmdc:mga0k408_98019_c1 nmdc:mga0k408_98019_c1_596_841 81
120 3300050496 nmdc:mga07m45_662237_c1 nmdc:mga07m45_662237_c1_102_347 81
121 3300050516 nmdc:mga0sz30_352572_c1 nmdc:mga0sz30_352572_c1_32_277 81
122 3300053080 Ga0500635_0015989 Ga0500635_0015989_290_535 81
123 3300053098 Ga0500650_0395019 Ga0500650_0395019_230_475 81
124 3300053125 Ga0500618_000011 Ga0500618_000011_88592_88837 81
125 3300053125 Ga0500618_015439 Ga0500618_015439_518_763 81
126 3300053131 Ga0500652_094586 Ga0500652_094586_165_410 81
127 3300053131 Ga0500652_282679 Ga0500652_282679_299_544 81
128 3300053138 Ga0500564_127102 Ga0500564_127102_768_1013 81
129 3300053140 Ga0500573_0379755 Ga0500573_0379755_77_322 81
130 3300053143 Ga0500579_172116 Ga0500579_172116_463_708 81
131 3300053153 Ga0500616_0098591 Ga0500616_0098591_37_282 81
132 3300053156 Ga0500622_0130589 Ga0500622_0130589_402_647 81
133 3300053157 Ga0500624_000349 Ga0500624_000349_13277_13522 81
134 3300001989 JGI24739J22299_10179345 JGI24739J22299_101793451 82
135 3300002741 JGI25157J39369_1006591 JGI25157J39369_10065912 82
136 3300003316 rootH1_10174641 rootH1_101746412 82
137 3300003320 rootH2_10000579 rootH2_10000579109 82
138 3300005327 Ga0070658_10328781 Ga0070658_103287812 82
139 3300005339 Ga0070660_100019609 Ga0070660_1000196094 82
140 3300005364 Ga0070673_100017902 Ga0070673_1000179022 82
141 3300005364 Ga0070673_100554429 Ga0070673_1005544292 82
142 3300005364 Ga0070673_101014983 Ga0070673_1010149831 82
143 3300005366 Ga0070659_100265844 Ga0070659_1002658442 82
144 3300005457 Ga0070662_100000374 Ga0070662_10000037433 82
145 3300005530 Ga0070679_100171105 Ga0070679_1001711052 82
146 3300005539 Ga0068853_102475061 Ga0068853_1024750612 82
147 3300005563 Ga0068855_100060890 Ga0068855_1000608903 82
148 3300006195 Ga0075366_10008691 Ga0075366_100086915 82
149 3300006195 Ga0075366_10447247 Ga0075366_104472472 82
150 3300009093 Ga0105240_10013206 Ga0105240_1001320612 82
151 3300009098 Ga0105245_10963928 Ga0105245_109639281 82
152 3300009098 Ga0105245_11999689 Ga0105245_119996892 82
153 3300009174 Ga0105241_10525332 Ga0105241_105253322 82
154 3300009545 Ga0105237_10002767 Ga0105237_1000276718 82
155 3300009545 Ga0105237_10189764 Ga0105237_101897642 82
156 3300009545 Ga0105237_12694408 Ga0105237_126944082 82
157 3300010375 Ga0105239_11731717 Ga0105239_117317172 82
158 3300010375 Ga0105239_13253492 Ga0105239_132534921 82
159 3300013100 Ga0157373_10066385 Ga0157373_100663852 82
160 3300013296 Ga0157374_10000122 Ga0157374_1000012260 82
161 3300013296 Ga0157374_10003748 Ga0157374_100037485 82
162 3300013297 Ga0157378_10286226 Ga0157378_102862262 82
163 3300013306 Ga0163162_10000071 Ga0163162_1000007119 82
164 3300013307 Ga0157372_10086778 Ga0157372_100867782 82
165 3300013307 Ga0157372_10986201 Ga0157372_109862012 82
166 3300013308 Ga0157375_10034268 Ga0157375_100342682 82
167 3300013308 Ga0157375_11388321 Ga0157375_113883212 82
168 3300014745 Ga0157377_10000731 Ga0157377_1000073111 82
169 3300025250 Ga0209026_1000881 Ga0209026_100088111 82
170 3300025904 Ga0207647_10000146 Ga0207647_1000014611 82
171 3300025904 Ga0207647_10491220 Ga0207647_104912202 82
172 3300025909 Ga0207705_10288164 Ga0207705_102881642 82
173 3300025911 Ga0207654_10667845 Ga0207654_106678451 82
174 3300025913 Ga0207695_10003909 Ga0207695_100039093 82
175 3300025914 Ga0207671_10000979 Ga0207671_1000097918 82
176 3300025914 Ga0207671_10293705 Ga0207671_102937052 82
177 3300025919 Ga0207657_10012630 Ga0207657_100126305 82
178 3300025921 Ga0207652_10142385 Ga0207652_101423852 82
179 3300025927 Ga0207687_10532750 Ga0207687_105327502 82
180 3300025927 Ga0207687_10649488 Ga0207687_106494882 82
181 3300025931 Ga0207644_10083695 Ga0207644_100836951 82
182 3300025933 Ga0207706_10000007 Ga0207706_1000000775 82
183 3300025935 Ga0207709_10253095 Ga0207709_102530952 82
184 3300025944 Ga0207661_12160793 Ga0207661_121607932 82
185 3300025949 Ga0207667_10064048 Ga0207667_100640482 82
186 3300025949 Ga0207667_11783222 Ga0207667_117832222 82
187 3300025960 Ga0207651_11694763 Ga0207651_116947632 82
188 3300026078 Ga0207702_10141987 Ga0207702_101419872 82
189 3300028786 Ga0307517_10000335 Ga0307517_1000033548 82
190 3300033180 Ga0307510_10034837 Ga0307510_100348372 82
191 3300037312 Ga0395899_0022125 Ga0395899_0022125_1838_2086 82
192 3300037418 Ga0395900_0000288 Ga0395900_0000288_22616_22864 82
193 3300037418 Ga0395900_0048652 Ga0395900_0048652_3110_3358 82
194 3300037466 Ga0395898_0864804 Ga0395898_0864804_434_682 82
195 3300037471 Ga0395905_0000411 Ga0395905_0000411_16838_17086 82
196 3300038443 Ga0395901_0020522 Ga0395901_0020522_1236_1484 82
197 3300042005 Ga0439448_0065335 Ga0439448_0065335_912_1160 82
198 3300042012 Ga0439455_0059747 Ga0439455_0059747_591_839 82
199 3300046462 Ga0495651_0703413 Ga0495651_0703413_164_412 82
200 3300046500 Ga0495596_0019260 Ga0495596_0019260_2198_2446 82
201 3300046518 Ga0495631_0012686 Ga0495631_0012686_2776_3024 82
202 3300047323 Ga0495683_0043231 Ga0495683_0043231_842_1090 82
203 3300047472 Ga0495686_0142211 Ga0495686_0142211_637_888 82
204 3300049822 Ga0501035_1412862 Ga0501035_1412862_167_415 82
205 3300050493 nmdc:mga0k408_8022_c1 nmdc:mga0k408_8022_c1_3413_3661 82
206 3300053156 Ga0500622_0002680 Ga0500622_0002680_10040_10288 82
207 3300005288 Ga0065714_10270683 Ga0065714_102706831 83
208 3300010375 Ga0105239_10000014 Ga0105239_10000014213 83
209 3300028794 Ga0307515_10179843 Ga0307515_101798432 83
210 3300032004 Ga0307414_10052103 Ga0307414_100521032 83
211 3300032004 Ga0307414_10063673 Ga0307414_100636732 83
212 3300032005 Ga0307411_10319358 Ga0307411_103193581 83
213 3300001979 JGI24740J21852_10007632 JGI24740J21852_100076322 84
214 3300003214 JGI25165J46597_1011795 JGI25165J46597_10117952 84
215 3300005455 Ga0070663_100020353 Ga0070663_1000203532 84
216 3300005563 Ga0068855_100238656 Ga0068855_1002386562 84
217 3300005616 Ga0068852_100851382 Ga0068852_1008513822 84
218 3300009093 Ga0105240_10000083 Ga0105240_1000008375 84
219 3300009093 Ga0105240_10455221 Ga0105240_104552212 84
220 3300009093 Ga0105240_10494576 Ga0105240_104945762 84
221 3300009093 Ga0105240_10565979 Ga0105240_105659792 84
222 3300009174 Ga0105241_10014903 Ga0105241_100149032 84
223 3300009545 Ga0105237_10000138 Ga0105237_1000013848 84
224 3300009545 Ga0105237_11479807 Ga0105237_114798072 84
225 3300009551 Ga0105238_10075634 Ga0105238_100756343 84
226 3300010375 Ga0105239_10007896 Ga0105239_1000789611 84
227 3300013102 Ga0157371_10002147 Ga0157371_100021478 84
228 3300013104 Ga0157370_10319964 Ga0157370_103199642 84
229 3300013105 Ga0157369_10003611 Ga0157369_1000361115 84
230 3300013296 Ga0157374_11859481 Ga0157374_118594811 84
231 3300013306 Ga0163162_10085668 Ga0163162_100856683 84
232 3300013307 Ga0157372_10000037 Ga0157372_1000003714 84
233 3300025250 Ga0209026_1009891 Ga0209026_10098912 84
234 3300025254 Ga0209148_1018938 Ga0209148_10189382 84
235 3300025911 Ga0207654_10029874 Ga0207654_100298742 84
236 3300025913 Ga0207695_10323813 Ga0207695_103238132 84
237 3300025913 Ga0207695_10627009 Ga0207695_106270092 84
238 3300025913 Ga0207695_11079680 Ga0207695_110796801 84
239 3300025913 Ga0207695_11280669 Ga0207695_112806692 84
240 3300025914 Ga0207671_10000635 Ga0207671_1000063520 84
241 3300025914 Ga0207671_10287178 Ga0207671_102871782 84
242 3300025924 Ga0207694_10052463 Ga0207694_100524632 84
243 3300026067 Ga0207678_10285235 Ga0207678_102852352 84
244 3300026142 Ga0207698_11040195 Ga0207698_110401952 84
245 3300037312 Ga0395899_0000152 Ga0395899_0000152_56313_56567 84
246 3300037312 Ga0395899_0001541 Ga0395899_0001541_2718_2972 84
247 3300037466 Ga0395898_0097397 Ga0395898_0097397_1298_1552 84
248 3300037471 Ga0395905_0143258 Ga0395905_0143258_1157_1411 84
249 3300038443 Ga0395901_0074376 Ga0395901_0074376_890_1144 84
250 3300044684 Ga0466966_0031871 Ga0466966_0031871_732_986 84
251 3300044693 Ga0466961_0037993 Ga0466961_0037993_495_749 84
252 3300044719 Ga0466971_0238420 Ga0466971_0238420_171_425 84
253 3300045049 Ga0466959_0029921 Ga0466959_0029921_1078_1332 84
254 3300045836 Ga0466958_0030403 Ga0466958_0030403_1028_1282 84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4eru-assembly1.cif.gz_B crystal structure of putative cytoplasmic protein, ycif bacterial stress response protein from salmonella enterica 0.9672 32 74
5mqs-assembly1.cif.gz_A sialidase bt_1020 0.9671 32 68
2gs4-assembly1.cif.gz_A the crystal structure of the e.coli stress protein ycif. 0.9621 32 73
2c41-assembly1.cif.gz_C x-ray structure of dps from thermosynechococcus elongatus 0.9233 32 72
7dkv-assembly1.cif.gz_A crystal structure of txgh116 e441a nucleophile mutant from thermoanaerobacterium xylanolyticum with cellotriose 0.7898 35 71
ID Description Score Start End Superfamily
2c41C01 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9233 32 72 1.20.1260.10
af_P06989_113_203_1.10.287.1080 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.8755 25 72 1.10.287.1080
af_D4A615_3_281_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.871 8 72 1.25.40.10
af_Q54RZ3_14_187_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.867 31 75 1.25.40.10
af_Q9VSA4_124_304_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8548 4 68 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A0E3LG12-F1-model_v4 Uncharacterized protein 0.9945 4 73 GO:0016020
AF-A0A3N5UXB1-F1-model_v4 Permease 0.9935 4 73 GO:0016020
AF-A0A842WAS0-F1-model_v4 YgjV family protein 0.9917 6 74 GO:0016020
AF-A0A536SYJ8-F1-model_v4 Cyclic nucleotide-binding protein 0.9914 3 72
AF-A0A519U578-F1-model_v4 Uncharacterized protein 0.9913 4 61 GO:0016020

Feature Viewer

pLDDT pTM Quality
86.85 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map