F365396

General Info

Members Datasets Scaffolds Average Seq Length
255 151 254 521

Family's Representative Sequence

Representative Sequence 3300005295|Ga0065707_10006787|Ga0065707_100067871
Length 610
Sequence LQSRLLLPDAASSDRVRLLDKTLAEPSIELRKLLRISRTRRRYTNRCREKSAHGCPKFSAEDSGRYKLCCHRNVTLIPLLVLRPFRIVASVETTAQELSISAGKSATGNRRRTAESAIRAFFGSNALVAIIVLTLITIFLFREGSGFFGQNLANLRLYRQAGLEYVDIIRGQAEKQTALSRQLGDIRLQQMRAGADQAALEKFDEFANKFSDTGEQLNGLLSDATDQAQALRETMLQXGSHAGASVAEXESQDEPSAAAAPAGNETEQMSALRSATDKFAQIADSMKAQINELLAAPPALTNAKARKALVKWKAEVEEYLKQLPAVVERLRAWDPNKPVPAYRGITSFLFGTQWITASFWQDWYGIIPLFVGSLMVSVVALLIAVPLGVCGAIYVSEVASPIEKSLIKPYIEFISAIPSVVLGFFGIAVLGETIRAISRASFMQWVPFFPISERLNVFTAGCLLALMAVPTIFTLAEDALRNVPRGFKEASYALGANRFQTILRVLVPAALSGIVSAVLLGLGRVIGETMVVLLCAGNRIAIPDFTQGLGAFFQPVHTMTGIIAQEMGEVVRGSIHYRALFMVGLLLFAITLAINYGAQKLVMRYRMSIG

Samples

Sample ID Description Type Environment
1 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
2 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
58 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
94 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
95 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
96 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
97 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
98 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
99 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
100 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
101 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
102 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
103 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
104 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
105 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
106 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
107 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
108 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
109 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
112 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
113 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
116 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
119 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
120 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
121 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
122 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
123 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
124 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
125 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
126 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
127 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
128 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
129 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
130 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
131 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
132 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
133 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
134 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
135 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
136 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
137 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
138 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
139 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
140 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
141 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
142 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
148 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
149 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
150 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
151 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.61
Metatranscriptomes 0
Isolates 0.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.78
Nodule 0
Rhizoplane 6.27
Rhizosphere 89.41
Stem 0
Stem Tuber 0
Unclassified 3.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNXas_1000112 3300000545 Bacteria 15045
2 JGI25406J46586_10000005 3300003203 Bacteria 118289
3 rootH2_10014434 3300003320 Bacteria 12318
4 rootH2_10035222 3300003320 Bacteria 15394
5 rootH2_10137323 3300003320 Bacteria 3343
6 rootL2_10008384 3300003322 Bacteria 11837
7 rootL2_10162878 3300003322 Bacteria 8183
8 rootH1_10159213 3300003323 Bacteria 6867
9 Ga0065712_10094700 3300005290 Bacteria 2242
10 Ga0065712_10101773 3300005290 Bacteria 2025
11 Ga0065715_10003208 3300005293 Bacteria 4340
12 Ga0065707_10006787 3300005295 Unclassified 2784
13 Ga0070658_10015442 3300005327 Bacteria 6110
14 Ga0070658_10020846 3300005327 Bacteria 5251
15 Ga0070676_10006164 3300005328 Bacteria 6402
16 Ga0070676_10011467 3300005328 Bacteria 4819
17 Ga0070676_10017832 3300005328 Unclassified 3930
18 Ga0070676_10051704 3300005328 Bacteria 2413
19 Ga0070670_100086535 3300005331 Bacteria 2693
20 Ga0068869_100000360 3300005334 Bacteria 24448
21 Ga0068868_100019823 3300005338 Bacteria 5045
22 Ga0068868_100022152 3300005338 Bacteria 4792
23 Ga0068868_100098496 3300005338 Unclassified 2364
24 Ga0070689_100040158 3300005340 Bacteria 3586
25 Ga0070669_100013775 3300005353 Bacteria 5748
26 Ga0070669_100122912 3300005353 Bacteria 1983
27 Ga0070675_100010634 3300005354 Bacteria 7193
28 Ga0070675_100026349 3300005354 Bacteria 4665
29 Ga0070675_100114543 3300005354 Unclassified 2285
30 Ga0070671_100025056 3300005355 Bacteria 4890
31 Ga0070674_100007282 3300005356 Bacteria 6516
32 Ga0070674_100017435 3300005356 Bacteria 4518
33 Ga0070673_100043432 3300005364 Bacteria 3474
34 Ga0070673_100098948 3300005364 Bacteria 2398
35 Ga0070688_100001049 3300005365 Bacteria 13891
36 Ga0070659_100024501 3300005366 Unclassified 4625
37 Ga0070667_100005328 3300005367 Bacteria 10745
38 Ga0070667_100008620 3300005367 Bacteria 8450
39 Ga0070714_100141181 3300005435 Bacteria 2162
40 Ga0070711_100021075 3300005439 Bacteria 4211
41 Ga0070705_100072094 3300005440 Unclassified 2091
42 Ga0070700_100027809 3300005441 Unclassified 3357
43 Ga0070708_100007375 3300005445 Bacteria 8799
44 Ga0070708_100023166 3300005445 Bacteria 5276
45 Ga0070708_100070255 3300005445 Bacteria 3150
46 Ga0070708_100164566 3300005445 Bacteria 2068
47 Ga0070678_100041029 3300005456 Bacteria 3278
48 Ga0070678_100079878 3300005456 Bacteria 2475
49 Ga0068867_100012405 3300005459 Bacteria 6027
50 Ga0070706_100025040 3300005467 Bacteria 5493
51 Ga0070706_100068231 3300005467 Bacteria 3288
52 Ga0070707_100000049 3300005468 Bacteria 102972
53 Ga0070707_100252153 3300005468 Bacteria 1717
54 Ga0070684_100008518 3300005535 Bacteria 8022
55 Ga0070697_100001899 3300005536 Bacteria 15978
56 Ga0070697_100006008 3300005536 Bacteria 9390
57 Ga0070697_100039077 3300005536 Bacteria 3836
58 Ga0070697_100071161 3300005536 Bacteria 2852
59 Ga0070697_100073691 3300005536 Unclassified 2804
60 Ga0070672_100001930 3300005543 Bacteria 13018
61 Ga0070672_100155432 3300005543 Unclassified 1894
62 Ga0070665_100188056 3300005548 Unclassified 2066
63 Ga0068855_100004104 3300005563 Bacteria 17766
64 Ga0068858_100021014 3300005842 Bacteria 6099
65 Ga0068858_100024619 3300005842 Bacteria 5608
66 Ga0068858_100058561 3300005842 Bacteria 3562
67 Ga0068860_100000575 3300005843 Bacteria 44198
68 Ga0081455_10002063 3300005937 Bacteria 24020
69 Ga0081455_10004799 3300005937 Bacteria 15022
70 Ga0081540_1048253 3300005983 Unclassified 2134
71 Ga0081539_10000026 3300005985 Bacteria 330830
72 Ga0081539_10000511 3300005985 Bacteria 80587
73 Ga0081539_10014017 3300005985 Bacteria 5972
74 Ga0070717_10000011 3300006028 Bacteria 233981
75 Ga0070717_10007457 3300006028 Bacteria 8127
76 Ga0070717_10015759 3300006028 Bacteria 5843
77 Ga0097621_100005263 3300006237 Bacteria 9109
78 Ga0068871_100001317 3300006358 Bacteria 16587
79 Ga0068865_100004689 3300006881 Bacteria 8257
80 Ga0111539_10101127 3300009094 Bacteria 3384
81 Ga0105245_10049736 3300009098 Bacteria 3755
82 Ga0105245_10088734 3300009098 Unclassified 2841
83 Ga0114129_10073396 3300009147 Bacteria 4767
84 Ga0105237_10016988 3300009545 Bacteria 7551
85 Ga0105237_10027404 3300009545 Bacteria 5817
86 Ga0157374_10011222 3300013296 Bacteria 7749
87 Ga0157374_10017706 3300013296 Bacteria 6279
88 Ga0157374_10018160 3300013296 Bacteria 6204
89 Ga0157374_10019441 3300013296 Bacteria 6011
90 Ga0157374_10029998 3300013296 Bacteria 4934
91 Ga0157374_10087189 3300013296 Bacteria 2971
92 Ga0157374_10160953 3300013296 Archaea 2186
93 Ga0157378_10029222 3300013297 Bacteria 4866
94 Ga0157378_10060607 3300013297 Unclassified 3376
95 Ga0157378_10063257 3300013297 Bacteria 3306
96 Ga0157378_10092299 3300013297 Unclassified 2754
97 Ga0157378_10103902 3300013297 Unclassified 2597
98 Ga0163162_10004541 3300013306 Bacteria 13373
99 Ga0163162_10012686 3300013306 Bacteria 8225
100 Ga0163162_10033084 3300013306 Bacteria 5136
101 Ga0163162_10072384 3300013306 Bacteria 3502
102 Ga0157375_10004081 3300013308 Bacteria 12660
103 Ga0157375_10006098 3300013308 Bacteria 10508
104 Ga0157375_10205611 3300013308 Unclassified 2125
105 Ga0157376_10023192 3300014969 Bacteria 4854
106 Ga0207666_1002517 3300025271 Bacteria 2212
107 Ga0207673_1001975 3300025290 Unclassified 2292
108 Ga0207697_10004370 3300025315 Bacteria 6762
109 Ga0207697_10005264 3300025315 Bacteria 6030
110 Ga0207697_10009934 3300025315 Bacteria 4088
111 Ga0207697_10010429 3300025315 Unclassified 3972
112 Ga0207688_10001324 3300025901 Bacteria 12871
113 Ga0207688_10003893 3300025901 Bacteria 8140
114 Ga0207688_10007613 3300025901 Bacteria 5895
115 Ga0207680_10007424 3300025903 Bacteria 5343
116 Ga0207680_10027759 3300025903 Bacteria 3157
117 Ga0207685_10011716 3300025905 Bacteria 2648
118 Ga0207699_10022948 3300025906 Bacteria 3389
119 Ga0207645_10002814 3300025907 Bacteria 13507
120 Ga0207645_10008969 3300025907 Bacteria 6945
121 Ga0207645_10024919 3300025907 Bacteria 3875
122 Ga0207645_10028527 3300025907 Bacteria 3603
123 Ga0207645_10045348 3300025907 Unclassified 2810
124 Ga0207684_10005437 3300025910 Bacteria 11748
125 Ga0207671_10016062 3300025914 Bacteria 5833
126 Ga0207671_10027257 3300025914 Bacteria 4271
127 Ga0207663_10133687 3300025916 Unclassified 1718
128 Ga0207657_10023884 3300025919 Bacteria 5679
129 Ga0207657_10119845 3300025919 Bacteria 2165
130 Ga0207646_10000761 3300025922 Bacteria 41842
131 Ga0207659_10071054 3300025926 Unclassified 2540
132 Ga0207700_10056936 3300025928 Unclassified 2945
133 Ga0207664_10017491 3300025929 Bacteria 5258
134 Ga0207664_10237300 3300025929 Unclassified 1587
135 Ga0207644_10010317 3300025931 Bacteria 6156
136 Ga0207644_10026970 3300025931 Bacteria 3966
137 Ga0207644_10031845 3300025931 Bacteria 3677
138 Ga0207690_10053041 3300025932 Unclassified 2719
139 Ga0207706_10001969 3300025933 Bacteria 20134
140 Ga0207706_10066164 3300025933 Unclassified 3181
141 Ga0207670_10079724 3300025936 Bacteria 2287
142 Ga0207704_10028963 3300025938 Bacteria 3081
143 Ga0207691_10000395 3300025940 Bacteria 43692
144 Ga0207691_10006962 3300025940 Bacteria 10907
145 Ga0207689_10001289 3300025942 Bacteria 24149
146 Ga0207689_10033070 3300025942 Unclassified 4298
147 Ga0207667_10035148 3300025949 Bacteria 5377
148 Ga0207651_10130588 3300025960 Bacteria 1922
149 Ga0207651_10133389 3300025960 Unclassified 1905
150 Ga0207668_10073425 3300025972 Unclassified 2451
151 Ga0207658_10106623 3300025986 Unclassified 2206
152 Ga0207677_10032051 3300026023 Bacteria 3374
153 Ga0207703_10014658 3300026035 Bacteria 6116
154 Ga0207703_10042595 3300026035 Bacteria 3642
155 Ga0207703_10092792 3300026035 Unclassified 2542
156 Ga0207678_10007512 3300026067 Bacteria 9636
157 Ga0207708_10022368 3300026075 Unclassified 4774
158 Ga0207702_10001406 3300026078 Bacteria 24034
159 Ga0207648_10005102 3300026089 Bacteria 13303
160 Ga0207648_10006176 3300026089 Bacteria 11934
161 Ga0207683_10007434 3300026121 Bacteria 9393
162 Ga0207683_10010269 3300026121 Bacteria 7984
163 Ga0207683_10069630 3300026121 Bacteria 3107
164 Ga0268266_10056691 3300028379 Bacteria 3370
165 Ga0268265_10018849 3300028380 Bacteria 4788
166 Ga0268265_10081402 3300028380 Bacteria 2557
167 Ga0268264_10000163 3300028381 Bacteria 148007
168 Ga0268264_10182147 3300028381 Unclassified 1909
169 Ga0265319_1006179 3300028563 Bacteria 5587
170 Ga0265319_1010329 3300028563 Bacteria 3902
171 Ga0265334_10000599 3300028573 Bacteria 18222
172 Ga0265318_10000002 3300028577 Bacteria 428208
173 Ga0265323_10000003 3300028653 Bacteria 200487
174 Ga0265323_10004751 3300028653 Bacteria 5823
175 Ga0265322_10000655 3300028654 Bacteria 12985
176 Ga0307511_10000511 3300030521 Bacteria 41762
177 Ga0265320_10003294 3300031240 Bacteria 10899
178 Ga0265331_10005688 3300031250 Bacteria 7485
179 Ga0265327_10000091 3300031251 Bacteria 196369
180 Ga0265327_10002503 3300031251 Bacteria 19206
181 Ga0265327_10006779 3300031251 Bacteria 9038
182 Ga0265316_10004818 3300031344 Bacteria 13311
183 Ga0265316_10090862 3300031344 Bacteria 2330
184 Ga0307408_100000017 3300031548 Bacteria 355890
185 Ga0265313_10000669 3300031595 Bacteria 35282
186 Ga0265313_10002336 3300031595 Bacteria 16601
187 Ga0307508_10000093 3300031616 Bacteria 104212
188 Ga0265314_10001638 3300031711 Bacteria 24539
189 Ga0265314_10003859 3300031711 Bacteria 14300
190 Ga0265314_10004604 3300031711 Bacteria 12726
191 Ga0265342_10009652 3300031712 Bacteria 6769
192 Ga0307410_10000014 3300031852 Bacteria 74664
193 Ga0307409_100002364 3300031995 Bacteria 9811
194 Ga0307416_100000151 3300032002 Bacteria 41211
195 Ga0307414_10150639 3300032004 Unclassified 1835
196 Ga0373946_0034119 3300035171 Unclassified 2053
197 Ga0373937_0061374 3300036401 Bacteria 3456
198 Ga0373925_0012027 3300037068 Bacteria 6267
199 Ga0395900_0054860 3300037418 Bacteria 4103
200 Ga0395898_0078112 3300037466 Bacteria 3194
201 Ga0395905_0000426 3300037471 Bacteria 58859
202 Ga0395901_0018755 3300038443 Bacteria 7068
203 Ga0439451_007347 3300042009 Bacteria 2248
204 Ga0451577_0000024 3300042876 Bacteria 411758
205 Ga0451577_0034835 3300042876 Bacteria 4537
206 Ga0451577_0038359 3300042876 Bacteria 4310
207 Ga0451577_0168214 3300042876 Bacteria 1975
208 Ga0453683_0002309 3300044673 Bacteria 14995
209 Ga0453684_0000001 3300044712 Bacteria 2623166
210 Ga0453684_0009413 3300044712 Bacteria 17090
211 Ga0453684_0013450 3300044712 Bacteria 13288
212 Ga0453684_0089128 3300044712 Bacteria 3817
213 Ga0451576_0001292 3300045051 Bacteria 43381
214 Ga0451576_0005144 3300045051 Bacteria 16566
215 Ga0451576_0008301 3300045051 Bacteria 12207
216 Ga0451576_0019264 3300045051 Bacteria 7450
217 Ga0451576_0040001 3300045051 Bacteria 4964
218 Ga0451576_0041244 3300045051 Bacteria 4881
219 Ga0451576_0136800 3300045051 Bacteria 2555
220 Ga0495592_0009261 3300046454 Bacteria 7407
221 Ga0495618_0032012 3300046514 Bacteria 3294
222 Ga0495628_0112560 3300046516 Bacteria 2092
223 Ga0495652_0020197 3300046529 Bacteria 5921
224 Ga0495659_0004275 3300046664 Bacteria 4503
225 Ga0495599_0042644 3300046678 Unclassified 2847
226 Ga0495669_0022405 3300046684 Unclassified 2743
227 Ga0495684_0045046 3300047471 Bacteria 3376
228 Ga0496100_0047206 3300048903 Bacteria 2773
229 Ga0496101_0042269 3300048904 Unclassified 3253
230 Ga0496104_0133957 3300048907 Bacteria 2380
231 Ga0496106_0005830 3300048909 Bacteria 9110
232 Ga0496106_0083763 3300048909 Unclassified 2453
233 Ga0496108_0110129 3300048911 Bacteria 2354
234 Ga0496109_0001915 3300048912 Bacteria 17286
235 Ga0496109_0016749 3300048912 Bacteria 6413
236 Ga0496109_0060933 3300048912 Bacteria 3449
237 Ga0496109_0114552 3300048912 Bacteria 2508
238 Ga0496109_0145052 3300048912 Unclassified 2221
239 Ga0496110_0108453 3300048913 Unclassified 2493
240 Ga0496112_0076527 3300048915 Unclassified 3310
241 Ga0496114_0166724 3300048917 Unclassified 1918
242 Ga0496115_0014030 3300048918 Bacteria 6065
243 Ga0496115_0092349 3300048918 Unclassified 2474
244 Ga0501032_0020693 3300049569 Bacteria 4580
245 Ga0501033_0002474 3300049570 Bacteria 15659
246 Ga0501037_0012626 3300049573 Bacteria 6224
247 Ga0501046_0001850 3300049580 Bacteria 20144
248 Ga0501047_0207720 3300049581 Bacteria 1817
249 Ga0501083_0009171 3300049744 Bacteria 6990
250 nmdc:mga05p37_167777_c1 3300050507 Bacteria 2678
251 nmdc:mga05p37_79891_c1 3300050507 Bacteria 4027
252 nmdc:mga08y16_168366_c1 3300050511 Bacteria 2276
253 Ga0500555_000003 3300053103 Bacteria 392994
254 Ga0500622_0057936 3300053156 Bacteria 1981

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042876 Ga0451577_0168214 Ga0451577_0168214_40_1440 446
2 3300005543 Ga0070672_100001930 Ga0070672_1000019308 449
3 3300026089 Ga0207648_10006176 Ga0207648_100061767 449
4 3300005338 Ga0068868_100022152 Ga0068868_1000221526 457
5 3300005340 Ga0070689_100040158 Ga0070689_1000401583 457
6 3300005353 Ga0070669_100013775 Ga0070669_1000137754 457
7 3300005354 Ga0070675_100026349 Ga0070675_1000263492 457
8 3300005356 Ga0070674_100017435 Ga0070674_1000174352 457
9 3300005365 Ga0070688_100001049 Ga0070688_10000104912 457
10 3300005367 Ga0070667_100005328 Ga0070667_1000053288 457
11 3300013306 Ga0163162_10004541 Ga0163162_100045412 457
12 3300013308 Ga0157375_10006098 Ga0157375_100060983 457
13 3300025901 Ga0207688_10001324 Ga0207688_100013245 457
14 3300025907 Ga0207645_10024919 Ga0207645_100249192 457
15 3300025940 Ga0207691_10000395 Ga0207691_1000039524 457
16 3300026121 Ga0207683_10007434 Ga0207683_100074349 457
17 3300048912 Ga0496109_0145052 Ga0496109_0145052_113_1705 457
18 3300013296 Ga0157374_10087189 Ga0157374_100871892 465
19 3300050507 nmdc:mga05p37_167777_c1 nmdc:mga05p37_167777_c1_224_1867 465
20 3300025936 Ga0207670_10079724 Ga0207670_100797241 472
21 3300044712 Ga0453684_0000001 Ga0453684_0000001_739075_740724 472
22 3300046454 Ga0495592_0009261 Ga0495592_0009261_2053_3651 472
23 3300046516 Ga0495628_0112560 Ga0495628_0112560_242_1840 472
24 3300046678 Ga0495599_0042644 Ga0495599_0042644_234_1832 472
25 3300005354 Ga0070675_100010634 Ga0070675_1000106349 474
26 3300005937 Ga0081455_10004799 Ga0081455_1000479914 474
27 3300025315 Ga0207697_10005264 Ga0207697_100052645 474
28 3300045051 Ga0451576_0005144 Ga0451576_0005144_8064_9668 476
29 3300009147 Ga0114129_10073396 Ga0114129_100733962 477
30 3300042876 Ga0451577_0000024 Ga0451577_0000024_257667_259325 478
31 3300044673 Ga0453683_0002309 Ga0453683_0002309_4760_6307 480
32 3300045051 Ga0451576_0041244 Ga0451576_0041244_3225_4772 481
33 3300005353 Ga0070669_100122912 Ga0070669_1001229122 482
34 3300003322 rootL2_10162878 rootL2_101628785 483
35 3300005985 Ga0081539_10014017 Ga0081539_100140175 483
36 3300009545 Ga0105237_10016988 Ga0105237_100169883 483
37 3300025914 Ga0207671_10027257 Ga0207671_100272573 483
38 3300005293 Ga0065715_10003208 Ga0065715_100032083 484
39 3300005327 Ga0070658_10015442 Ga0070658_100154424 484
40 3300005445 Ga0070708_100070255 Ga0070708_1000702553 485
41 3300005842 Ga0068858_100058561 Ga0068858_1000585612 486
42 3300025919 Ga0207657_10119845 Ga0207657_101198452 486
43 3300026035 Ga0207703_10042595 Ga0207703_100425952 486
44 3300045051 Ga0451576_0019264 Ga0451576_0019264_1199_2791 486
45 3300042876 Ga0451577_0038359 Ga0451577_0038359_2751_4298 488
46 3300005328 Ga0070676_10006164 Ga0070676_100061645 489
47 3300005355 Ga0070671_100025056 Ga0070671_1000250562 489
48 3300032004 Ga0307414_10150639 Ga0307414_101506391 489
49 3300037068 Ga0373925_0012027 Ga0373925_0012027_51_1556 489
50 3300046664 Ga0495659_0004275 Ga0495659_0004275_498_2003 489
51 3300046684 Ga0495669_0022405 Ga0495669_0022405_57_1562 489
52 3300047471 Ga0495684_0045046 Ga0495684_0045046_36_1562 489
53 3300005467 Ga0070706_100068231 Ga0070706_1000682312 490
54 3300005843 Ga0068860_100000575 Ga0068860_10000057516 490
55 3300028381 Ga0268264_10000163 Ga0268264_10000163119 490
56 3300031251 Ga0265327_10006779 Ga0265327_100067794 490
57 3300031344 Ga0265316_10090862 Ga0265316_100908622 491
58 3300050507 nmdc:mga05p37_79891_c1 nmdc:mga05p37_79891_c1_1775_3367 491
59 3300005334 Ga0068869_100000360 Ga0068869_1000003608 492
60 3300005338 Ga0068868_100019823 Ga0068868_1000198233 492
61 3300005445 Ga0070708_100164566 Ga0070708_1001645661 492
62 3300005459 Ga0068867_100012405 Ga0068867_1000124054 492
63 3300006358 Ga0068871_100001317 Ga0068871_1000013173 492
64 3300006881 Ga0068865_100004689 Ga0068865_1000046894 492
65 3300025929 Ga0207664_10017491 Ga0207664_100174912 492
66 3300025938 Ga0207704_10028963 Ga0207704_100289633 492
67 3300025942 Ga0207689_10001289 Ga0207689_100012894 492
68 3300026023 Ga0207677_10032051 Ga0207677_100320513 492
69 3300026089 Ga0207648_10005102 Ga0207648_100051023 492
70 3300045051 Ga0451576_0040001 Ga0451576_0040001_989_2593 492
71 3300009094 Ga0111539_10101127 Ga0111539_101011272 493
72 3300050511 nmdc:mga08y16_168366_c1 nmdc:mga08y16_168366_c1_165_1766 493
73 3300005937 Ga0081455_10002063 Ga0081455_1000206324 494
74 3300006028 Ga0070717_10007457 Ga0070717_100074572 494
75 3300005536 Ga0070697_100071161 Ga0070697_1000711612 496
76 3300045051 Ga0451576_0001292 Ga0451576_0001292_17133_18737 496
77 3300005290 Ga0065712_10101773 Ga0065712_101017731 497
78 3300005328 Ga0070676_10011467 Ga0070676_100114678 497
79 3300005354 Ga0070675_100114543 Ga0070675_1001145432 497
80 3300005364 Ga0070673_100043432 Ga0070673_1000434323 497
81 3300005435 Ga0070714_100141181 Ga0070714_1001411811 497
82 3300005456 Ga0070678_100079878 Ga0070678_1000798782 497
83 3300005468 Ga0070707_100252153 Ga0070707_1002521531 497
84 3300005543 Ga0070672_100155432 Ga0070672_1001554322 497
85 3300006028 Ga0070717_10015759 Ga0070717_100157595 497
86 3300013296 Ga0157374_10017706 Ga0157374_100177067 497
87 3300013296 Ga0157374_10019441 Ga0157374_100194414 497
88 3300013297 Ga0157378_10029222 Ga0157378_100292224 497
89 3300013297 Ga0157378_10092299 Ga0157378_100922992 497
90 3300013306 Ga0163162_10072384 Ga0163162_100723842 497
91 3300013308 Ga0157375_10205611 Ga0157375_102056111 497
92 3300025290 Ga0207673_1001975 Ga0207673_10019752 497
93 3300025315 Ga0207697_10004370 Ga0207697_100043702 497
94 3300025315 Ga0207697_10009934 Ga0207697_100099344 497
95 3300025901 Ga0207688_10003893 Ga0207688_100038931 497
96 3300025903 Ga0207680_10007424 Ga0207680_100074243 497
97 3300025905 Ga0207685_10011716 Ga0207685_100117162 497
98 3300025906 Ga0207699_10022948 Ga0207699_100229483 497
99 3300025907 Ga0207645_10028527 Ga0207645_100285274 497
100 3300025907 Ga0207645_10045348 Ga0207645_100453482 497
101 3300025916 Ga0207663_10133687 Ga0207663_101336871 497
102 3300025928 Ga0207700_10056936 Ga0207700_100569362 497
103 3300025929 Ga0207664_10237300 Ga0207664_102373001 497
104 3300025960 Ga0207651_10133389 Ga0207651_101333891 497
105 3300025986 Ga0207658_10106623 Ga0207658_101066232 497
106 3300026121 Ga0207683_10069630 Ga0207683_100696302 497
107 3300028380 Ga0268265_10081402 Ga0268265_100814021 497
108 3300028381 Ga0268264_10182147 Ga0268264_101821471 497
109 3300028653 Ga0265323_10004751 Ga0265323_100047513 497
110 3300037418 Ga0395900_0054860 Ga0395900_0054860_2392_3924 497
111 3300037466 Ga0395898_0078112 Ga0395898_0078112_1391_2923 497
112 3300038443 Ga0395901_0018755 Ga0395901_0018755_1188_2720 497
113 3300048903 Ga0496100_0047206 Ga0496100_0047206_187_1719 497
114 3300048904 Ga0496101_0042269 Ga0496101_0042269_1285_2817 497
115 3300048907 Ga0496104_0133957 Ga0496104_0133957_73_1605 497
116 3300048909 Ga0496106_0005830 Ga0496106_0005830_6513_8045 497
117 3300048911 Ga0496108_0110129 Ga0496108_0110129_686_2221 497
118 3300048912 Ga0496109_0016749 Ga0496109_0016749_4689_6221 497
119 3300048912 Ga0496109_0060933 Ga0496109_0060933_590_2125 497
120 3300048913 Ga0496110_0108453 Ga0496110_0108453_368_1900 497
121 3300048915 Ga0496112_0076527 Ga0496112_0076527_1278_2810 497
122 3300048917 Ga0496114_0166724 Ga0496114_0166724_31_1563 497
123 3300048918 Ga0496115_0092349 Ga0496115_0092349_332_1864 497
124 3300013297 Ga0157378_10063257 Ga0157378_100632572 498
125 3300003203 JGI25406J46586_10000005 JGI25406J46586_1000000564 499
126 3300005327 Ga0070658_10020846 Ga0070658_100208463 499
127 3300005366 Ga0070659_100024501 Ga0070659_1000245012 499
128 3300005440 Ga0070705_100072094 Ga0070705_1000720941 499
129 3300005441 Ga0070700_100027809 Ga0070700_1000278092 499
130 3300005535 Ga0070684_100008518 Ga0070684_1000085185 499
131 3300005536 Ga0070697_100006008 Ga0070697_1000060084 499
132 3300005842 Ga0068858_100024619 Ga0068858_1000246194 499
133 3300005985 Ga0081539_10000026 Ga0081539_10000026240 499
134 3300025315 Ga0207697_10010429 Ga0207697_100104293 499
135 3300025919 Ga0207657_10023884 Ga0207657_100238844 499
136 3300025926 Ga0207659_10071054 Ga0207659_100710541 499
137 3300025932 Ga0207690_10053041 Ga0207690_100530412 499
138 3300025933 Ga0207706_10066164 Ga0207706_100661642 499
139 3300026035 Ga0207703_10092792 Ga0207703_100927921 499
140 3300026075 Ga0207708_10022368 Ga0207708_100223684 499
141 3300028563 Ga0265319_1006179 Ga0265319_10061793 499
142 3300031250 Ga0265331_10005688 Ga0265331_100056882 499
143 3300048909 Ga0496106_0083763 Ga0496106_0083763_187_1776 499
144 3300005456 Ga0070678_100041029 Ga0070678_1000410293 500
145 3300014969 Ga0157376_10023192 Ga0157376_100231922 500
146 3300026121 Ga0207683_10010269 Ga0207683_100102693 500
147 3300049569 Ga0501032_0020693 Ga0501032_0020693_201_1817 500
148 3300049570 Ga0501033_0002474 Ga0501033_0002474_4587_6203 500
149 3300049573 Ga0501037_0012626 Ga0501037_0012626_2584_4200 500
150 3300049580 Ga0501046_0001850 Ga0501046_0001850_16487_18103 500
151 3300049581 Ga0501047_0207720 Ga0501047_0207720_130_1746 500
152 3300003322 rootL2_10008384 rootL2_100083848 501
153 3300005328 Ga0070676_10051704 Ga0070676_100517041 501
154 3300005356 Ga0070674_100007282 Ga0070674_1000072826 501
155 3300005364 Ga0070673_100098948 Ga0070673_1000989481 501
156 3300009545 Ga0105237_10027404 Ga0105237_100274043 501
157 3300013296 Ga0157374_10029998 Ga0157374_100299985 501
158 3300025901 Ga0207688_10007613 Ga0207688_100076136 501
159 3300025903 Ga0207680_10027759 Ga0207680_100277592 501
160 3300025907 Ga0207645_10002814 Ga0207645_100028147 501
161 3300025914 Ga0207671_10016062 Ga0207671_100160623 501
162 3300025931 Ga0207644_10026970 Ga0207644_100269702 501
163 3300025940 Ga0207691_10006962 Ga0207691_100069626 501
164 3300025960 Ga0207651_10130588 Ga0207651_101305882 501
165 3300028379 Ga0268266_10056691 Ga0268266_100566912 501
166 3300031548 Ga0307408_100000017 Ga0307408_100000017300 501
167 3300031852 Ga0307410_10000014 Ga0307410_100000144 501
168 3300031995 Ga0307409_100002364 Ga0307409_1000023644 501
169 3300032002 Ga0307416_100000151 Ga0307416_10000015125 501
170 3300005295 Ga0065707_10006787 Ga0065707_100067871 502
171 3300005328 Ga0070676_10017832 Ga0070676_100178324 502
172 3300005338 Ga0068868_100098496 Ga0068868_1000984961 502
173 3300005367 Ga0070667_100008620 Ga0070667_1000086203 502
174 3300005439 Ga0070711_100021075 Ga0070711_1000210755 502
175 3300005445 Ga0070708_100007375 Ga0070708_1000073759 502
176 3300005445 Ga0070708_100023166 Ga0070708_1000231663 502
177 3300005467 Ga0070706_100025040 Ga0070706_1000250405 502
178 3300005468 Ga0070707_100000049 Ga0070707_10000004917 502
179 3300005536 Ga0070697_100001899 Ga0070697_10000189913 502
180 3300005536 Ga0070697_100039077 Ga0070697_1000390773 502
181 3300005536 Ga0070697_100073691 Ga0070697_1000736912 502
182 3300009098 Ga0105245_10088734 Ga0105245_100887341 502
183 3300013296 Ga0157374_10018160 Ga0157374_100181601 502
184 3300013296 Ga0157374_10160953 Ga0157374_101609532 502
185 3300013306 Ga0163162_10033084 Ga0163162_100330842 502
186 3300025271 Ga0207666_1002517 Ga0207666_10025171 502
187 3300025907 Ga0207645_10008969 Ga0207645_100089692 502
188 3300025910 Ga0207684_10005437 Ga0207684_100054379 502
189 3300025922 Ga0207646_10000761 Ga0207646_1000076114 502
190 3300025933 Ga0207706_10001969 Ga0207706_1000196910 502
191 3300025942 Ga0207689_10033070 Ga0207689_100330704 502
192 3300025972 Ga0207668_10073425 Ga0207668_100734252 502
193 3300026067 Ga0207678_10007512 Ga0207678_1000751210 502
194 3300028380 Ga0268265_10018849 Ga0268265_100188493 502
195 3300028563 Ga0265319_1010329 Ga0265319_10103292 502
196 3300042009 Ga0439451_007347 Ga0439451_007347_368_1960 502
197 3300045051 Ga0451576_0136800 Ga0451576_0136800_92_1684 502
198 3300048912 Ga0496109_0001915 Ga0496109_0001915_15288_16850 502
199 3300048912 Ga0496109_0114552 Ga0496109_0114552_607_2166 502
200 3300048918 Ga0496115_0014030 Ga0496115_0014030_293_1852 502
201 3300005290 Ga0065712_10094700 Ga0065712_100947002 503
202 3300005331 Ga0070670_100086535 Ga0070670_1000865352 503
203 3300005548 Ga0070665_100188056 Ga0070665_1001880562 503
204 3300005983 Ga0081540_1048253 Ga0081540_10482531 503
205 3300006237 Ga0097621_100005263 Ga0097621_1000052633 503
206 3300013296 Ga0157374_10011222 Ga0157374_100112227 503
207 3300013306 Ga0163162_10012686 Ga0163162_100126866 503
208 3300013308 Ga0157375_10004081 Ga0157375_100040813 503
209 3300025931 Ga0207644_10010317 Ga0207644_100103177 503
210 iso_pu_bacteria 2786546940 2788435586 505
211 3300030521 Ga0307511_10000511 Ga0307511_1000051129 506
212 3300031251 Ga0265327_10002503 Ga0265327_100025035 508
213 3300042876 Ga0451577_0034835 Ga0451577_0034835_961_2649 508
214 3300003320 rootH2_10035222 rootH2_1003522212 509
215 3300003320 rootH2_10137323 rootH2_101373232 509
216 3300003323 rootH1_10159213 rootH1_101592132 509
217 3300026078 Ga0207702_10001406 Ga0207702_1000140618 509
218 3300028573 Ga0265334_10000599 Ga0265334_100005993 509
219 3300028577 Ga0265318_10000002 Ga0265318_10000002330 509
220 3300028653 Ga0265323_10000003 Ga0265323_10000003122 509
221 3300028654 Ga0265322_10000655 Ga0265322_100006554 509
222 3300031240 Ga0265320_10003294 Ga0265320_100032949 509
223 3300031344 Ga0265316_10004818 Ga0265316_100048184 509
224 3300031595 Ga0265313_10002336 Ga0265313_100023369 509
225 3300031711 Ga0265314_10001638 Ga0265314_1000163811 509
226 3300031712 Ga0265342_10009652 Ga0265342_100096525 509
227 3300044712 Ga0453684_0013450 Ga0453684_0013450_6093_7700 509
228 3300045051 Ga0451576_0008301 Ga0451576_0008301_8220_9869 509
229 3300053103 Ga0500555_000003 Ga0500555_000003_193896_195581 509
230 3300003320 rootH2_10014434 rootH2_100144348 510
231 3300006028 Ga0070717_10000011 Ga0070717_10000011113 510
232 3300013297 Ga0157378_10060607 Ga0157378_100606072 510
233 3300031251 Ga0265327_10000091 Ga0265327_10000091187 510
234 3300031595 Ga0265313_10000669 Ga0265313_1000066913 510
235 3300031616 Ga0307508_10000093 Ga0307508_1000009355 510
236 3300031711 Ga0265314_10003859 Ga0265314_100038599 510
237 3300031711 Ga0265314_10004604 Ga0265314_100046045 510
238 3300035171 Ga0373946_0034119 Ga0373946_0034119_110_1729 510
239 3300036401 Ga0373937_0061374 Ga0373937_0061374_332_1951 510
240 3300037471 Ga0395905_0000426 Ga0395905_0000426_25379_26980 510
241 3300044712 Ga0453684_0009413 Ga0453684_0009413_4637_6286 510
242 3300044712 Ga0453684_0089128 Ga0453684_0089128_1964_3610 510
243 3300046514 Ga0495618_0032012 Ga0495618_0032012_136_1755 510
244 3300046529 Ga0495652_0020197 Ga0495652_0020197_2840_4459 510
245 3300049744 Ga0501083_0009171 Ga0501083_0009171_4538_6397 510
246 3300000545 CNXas_1000112 CNXas_10001127 511
247 3300005563 Ga0068855_100004104 Ga0068855_1000041048 511
248 3300005842 Ga0068858_100021014 Ga0068858_1000210142 511
249 3300005985 Ga0081539_10000511 Ga0081539_1000051112 511
250 3300009098 Ga0105245_10049736 Ga0105245_100497363 511
251 3300013297 Ga0157378_10103902 Ga0157378_101039022 511
252 3300025931 Ga0207644_10031845 Ga0207644_100318452 511
253 3300025949 Ga0207667_10035148 Ga0207667_100351481 511
254 3300026035 Ga0207703_10014658 Ga0207703_100146582 511
255 3300053156 Ga0500622_0057936 Ga0500622_0057936_224_1897 511

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

384

604

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.7862 270 505
3dhw-assembly2.cif.gz_F crystal structure of methionine importer metni 0.7518 270 499
3dhw-assembly1.cif.gz_A crystal structure of methionine importer metni 0.7491 267 497
3dhw-assembly2.cif.gz_F crystal structure of methionine importer metni 0.7386 270 499
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.7261 270 505
ID Description Score Start End Superfamily
af_Q2FYP8_79_307_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8258 265 509 1.10.3720.10
af_Q2FYP8_79_307_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8224 265 509 1.10.3720.10
3tuzF00 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7862 270 505 1.10.3720.10
af_Q2G225_74_270_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7824 265 505 1.10.3720.10
af_Q2G225_74_270_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7754 265 505 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A377C8X3-F1-model_v4 Phosphate transporter permease subunit PstC 0.8663 267 425 GO:0005886
GO:0006817
GO:0055085
AF-A0A7V4Y2N9-F1-model_v4 Phosphate transport system permease protein 0.8412 267 510 GO:0005315
GO:0005886
GO:0006817
AF-A0A7Y5SL38-F1-model_v4 Phosphate transport system permease protein 0.8382 246 507 GO:0005315
GO:0005886
GO:0006817
AF-A0A1V5KHN3-F1-model_v4 Phosphate transport system permease protein 0.8229 273 505 GO:0005315
GO:0005886
GO:0006817
AF-A0A5C8D3V3-F1-model_v4 Phosphate ABC transporter permease subunit PstC 0.8226 244 503 GO:0005315
GO:0005886
GO:0035435

Feature Viewer

pLDDT pTM Quality
72.28 0.55 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map