F365089

General Info

Members Datasets Scaffolds Average Seq Length
254 161 244 364

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0000112|Ga0451577_0000112_4119_5372
Length 417
Sequence MGTESAAIFLQAGKQSFAGRLRFARLGIGHGWLYRIACKNQYWFETLESGIISLTMTKLIVVTALILGLFGFGKAQDLLPVRGFCIAAPDSRHLDTFVKFIDEELASRKVNVLVVRIDYNYEFESHPELRAKDCLTKTDVKKMVDVCKKHSIRLIPQINLLGHQSWAGKLGNLLAMYPEFDETPNVKMPEKYVWPNADGLYCKSYCPLHPGVHKVVFELMDEICDAFESDAYHAGMDEVFFIGDDKCPRCSGRDKAELFSGEVNAIRNHLALKNRQLWIWGDRMIDGKTTGMGMWEASMNNTYRAIDLIAKDVMICDWHYERPDLTPVMFAMKGLSVVTCPWKNAENAIVQAQDMDRWRKNATPILKDRYQGMMQTVWSGNSSFLDEFYGIKPAGVKSESACFKALFREINNDATVK

Samples

Sample ID Description Type Environment
1 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
2 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
3 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
4 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
5 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
6 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere
7 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
8 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
9 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
10 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
15 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
16 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
76 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
77 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
78 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
79 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
82 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
84 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
113 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
114 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
115 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
117 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
118 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
119 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
120 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
121 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
122 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
123 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
124 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
125 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
126 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
127 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
128 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
135 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
136 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
137 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
138 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
139 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
140 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
141 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
142 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
143 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
144 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
145 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
146 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
147 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
148 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
149 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
150 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
151 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
152 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
153 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
154 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
155 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
156 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
157 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
158 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
160 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
161 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.85
Metatranscriptomes 0
Isolates 3.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.06
Nodule 0
Rhizoplane 0
Rhizosphere 85.04
Stem 0
Stem Tuber 0
Unclassified 5.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10005677 3300001989 Bacteria 4727
2 JGI25154J39366_1000028 3300002738 Bacteria 195818
3 JGI25406J46586_10029432 3300003203 Bacteria 2079
4 JGI25153J46596_10032052 3300003215 Bacteria 1759
5 rootH2_10008015 3300003320 Bacteria 33665
6 JGI25160J50197_1000946 3300003354 Bacteria 15244
7 Ga0055526_1019318 3300003771 Bacteria 2488
8 Ga0055526_1027332 3300003771 Bacteria 1766
9 Ga0055528_1000029 3300003790 Bacteria 122126
10 Ga0055530_10000263 3300003791 Bacteria 47460
11 Ga0055531_10000061 3300003794 Bacteria 120535
12 Ga0055531_10000144 3300003794 Bacteria 82231
13 Ga0065165_1000052 3300005262 Bacteria 192010
14 Ga0065165_1006449 3300005262 Bacteria 6145
15 Ga0065712_10071768 3300005290 Bacteria 5071
16 Ga0070658_10146646 3300005327 Bacteria 1974
17 Ga0070683_100062931 3300005329 Bacteria 3450
18 Ga0070670_100032523 3300005331 Bacteria 4492
19 Ga0070680_100001709 3300005336 Bacteria 16117
20 Ga0070680_100034222 3300005336 Bacteria 4097
21 Ga0068868_100109186 3300005338 Bacteria 2246
22 Ga0070660_100126076 3300005339 Bacteria 2046
23 Ga0070660_100139152 3300005339 Bacteria 1946
24 Ga0070660_100173579 3300005339 Bacteria 1742
25 Ga0070691_10014467 3300005341 Unclassified 3621
26 Ga0070661_100004104 3300005344 Bacteria 10039
27 Ga0070668_100056264 3300005347 Bacteria 3037
28 Ga0070668_100097439 3300005347 Bacteria 2326
29 Ga0070675_100051183 3300005354 Unclassified 3394
30 Ga0070675_100114952 3300005354 Bacteria 2280
31 Ga0070671_100082283 3300005355 Bacteria 2692
32 Ga0070671_100344252 3300005355 Bacteria 1272
33 Ga0070673_100204885 3300005364 Bacteria 1700
34 Ga0070659_100150364 3300005366 Bacteria 1899
35 Ga0070662_100032710 3300005457 Bacteria 3656
36 Ga0070681_10049335 3300005458 Bacteria 4204
37 Ga0070681_10056933 3300005458 Bacteria 3889
38 Ga0068867_100058649 3300005459 Bacteria 2853
39 Ga0070679_100046516 3300005530 Bacteria 4325
40 Ga0070679_100128108 3300005530 Unclassified 2520
41 Ga0070679_100183304 3300005530 Bacteria 2065
42 Ga0070684_100108809 3300005535 Bacteria 2483
43 Ga0070684_100123244 3300005535 Unclassified 2333
44 Ga0068853_100012350 3300005539 Bacteria 6950
45 Ga0068853_100192196 3300005539 Unclassified 1855
46 Ga0070693_100001265 3300005547 Bacteria 11437
47 Ga0070693_100014028 3300005547 Bacteria 4094
48 Ga0068855_100015131 3300005563 Bacteria 9291
49 Ga0068855_100143508 3300005563 Unclassified 2719
50 Ga0070664_100041698 3300005564 Bacteria 3873
51 Ga0068857_100034919 3300005577 Bacteria 4449
52 Ga0068857_100152496 3300005577 Bacteria 2094
53 Ga0068854_100048089 3300005578 Unclassified 3042
54 Ga0068854_100078743 3300005578 Bacteria 2429
55 Ga0068859_100036789 3300005617 Bacteria 4914
56 Ga0068859_100096967 3300005617 Bacteria 3001
57 Ga0068864_100018431 3300005618 Bacteria 5832
58 Ga0068864_100128772 3300005618 Bacteria 2271
59 Ga0068861_100027814 3300005719 Bacteria 4123
60 Ga0068863_100241546 3300005841 Bacteria 1743
61 Ga0068860_100003579 3300005843 Bacteria 15969
62 Ga0068862_100007873 3300005844 Bacteria 8816
63 Ga0081540_1009166 3300005983 Bacteria 6828
64 Ga0081539_10000284 3300005985 Bacteria 114545
65 Ga0075366_10039039 3300006195 Bacteria 2805
66 Ga0097621_100060452 3300006237 Bacteria 3106
67 Ga0068871_100265744 3300006358 Bacteria 1498
68 Ga0075428_100383262 3300006844 Bacteria 1507
69 Ga0068865_100041328 3300006881 Bacteria 3136
70 Ga0097620_100036787 3300006931 Bacteria 4914
71 Ga0097620_100096967 3300006931 Bacteria 3001
72 Ga0105240_10005141 3300009093 Bacteria 19585
73 Ga0105240_10044723 3300009093 Bacteria 5623
74 Ga0111539_10086060 3300009094 Unclassified 3694
75 Ga0114129_10063065 3300009147 Bacteria 5177
76 Ga0105241_10010962 3300009174 Bacteria 6645
77 Ga0105241_10024298 3300009174 Bacteria 4500
78 Ga0105242_10310418 3300009176 Bacteria 1443
79 Ga0105237_10092906 3300009545 Bacteria 3007
80 Ga0105237_10168526 3300009545 Unclassified 2189
81 Ga0105237_10181373 3300009545 Bacteria 2106
82 Ga0105249_10000887 3300009553 Bacteria 26498
83 Ga0105249_10267899 3300009553 Bacteria 1700
84 Ga0105239_10007397 3300010375 Bacteria 12598
85 Ga0105239_10099793 3300010375 Bacteria 3210
86 Ga0105239_10222765 3300010375 Bacteria 2116
87 Ga0157373_10011369 3300013100 Bacteria 6546
88 Ga0157371_10060732 3300013102 Bacteria 2680
89 Ga0157370_10140599 3300013104 Bacteria 2249
90 Ga0157369_10042999 3300013105 Bacteria 4926
91 Ga0157374_10015885 3300013296 Bacteria 6614
92 Ga0157374_10181596 3300013296 Bacteria 2055
93 Ga0157374_10230624 3300013296 Bacteria 1819
94 Ga0157378_10088856 3300013297 Bacteria 2805
95 Ga0157378_10182485 3300013297 Bacteria 1975
96 Ga0157372_10012438 3300013307 Bacteria 9072
97 Ga0157372_10179268 3300013307 Bacteria 2452
98 Ga0163163_10546132 3300014325 Bacteria 1221
99 Ga0157380_10113397 3300014326 Bacteria 2283
100 Ga0182005_1000091 3300015265 Bacteria 67859
101 Ga0213876_10111131 3300021384 Bacteria 1454
102 Ga0209646_1000006 3300025246 Bacteria 694084
103 Ga0209026_1000185 3300025250 Bacteria 91252
104 Ga0209673_1000187 3300025273 Bacteria 124227
105 Ga0209564_1003435 3300025295 Bacteria 10843
106 Ga0209564_1030995 3300025295 Bacteria 1644
107 Ga0209758_1043422 3300025297 Bacteria 1656
108 Ga0209050_1000259 3300025298 Bacteria 113475
109 Ga0207426_1000026 3300025302 Bacteria 515228
110 Ga0207426_1003817 3300025302 Bacteria 7797
111 Ga0209051_1053155 3300025303 Bacteria 1333
112 Ga0209257_1000006 3300025304 Bacteria 1570111
113 Ga0209257_1000064 3300025304 Bacteria 356803
114 Ga0209257_1002666 3300025304 Bacteria 17132
115 Ga0207647_10070211 3300025904 Unclassified 2116
116 Ga0207654_10001973 3300025911 Bacteria 10601
117 Ga0207654_10104331 3300025911 Unclassified 1752
118 Ga0207654_10140979 3300025911 Bacteria 1537
119 Ga0207707_10002014 3300025912 Bacteria 18444
120 Ga0207707_10086752 3300025912 Bacteria 2735
121 Ga0207695_10006064 3300025913 Bacteria 15777
122 Ga0207695_10197173 3300025913 Bacteria 1929
123 Ga0207671_10051370 3300025914 Bacteria 3055
124 Ga0207671_10110549 3300025914 Bacteria 2090
125 Ga0207660_10003536 3300025917 Bacteria 10183
126 Ga0207660_10082164 3300025917 Bacteria 2369
127 Ga0207657_10064829 3300025919 Bacteria 3116
128 Ga0207652_10003997 3300025921 Bacteria 12052
129 Ga0207652_10160048 3300025921 Unclassified 2018
130 Ga0207694_10282628 3300025924 Bacteria 1363
131 Ga0207650_10054124 3300025925 Bacteria 2976
132 Ga0207659_10099299 3300025926 Unclassified 2191
133 Ga0207690_10065211 3300025932 Bacteria 2489
134 Ga0207706_10007591 3300025933 Bacteria 10032
135 Ga0207704_10023978 3300025938 Bacteria 3298
136 Ga0207689_10017896 3300025942 Bacteria 5984
137 Ga0207651_10105612 3300025960 Bacteria 2101
138 Ga0207712_10002645 3300025961 Bacteria 11466
139 Ga0207668_10240330 3300025972 Bacteria 1465
140 Ga0207677_10085689 3300026023 Bacteria 2275
141 Ga0207639_10039014 3300026041 Bacteria 3536
142 Ga0207702_10096453 3300026078 Bacteria 2601
143 Ga0207648_10023510 3300026089 Bacteria 5519
144 Ga0207648_10044746 3300026089 Bacteria 3884
145 Ga0207676_10021656 3300026095 Bacteria 4719
146 Ga0207674_10040891 3300026116 Bacteria 4798
147 Ga0207674_10173644 3300026116 Bacteria 2108
148 Ga0207674_10356623 3300026116 Unclassified 1414
149 Ga0207675_100045607 3300026118 Bacteria 4095
150 Ga0207675_100103985 3300026118 Bacteria 2676
151 Ga0207428_10105505 3300027907 Bacteria 2173
152 Ga0265327_10000653 3300031251 Bacteria 55957
153 Ga0265327_10011485 3300031251 Bacteria 6090
154 Ga0265316_10010231 3300031344 Bacteria 8565
155 Ga0265316_10088605 3300031344 Bacteria 2363
156 Ga0307408_100009558 3300031548 Bacteria 6398
157 Ga0316576_10001008 3300031727 Bacteria 14520
158 Ga0307416_100002068 3300032002 Bacteria 11305
159 Ga0316584_0169312 3300036712 Bacteria 1621
160 Ga0436365_0356837 3300039437 Bacteria 37291
161 Ga0451577_0000072 3300042876 Bacteria 237934
162 Ga0451577_0000112 3300042876 Bacteria 177581
163 Ga0451577_0001478 3300042876 Bacteria 31145
164 Ga0451577_0033180 3300042876 Bacteria 4653
165 Ga0451577_0037966 3300042876 Unclassified 4334
166 Ga0451577_0069372 3300042876 Bacteria 3143
167 Ga0453683_0000224 3300044673 Bacteria 75668
168 Ga0453683_0000363 3300044673 Bacteria 54249
169 Ga0453683_0002945 3300044673 Bacteria 12814
170 Ga0453683_0004679 3300044673 Bacteria 9652
171 Ga0453683_0004925 3300044673 Bacteria 9381
172 Ga0453683_0016781 3300044673 Bacteria 4720
173 Ga0453683_0035232 3300044673 Bacteria 3154
174 Ga0453684_0000143 3300044712 Bacteria 315998
175 Ga0453684_0000186 3300044712 Bacteria 273302
176 Ga0453684_0000398 3300044712 Bacteria 178891
177 Ga0453684_0000570 3300044712 Bacteria 137760
178 Ga0453684_0000919 3300044712 Bacteria 97826
179 Ga0453684_0001483 3300044712 Bacteria 66171
180 Ga0453684_0001631 3300044712 Bacteria 61066
181 Ga0453684_0028193 3300044712 Bacteria 8024
182 Ga0453684_0034850 3300044712 Bacteria 6974
183 Ga0453684_0058212 3300044712 Bacteria 4993
184 Ga0453684_0099496 3300044712 Bacteria 3562
185 Ga0453684_0106628 3300044712 Bacteria 3414
186 Ga0453684_0130407 3300044712 Bacteria 3017
187 Ga0453684_0172346 3300044712 Bacteria 2549
188 Ga0453684_0182109 3300044712 Unclassified 2465
189 Ga0453684_0214575 3300044712 Bacteria 2234
190 Ga0453684_0249619 3300044712 Bacteria 2038
191 Ga0453684_0348521 3300044712 Bacteria 1670
192 Ga0466959_0007096 3300045049 Bacteria 7838
193 Ga0451576_0000065 3300045051 Bacteria 274445
194 Ga0451576_0000095 3300045051 Bacteria 223485
195 Ga0451576_0000150 3300045051 Bacteria 177361
196 Ga0451576_0001135 3300045051 Bacteria 48115
197 Ga0451576_0001534 3300045051 Bacteria 38886
198 Ga0451576_0001677 3300045051 Bacteria 36728
199 Ga0451576_0002950 3300045051 Bacteria 24120
200 Ga0451576_0003363 3300045051 Bacteria 22150
201 Ga0451576_0055975 3300045051 Unclassified 4126
202 Ga0451576_0058706 3300045051 Unclassified 4019
203 Ga0451576_0067347 3300045051 Bacteria 3727
204 Ga0451576_0100471 3300045051 Bacteria 3008
205 Ga0451576_0132922 3300045051 Bacteria 2594
206 Ga0495611_0000025 3300046648 Bacteria 118583
207 Ga0495649_0131006 3300046694 Unclassified 1323
208 Ga0496121_0000011 3300048924 Bacteria 792193
209 Ga0496126_0020214 3300048929 Bacteria 6534
210 Ga0501032_0049163 3300049569 Bacteria 2846
211 Ga0501034_0007750 3300049571 Bacteria 11415
212 Ga0501037_0191599 3300049573 Bacteria 1447
213 Ga0501038_0136110 3300049574 Bacteria 2013
214 Ga0501043_0026072 3300049579 Bacteria 4587
215 Ga0501047_0052859 3300049581 Bacteria 3927
216 Ga0501067_0011962 3300049583 Bacteria 4808
217 Ga0501070_0069370 3300049586 Bacteria 2918
218 Ga0501072_0162145 3300049588 Bacteria 1784
219 Ga0501073_0031462 3300049589 Bacteria 3786
220 Ga0501074_0105644 3300049590 Bacteria 2016
221 Ga0501198_003708 3300049649 Unclassified 2099
222 Ga0501201_000196 3300049651 Bacteria 5300
223 Ga0501202_004547 3300049652 Bacteria 2429
224 Ga0501207_002082 3300049654 Bacteria 2555
225 Ga0501217_000055 3300049661 Bacteria 13339
226 Ga0501217_006991 3300049661 Bacteria 2413
227 Ga0501222_001637 3300049662 Bacteria 3112
228 Ga0501223_002138 3300049663 Bacteria 4430
229 Ga0501224_000290 3300049664 Bacteria 5799
230 Ga0501233_010018 3300049668 Unclassified 1859
231 Ga0501235_015207 3300049669 Bacteria 1697
232 Ga0501243_000781 3300049675 Bacteria 4421
233 Ga0501259_001977 3300049688 Bacteria 3388
234 Ga0501261_001206 3300049690 Bacteria 3174
235 Ga0501221_001796 3300049704 Bacteria 3581
236 Ga0501225_0001107 3300049705 Bacteria 8457
237 Ga0501234_000929 3300049707 Bacteria 4632
238 Ga0501083_0073642 3300049744 Bacteria 2270
239 Ga0501241_000674 3300049758 Bacteria 7363
240 Ga0501264_000050 3300049761 Bacteria 16836
241 Ga0501035_0063919 3300049822 Bacteria 3272
242 Ga0501044_0044152 3300049823 Bacteria 4628
243 Ga0501044_0061509 3300049823 Bacteria 3841
244 Ga0500622_0000203 3300053156 Bacteria 63042

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044673 Ga0453683_0016781 Ga0453683_0016781_27_944 298
2 3300045051 Ga0451576_0100471 Ga0451576_0100471_103_1149 324
3 3300009094 Ga0111539_10086060 Ga0111539_100860603 326
4 3300003794 Ga0055531_10000061 Ga0055531_1000006124 330
5 3300006195 Ga0075366_10039039 Ga0075366_100390392 330
6 3300009147 Ga0114129_10063065 Ga0114129_100630652 330
7 3300025304 Ga0209257_1000006 Ga0209257_1000006230 330
8 3300009176 Ga0105242_10310418 Ga0105242_103104181 331
9 3300013307 Ga0157372_10012438 Ga0157372_100124382 334
10 3300046648 Ga0495611_0000025 Ga0495611_0000025_13790_14890 334
11 3300025921 Ga0207652_10160048 Ga0207652_101600481 335
12 3300025924 Ga0207694_10282628 Ga0207694_102826282 336
13 3300026116 Ga0207674_10356623 Ga0207674_103566231 337
14 3300045051 Ga0451576_0001677 Ga0451576_0001677_31333_32427 337
15 3300005355 Ga0070671_100344252 Ga0070671_1003442521 338
16 3300005459 Ga0068867_100058649 Ga0068867_1000586493 338
17 3300005539 Ga0068853_100192196 Ga0068853_1001921963 338
18 3300005617 Ga0068859_100096967 Ga0068859_1000969675 338
19 3300006931 Ga0097620_100096967 Ga0097620_1000969675 338
20 3300009093 Ga0105240_10044723 Ga0105240_100447232 338
21 3300013296 Ga0157374_10230624 Ga0157374_102306242 338
22 3300021384 Ga0213876_10111131 Ga0213876_101111312 338
23 3300025913 Ga0207695_10197173 Ga0207695_101971733 338
24 3300026089 Ga0207648_10023510 Ga0207648_100235103 338
25 3300045049 Ga0466959_0007096 Ga0466959_0007096_4375_5484 338
26 3300005618 Ga0068864_100018431 Ga0068864_1000184317 339
27 3300006237 Ga0097621_100060452 Ga0097621_1000604523 339
28 3300026089 Ga0207648_10044746 Ga0207648_100447464 339
29 3300031251 Ga0265327_10000653 Ga0265327_1000065336 339
30 3300049758 Ga0501241_000674 Ga0501241_000674_2450_3616 339
31 3300005336 Ga0070680_100034222 Ga0070680_1000342223 340
32 3300005530 Ga0070679_100183304 Ga0070679_1001833042 340
33 3300005618 Ga0068864_100128772 Ga0068864_1001287722 340
34 3300005841 Ga0068863_100241546 Ga0068863_1002415462 340
35 3300006844 Ga0075428_100383262 Ga0075428_1003832622 340
36 3300013296 Ga0157374_10181596 Ga0157374_101815961 340
37 3300013297 Ga0157378_10088856 Ga0157378_100888563 340
38 3300014325 Ga0163163_10546132 Ga0163163_105461321 340
39 3300014326 Ga0157380_10113397 Ga0157380_101133972 340
40 3300025917 Ga0207660_10082164 Ga0207660_100821642 340
41 3300026095 Ga0207676_10021656 Ga0207676_100216563 340
42 3300027907 Ga0207428_10105505 Ga0207428_101055051 340
43 3300049579 Ga0501043_0026072 Ga0501043_0026072_3244_4365 340
44 3300005458 Ga0070681_10056933 Ga0070681_100569335 341
45 3300005530 Ga0070679_100128108 Ga0070679_1001281081 341
46 3300005535 Ga0070684_100123244 Ga0070684_1001232442 341
47 3300005563 Ga0068855_100143508 Ga0068855_1001435083 341
48 3300005578 Ga0068854_100048089 Ga0068854_1000480893 341
49 3300005983 Ga0081540_1009166 Ga0081540_10091667 341
50 3300009174 Ga0105241_10024298 Ga0105241_100242981 341
51 3300009545 Ga0105237_10168526 Ga0105237_101685262 341
52 3300010375 Ga0105239_10222765 Ga0105239_102227652 341
53 3300025911 Ga0207654_10104331 Ga0207654_101043312 341
54 3300026078 Ga0207702_10096453 Ga0207702_100964532 341
55 3300005290 Ga0065712_10071768 Ga0065712_100717681 342
56 3300005354 Ga0070675_100051183 Ga0070675_1000511832 342
57 3300025297 Ga0209758_1043422 Ga0209758_10434222 342
58 3300025926 Ga0207659_10099299 Ga0207659_100992992 342
59 3300042876 Ga0451577_0000072 Ga0451577_0000072_66509_67621 342
60 3300044673 Ga0453683_0000224 Ga0453683_0000224_40822_41934 342
61 3300044712 Ga0453684_0000186 Ga0453684_0000186_205682_206794 342
62 3300045051 Ga0451576_0000065 Ga0451576_0000065_206825_207937 342
63 3300003354 JGI25160J50197_1000946 JGI25160J50197_10009461 344
64 3300003771 Ga0055526_1019318 Ga0055526_10193181 344
65 3300003790 Ga0055528_1000029 Ga0055528_100002944 344
66 3300003791 Ga0055530_10000263 Ga0055530_1000026315 344
67 3300005262 Ga0065165_1000052 Ga0065165_100005246 344
68 3300005563 Ga0068855_100015131 Ga0068855_1000151312 344
69 3300009545 Ga0105237_10181373 Ga0105237_101813732 344
70 3300010375 Ga0105239_10007397 Ga0105239_100073979 344
71 3300025273 Ga0209673_1000187 Ga0209673_100018760 344
72 3300025295 Ga0209564_1003435 Ga0209564_10034352 344
73 3300025298 Ga0209050_1000259 Ga0209050_100025917 344
74 3300025302 Ga0207426_1003817 Ga0207426_10038173 344
75 3300025303 Ga0209051_1053155 Ga0209051_10531551 344
76 3300025304 Ga0209257_1002666 Ga0209257_100266611 344
77 3300025914 Ga0207671_10110549 Ga0207671_101105492 344
78 3300025933 Ga0207706_10007591 Ga0207706_100075911 344
79 3300049661 Ga0501217_006991 Ga0501217_006991_221_1258 344
80 3300003320 rootH2_10008015 rootH2_1000801511 345
81 3300046694 Ga0495649_0131006 Ga0495649_0131006_138_1283 345
82 3300049569 Ga0501032_0049163 Ga0501032_0049163_1294_2415 346
83 3300049571 Ga0501034_0007750 Ga0501034_0007750_280_1401 346
84 3300049573 Ga0501037_0191599 Ga0501037_0191599_86_1207 346
85 3300049581 Ga0501047_0052859 Ga0501047_0052859_1706_2827 346
86 3300049822 Ga0501035_0063919 Ga0501035_0063919_1784_2905 346
87 3300049823 Ga0501044_0044152 Ga0501044_0044152_2552_3673 346
88 3300044673 Ga0453683_0000363 Ga0453683_0000363_8742_9890 351
89 3300044712 Ga0453684_0130407 Ga0453684_0130407_1856_3004 351
90 3300045051 Ga0451576_0002950 Ga0451576_0002950_11556_12704 351
91 3300042876 Ga0451577_0069372 Ga0451577_0069372_712_1851 352
92 3300044712 Ga0453684_0348521 Ga0453684_0348521_136_1242 353
93 3300042876 Ga0451577_0000112 Ga0451577_0000112_4119_5372 354
94 3300044673 Ga0453683_0002945 Ga0453683_0002945_2420_3493 354
95 3300044673 Ga0453683_0004679 Ga0453683_0004679_6317_7471 354
96 3300044673 Ga0453683_0004925 Ga0453683_0004925_2698_3771 354
97 3300044712 Ga0453684_0000398 Ga0453684_0000398_3968_5221 354
98 3300044712 Ga0453684_0001483 Ga0453684_0001483_6646_7734 354
99 3300044712 Ga0453684_0001631 Ga0453684_0001631_53027_54205 354
100 3300044712 Ga0453684_0034850 Ga0453684_0034850_4299_5390 354
101 3300044712 Ga0453684_0106628 Ga0453684_0106628_2252_3394 354
102 3300045051 Ga0451576_0000150 Ga0451576_0000150_15262_16515 354
103 3300045051 Ga0451576_0001534 Ga0451576_0001534_10295_11449 354
104 3300005336 Ga0070680_100001709 Ga0070680_1000017097 355
105 3300005339 Ga0070660_100126076 Ga0070660_1001260762 355
106 3300005339 Ga0070660_100173579 Ga0070660_1001735791 355
107 3300005341 Ga0070691_10014467 Ga0070691_100144673 355
108 3300005539 Ga0068853_100012350 Ga0068853_1000123504 355
109 3300005547 Ga0070693_100001265 Ga0070693_1000012656 355
110 3300009093 Ga0105240_10005141 Ga0105240_100051417 355
111 3300009174 Ga0105241_10010962 Ga0105241_100109623 355
112 3300025911 Ga0207654_10001973 Ga0207654_100019737 355
113 3300025912 Ga0207707_10002014 Ga0207707_100020147 355
114 3300025913 Ga0207695_10006064 Ga0207695_100060646 355
115 3300025917 Ga0207660_10003536 Ga0207660_100035365 355
116 3300025921 Ga0207652_10003997 Ga0207652_100039976 355
117 3300026041 Ga0207639_10039014 Ga0207639_100390144 355
118 3300036712 Ga0316584_0169312 Ga0316584_0169312_347_1438 355
119 3300049574 Ga0501038_0136110 Ga0501038_0136110_832_1935 355
120 3300049583 Ga0501067_0011962 Ga0501067_0011962_291_1394 355
121 3300049586 Ga0501070_0069370 Ga0501070_0069370_287_1390 355
122 3300049588 Ga0501072_0162145 Ga0501072_0162145_357_1460 355
123 3300049589 Ga0501073_0031462 Ga0501073_0031462_1988_3091 355
124 3300049590 Ga0501074_0105644 Ga0501074_0105644_52_1155 355
125 3300049744 Ga0501083_0073642 Ga0501083_0073642_941_2044 355
126 3300049823 Ga0501044_0061509 Ga0501044_0061509_1723_2826 355
127 iso_pu_bacteria 2818991460 2819681589 355
128 iso_pu_bacteria 2920107658 2920114276 355
129 3300044712 Ga0453684_0172346 Ga0453684_0172346_176_1288 356
130 3300049649 Ga0501198_003708 Ga0501198_003708_355_1464 356
131 3300049651 Ga0501201_000196 Ga0501201_000196_1405_2514 356
132 3300049652 Ga0501202_004547 Ga0501202_004547_1215_2324 356
133 3300049654 Ga0501207_002082 Ga0501207_002082_112_1221 356
134 3300049661 Ga0501217_000055 Ga0501217_000055_8396_9505 356
135 3300049662 Ga0501222_001637 Ga0501222_001637_1244_2353 356
136 3300049663 Ga0501223_002138 Ga0501223_002138_1917_3026 356
137 3300049664 Ga0501224_000290 Ga0501224_000290_1213_2322 356
138 3300049668 Ga0501233_010018 Ga0501233_010018_631_1740 356
139 3300049669 Ga0501235_015207 Ga0501235_015207_410_1519 356
140 3300049675 Ga0501243_000781 Ga0501243_000781_1124_2233 356
141 3300049688 Ga0501259_001977 Ga0501259_001977_1446_2555 356
142 3300049690 Ga0501261_001206 Ga0501261_001206_665_1774 356
143 3300049704 Ga0501221_001796 Ga0501221_001796_760_1869 356
144 3300049705 Ga0501225_0001107 Ga0501225_0001107_1310_2419 356
145 3300049707 Ga0501234_000929 Ga0501234_000929_168_1277 356
146 iso_pu_bacteria 2818991442 2819576274 356
147 iso_pu_bacteria 2821136567 2821142501 356
148 iso_pu_bacteria 2904467357 2904470331 356
149 iso_pu_bacteria 2929239360 2929243425 356
150 3300044712 Ga0453684_0058212 Ga0453684_0058212_826_1932 357
151 3300044712 Ga0453684_0182109 Ga0453684_0182109_1268_2368 357
152 3300045051 Ga0451576_0001135 Ga0451576_0001135_43742_44848 357
153 iso_pu_bacteria 2884791551 2884792429 357
154 iso_pu_bacteria 8003151029 8003156301 358
155 3300002738 JGI25154J39366_1000028 JGI25154J39366_1000028133 359
156 3300005347 Ga0070668_100056264 Ga0070668_1000562641 359
157 3300005617 Ga0068859_100036789 Ga0068859_1000367892 359
158 3300006881 Ga0068865_100041328 Ga0068865_1000413282 359
159 3300006931 Ga0097620_100036787 Ga0097620_1000367872 359
160 3300009553 Ga0105249_10267899 Ga0105249_102678992 359
161 3300025246 Ga0209646_1000006 Ga0209646_100000696 359
162 3300025250 Ga0209026_1000185 Ga0209026_100018567 359
163 3300025911 Ga0207654_10140979 Ga0207654_101409791 359
164 3300025938 Ga0207704_10023978 Ga0207704_100239782 359
165 3300025942 Ga0207689_10017896 Ga0207689_100178963 359
166 3300026023 Ga0207677_10085689 Ga0207677_100856892 359
167 3300026118 Ga0207675_100103985 Ga0207675_1001039851 359
168 3300031251 Ga0265327_10011485 Ga0265327_100114852 359
169 3300031344 Ga0265316_10010231 Ga0265316_100102317 359
170 3300031344 Ga0265316_10088605 Ga0265316_100886051 359
171 3300039437 Ga0436365_0356837 Ga0436365_0356837_29807_30898 359
172 3300044712 Ga0453684_0249619 Ga0453684_0249619_204_1313 359
173 3300005262 Ga0065165_1006449 Ga0065165_10064495 360
174 3300005719 Ga0068861_100027814 Ga0068861_1000278142 360
175 3300009545 Ga0105237_10092906 Ga0105237_100929064 360
176 3300010375 Ga0105239_10099793 Ga0105239_100997932 360
177 3300015265 Ga0182005_1000091 Ga0182005_100009117 360
178 3300025904 Ga0207647_10070211 Ga0207647_100702112 360
179 3300025914 Ga0207671_10051370 Ga0207671_100513704 360
180 3300026118 Ga0207675_100045607 Ga0207675_1000456075 360
181 3300032002 Ga0307416_100002068 Ga0307416_1000020687 360
182 3300048924 Ga0496121_0000011 Ga0496121_0000011_396760_397863 360
183 3300003203 JGI25406J46586_10029432 JGI25406J46586_100294322 361
184 3300003794 Ga0055531_10000144 Ga0055531_1000014450 361
185 3300005327 Ga0070658_10146646 Ga0070658_101466463 361
186 3300005329 Ga0070683_100062931 Ga0070683_1000629313 361
187 3300005331 Ga0070670_100032523 Ga0070670_1000325233 361
188 3300005338 Ga0068868_100109186 Ga0068868_1001091862 361
189 3300005339 Ga0070660_100139152 Ga0070660_1001391522 361
190 3300005344 Ga0070661_100004104 Ga0070661_1000041043 361
191 3300005347 Ga0070668_100097439 Ga0070668_1000974391 361
192 3300005354 Ga0070675_100114952 Ga0070675_1001149524 361
193 3300005355 Ga0070671_100082283 Ga0070671_1000822833 361
194 3300005364 Ga0070673_100204885 Ga0070673_1002048852 361
195 3300005366 Ga0070659_100150364 Ga0070659_1001503642 361
196 3300005457 Ga0070662_100032710 Ga0070662_1000327102 361
197 3300005458 Ga0070681_10049335 Ga0070681_100493355 361
198 3300005530 Ga0070679_100046516 Ga0070679_1000465167 361
199 3300005535 Ga0070684_100108809 Ga0070684_1001088092 361
200 3300005547 Ga0070693_100014028 Ga0070693_1000140282 361
201 3300005564 Ga0070664_100041698 Ga0070664_1000416983 361
202 3300005577 Ga0068857_100034919 Ga0068857_1000349193 361
203 3300005577 Ga0068857_100152496 Ga0068857_1001524961 361
204 3300005578 Ga0068854_100078743 Ga0068854_1000787431 361
205 3300005843 Ga0068860_100003579 Ga0068860_1000035795 361
206 3300005844 Ga0068862_100007873 Ga0068862_1000078732 361
207 3300005985 Ga0081539_10000284 Ga0081539_1000028427 361
208 3300006358 Ga0068871_100265744 Ga0068871_1002657442 361
209 3300009553 Ga0105249_10000887 Ga0105249_1000088720 361
210 3300013100 Ga0157373_10011369 Ga0157373_100113692 361
211 3300013102 Ga0157371_10060732 Ga0157371_100607326 361
212 3300013104 Ga0157370_10140599 Ga0157370_101405992 361
213 3300013105 Ga0157369_10042999 Ga0157369_100429992 361
214 3300013296 Ga0157374_10015885 Ga0157374_100158855 361
215 3300013297 Ga0157378_10182485 Ga0157378_101824852 361
216 3300013307 Ga0157372_10179268 Ga0157372_101792683 361
217 3300025302 Ga0207426_1000026 Ga0207426_100002650 361
218 3300025304 Ga0209257_1000064 Ga0209257_1000064178 361
219 3300025912 Ga0207707_10086752 Ga0207707_100867522 361
220 3300025919 Ga0207657_10064829 Ga0207657_100648292 361
221 3300025925 Ga0207650_10054124 Ga0207650_100541242 361
222 3300025932 Ga0207690_10065211 Ga0207690_100652112 361
223 3300025960 Ga0207651_10105612 Ga0207651_101056122 361
224 3300025961 Ga0207712_10002645 Ga0207712_100026453 361
225 3300025972 Ga0207668_10240330 Ga0207668_102403301 361
226 3300026116 Ga0207674_10040891 Ga0207674_100408913 361
227 3300026116 Ga0207674_10173644 Ga0207674_101736443 361
228 3300031548 Ga0307408_100009558 Ga0307408_1000095582 361
229 3300042876 Ga0451577_0001478 Ga0451577_0001478_6368_7525 361
230 3300042876 Ga0451577_0033180 Ga0451577_0033180_1950_3092 361
231 3300042876 Ga0451577_0033180 Ga0451577_0033180_795_1931 361
232 3300042876 Ga0451577_0037966 Ga0451577_0037966_1612_2727 361
233 3300044673 Ga0453683_0035232 Ga0453683_0035232_1236_2378 361
234 3300044712 Ga0453684_0000570 Ga0453684_0000570_41576_42733 361
235 3300044712 Ga0453684_0000919 Ga0453684_0000919_93940_95076 361
236 3300044712 Ga0453684_0000919 Ga0453684_0000919_95095_96237 361
237 3300044712 Ga0453684_0028193 Ga0453684_0028193_6748_7905 361
238 3300044712 Ga0453684_0099496 Ga0453684_0099496_765_1880 361
239 3300045051 Ga0451576_0000095 Ga0451576_0000095_180755_181912 361
240 3300045051 Ga0451576_0003363 Ga0451576_0003363_10833_11990 361
241 3300045051 Ga0451576_0055975 Ga0451576_0055975_2447_3562 361
242 3300045051 Ga0451576_0132922 Ga0451576_0132922_202_1317 361
243 3300048929 Ga0496126_0020214 Ga0496126_0020214_689_1858 361
244 3300049761 Ga0501264_000050 Ga0501264_000050_12021_13118 361
245 3300053156 Ga0500622_0000203 Ga0500622_0000203_38570_39733 361
246 3300044712 Ga0453684_0214575 Ga0453684_0214575_209_1315 362
247 3300045051 Ga0451576_0067347 Ga0451576_0067347_756_1862 362
248 3300001989 JGI24739J22299_10005677 JGI24739J22299_100056773 363
249 3300003215 JGI25153J46596_10032052 JGI25153J46596_100320522 363
250 3300003771 Ga0055526_1027332 Ga0055526_10273321 363
251 3300025295 Ga0209564_1030995 Ga0209564_10309952 363
252 3300031727 Ga0316576_10001008 Ga0316576_100010087 363
253 3300044712 Ga0453684_0000143 Ga0453684_0000143_45895_47013 363
254 3300045051 Ga0451576_0058706 Ga0451576_0058706_2257_3375 363

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00728

Glyco_hydro_20

Glycosyl hydrolase family 20, catalytic domain

90

382

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
8bal-assembly4.cif.gz_E niako3494, a bacterial protein structure in glycoside hydrolase family 20 0.9514 27 362
8bal-assembly3.cif.gz_D niako3494, a bacterial protein structure in glycoside hydrolase family 20 0.9507 27 362
8bal-assembly1.cif.gz_A niako3494, a bacterial protein structure in glycoside hydrolase family 20 0.9386 27 362
8bal-assembly2.cif.gz_C niako3494, a bacterial protein structure in glycoside hydrolase family 20 0.9363 27 362
8bal-assembly3.cif.gz_D niako3494, a bacterial protein structure in glycoside hydrolase family 20 0.9291 27 362
ID Description Score Start End Superfamily
af_Q8WTK2_49_364_3.20.20.80 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.7347 31 335 3.20.20.80
af_Q3U4H6_6_322_3.20.20.80 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.7316 29 332 3.20.20.80
af_Q9VEB8_189_512_3.20.20.80 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.7299 32 335 3.20.20.80
af_A0A1D6G7A1_170_514_3.20.20.80 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.7276 30 332 3.20.20.80
af_Q54K56_193_563_3.20.20.80 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.723 30 361 3.20.20.80
ID Description Score Start End GO Terms
AF-A0A520J3R2-F1-model_v4 beta-N-acetylhexosaminidase (EC 3.2.1.52) 0.9825 30 347 GO:0005975
GO:0016020
GO:0016231
GO:0030203
AF-A0A1F3PDB6-F1-model_v4 Glycoside hydrolase 0.9797 31 305 GO:0005975
GO:0016231
AF-X1HE18-F1-model_v4 beta-N-acetylhexosaminidase (EC 3.2.1.52) 0.9793 47 362 GO:0005975
GO:0016020
GO:0016231
GO:0030203
AF-A0A354BSF7-F1-model_v4 beta-N-acetylhexosaminidase (EC 3.2.1.52) 0.9771 30 362 GO:0005975
GO:0016020
GO:0016231
GO:0030203
AF-A0A3D3CR34-F1-model_v4 beta-N-acetylhexosaminidase (EC 3.2.1.52) 0.9768 31 283 GO:0005975
GO:0016020
GO:0016231
GO:0030203

Feature Viewer

pLDDT pTM Quality
91.79 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map