F365396
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 255 | 151 | 254 | 521 |
Family's Representative Sequence
| Representative Sequence | 3300005295|Ga0065707_10006787|Ga0065707_100067871 |
| Length | 610 |
| Sequence | LQSRLLLPDAASSDRVRLLDKTLAEPSIELRKLLRISRTRRRYTNRCREKSAHGCPKFSAEDSGRYKLCCHRNVTLIPLLVLRPFRIVASVETTAQELSISAGKSATGNRRRTAESAIRAFFGSNALVAIIVLTLITIFLFREGSGFFGQNLANLRLYRQAGLEYVDIIRGQAEKQTALSRQLGDIRLQQMRAGADQAALEKFDEFANKFSDTGEQLNGLLSDATDQAQALRETMLQXGSHAGASVAEXESQDEPSAAAAPAGNETEQMSALRSATDKFAQIADSMKAQINELLAAPPALTNAKARKALVKWKAEVEEYLKQLPAVVERLRAWDPNKPVPAYRGITSFLFGTQWITASFWQDWYGIIPLFVGSLMVSVVALLIAVPLGVCGAIYVSEVASPIEKSLIKPYIEFISAIPSVVLGFFGIAVLGETIRAISRASFMQWVPFFPISERLNVFTAGCLLALMAVPTIFTLAEDALRNVPRGFKEASYALGANRFQTILRVLVPAALSGIVSAVLLGLGRVIGETMVVLLCAGNRIAIPDFTQGLGAFFQPVHTMTGIIAQEMGEVVRGSIHYRALFMVGLLLFAITLAINYGAQKLVMRYRMSIG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2786546940 | Opitutaceae bacterium EW11 | Isolate | Unclassified |
| 2 | 3300000545 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 38 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 39 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 40 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 41 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 42 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 43 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 46 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 47 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 94 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 95 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 96 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 97 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 98 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 99 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 100 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 101 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 102 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 103 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 104 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 105 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 106 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 107 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 108 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 109 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 110 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 111 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 112 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 113 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 114 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 115 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 116 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 117 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 118 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 119 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 120 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 121 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 122 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 123 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 124 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 133 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 134 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 135 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 136 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 137 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 138 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 139 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 140 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 141 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 142 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 143 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 144 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 145 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 146 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 147 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 148 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 149 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 150 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 151 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.61 |
| Metatranscriptomes | 0 |
| Isolates | 0.39 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.78 |
| Nodule | 0 |
| Rhizoplane | 6.27 |
| Rhizosphere | 89.41 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.53 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | CNXas_1000112 | 3300000545 | Bacteria | 15045 |
| 2 | JGI25406J46586_10000005 | 3300003203 | Bacteria | 118289 |
| 3 | rootH2_10014434 | 3300003320 | Bacteria | 12318 |
| 4 | rootH2_10035222 | 3300003320 | Bacteria | 15394 |
| 5 | rootH2_10137323 | 3300003320 | Bacteria | 3343 |
| 6 | rootL2_10008384 | 3300003322 | Bacteria | 11837 |
| 7 | rootL2_10162878 | 3300003322 | Bacteria | 8183 |
| 8 | rootH1_10159213 | 3300003323 | Bacteria | 6867 |
| 9 | Ga0065712_10094700 | 3300005290 | Bacteria | 2242 |
| 10 | Ga0065712_10101773 | 3300005290 | Bacteria | 2025 |
| 11 | Ga0065715_10003208 | 3300005293 | Bacteria | 4340 |
| 12 | Ga0065707_10006787 | 3300005295 | Unclassified | 2784 |
| 13 | Ga0070658_10015442 | 3300005327 | Bacteria | 6110 |
| 14 | Ga0070658_10020846 | 3300005327 | Bacteria | 5251 |
| 15 | Ga0070676_10006164 | 3300005328 | Bacteria | 6402 |
| 16 | Ga0070676_10011467 | 3300005328 | Bacteria | 4819 |
| 17 | Ga0070676_10017832 | 3300005328 | Unclassified | 3930 |
| 18 | Ga0070676_10051704 | 3300005328 | Bacteria | 2413 |
| 19 | Ga0070670_100086535 | 3300005331 | Bacteria | 2693 |
| 20 | Ga0068869_100000360 | 3300005334 | Bacteria | 24448 |
| 21 | Ga0068868_100019823 | 3300005338 | Bacteria | 5045 |
| 22 | Ga0068868_100022152 | 3300005338 | Bacteria | 4792 |
| 23 | Ga0068868_100098496 | 3300005338 | Unclassified | 2364 |
| 24 | Ga0070689_100040158 | 3300005340 | Bacteria | 3586 |
| 25 | Ga0070669_100013775 | 3300005353 | Bacteria | 5748 |
| 26 | Ga0070669_100122912 | 3300005353 | Bacteria | 1983 |
| 27 | Ga0070675_100010634 | 3300005354 | Bacteria | 7193 |
| 28 | Ga0070675_100026349 | 3300005354 | Bacteria | 4665 |
| 29 | Ga0070675_100114543 | 3300005354 | Unclassified | 2285 |
| 30 | Ga0070671_100025056 | 3300005355 | Bacteria | 4890 |
| 31 | Ga0070674_100007282 | 3300005356 | Bacteria | 6516 |
| 32 | Ga0070674_100017435 | 3300005356 | Bacteria | 4518 |
| 33 | Ga0070673_100043432 | 3300005364 | Bacteria | 3474 |
| 34 | Ga0070673_100098948 | 3300005364 | Bacteria | 2398 |
| 35 | Ga0070688_100001049 | 3300005365 | Bacteria | 13891 |
| 36 | Ga0070659_100024501 | 3300005366 | Unclassified | 4625 |
| 37 | Ga0070667_100005328 | 3300005367 | Bacteria | 10745 |
| 38 | Ga0070667_100008620 | 3300005367 | Bacteria | 8450 |
| 39 | Ga0070714_100141181 | 3300005435 | Bacteria | 2162 |
| 40 | Ga0070711_100021075 | 3300005439 | Bacteria | 4211 |
| 41 | Ga0070705_100072094 | 3300005440 | Unclassified | 2091 |
| 42 | Ga0070700_100027809 | 3300005441 | Unclassified | 3357 |
| 43 | Ga0070708_100007375 | 3300005445 | Bacteria | 8799 |
| 44 | Ga0070708_100023166 | 3300005445 | Bacteria | 5276 |
| 45 | Ga0070708_100070255 | 3300005445 | Bacteria | 3150 |
| 46 | Ga0070708_100164566 | 3300005445 | Bacteria | 2068 |
| 47 | Ga0070678_100041029 | 3300005456 | Bacteria | 3278 |
| 48 | Ga0070678_100079878 | 3300005456 | Bacteria | 2475 |
| 49 | Ga0068867_100012405 | 3300005459 | Bacteria | 6027 |
| 50 | Ga0070706_100025040 | 3300005467 | Bacteria | 5493 |
| 51 | Ga0070706_100068231 | 3300005467 | Bacteria | 3288 |
| 52 | Ga0070707_100000049 | 3300005468 | Bacteria | 102972 |
| 53 | Ga0070707_100252153 | 3300005468 | Bacteria | 1717 |
| 54 | Ga0070684_100008518 | 3300005535 | Bacteria | 8022 |
| 55 | Ga0070697_100001899 | 3300005536 | Bacteria | 15978 |
| 56 | Ga0070697_100006008 | 3300005536 | Bacteria | 9390 |
| 57 | Ga0070697_100039077 | 3300005536 | Bacteria | 3836 |
| 58 | Ga0070697_100071161 | 3300005536 | Bacteria | 2852 |
| 59 | Ga0070697_100073691 | 3300005536 | Unclassified | 2804 |
| 60 | Ga0070672_100001930 | 3300005543 | Bacteria | 13018 |
| 61 | Ga0070672_100155432 | 3300005543 | Unclassified | 1894 |
| 62 | Ga0070665_100188056 | 3300005548 | Unclassified | 2066 |
| 63 | Ga0068855_100004104 | 3300005563 | Bacteria | 17766 |
| 64 | Ga0068858_100021014 | 3300005842 | Bacteria | 6099 |
| 65 | Ga0068858_100024619 | 3300005842 | Bacteria | 5608 |
| 66 | Ga0068858_100058561 | 3300005842 | Bacteria | 3562 |
| 67 | Ga0068860_100000575 | 3300005843 | Bacteria | 44198 |
| 68 | Ga0081455_10002063 | 3300005937 | Bacteria | 24020 |
| 69 | Ga0081455_10004799 | 3300005937 | Bacteria | 15022 |
| 70 | Ga0081540_1048253 | 3300005983 | Unclassified | 2134 |
| 71 | Ga0081539_10000026 | 3300005985 | Bacteria | 330830 |
| 72 | Ga0081539_10000511 | 3300005985 | Bacteria | 80587 |
| 73 | Ga0081539_10014017 | 3300005985 | Bacteria | 5972 |
| 74 | Ga0070717_10000011 | 3300006028 | Bacteria | 233981 |
| 75 | Ga0070717_10007457 | 3300006028 | Bacteria | 8127 |
| 76 | Ga0070717_10015759 | 3300006028 | Bacteria | 5843 |
| 77 | Ga0097621_100005263 | 3300006237 | Bacteria | 9109 |
| 78 | Ga0068871_100001317 | 3300006358 | Bacteria | 16587 |
| 79 | Ga0068865_100004689 | 3300006881 | Bacteria | 8257 |
| 80 | Ga0111539_10101127 | 3300009094 | Bacteria | 3384 |
| 81 | Ga0105245_10049736 | 3300009098 | Bacteria | 3755 |
| 82 | Ga0105245_10088734 | 3300009098 | Unclassified | 2841 |
| 83 | Ga0114129_10073396 | 3300009147 | Bacteria | 4767 |
| 84 | Ga0105237_10016988 | 3300009545 | Bacteria | 7551 |
| 85 | Ga0105237_10027404 | 3300009545 | Bacteria | 5817 |
| 86 | Ga0157374_10011222 | 3300013296 | Bacteria | 7749 |
| 87 | Ga0157374_10017706 | 3300013296 | Bacteria | 6279 |
| 88 | Ga0157374_10018160 | 3300013296 | Bacteria | 6204 |
| 89 | Ga0157374_10019441 | 3300013296 | Bacteria | 6011 |
| 90 | Ga0157374_10029998 | 3300013296 | Bacteria | 4934 |
| 91 | Ga0157374_10087189 | 3300013296 | Bacteria | 2971 |
| 92 | Ga0157374_10160953 | 3300013296 | Archaea | 2186 |
| 93 | Ga0157378_10029222 | 3300013297 | Bacteria | 4866 |
| 94 | Ga0157378_10060607 | 3300013297 | Unclassified | 3376 |
| 95 | Ga0157378_10063257 | 3300013297 | Bacteria | 3306 |
| 96 | Ga0157378_10092299 | 3300013297 | Unclassified | 2754 |
| 97 | Ga0157378_10103902 | 3300013297 | Unclassified | 2597 |
| 98 | Ga0163162_10004541 | 3300013306 | Bacteria | 13373 |
| 99 | Ga0163162_10012686 | 3300013306 | Bacteria | 8225 |
| 100 | Ga0163162_10033084 | 3300013306 | Bacteria | 5136 |
| 101 | Ga0163162_10072384 | 3300013306 | Bacteria | 3502 |
| 102 | Ga0157375_10004081 | 3300013308 | Bacteria | 12660 |
| 103 | Ga0157375_10006098 | 3300013308 | Bacteria | 10508 |
| 104 | Ga0157375_10205611 | 3300013308 | Unclassified | 2125 |
| 105 | Ga0157376_10023192 | 3300014969 | Bacteria | 4854 |
| 106 | Ga0207666_1002517 | 3300025271 | Bacteria | 2212 |
| 107 | Ga0207673_1001975 | 3300025290 | Unclassified | 2292 |
| 108 | Ga0207697_10004370 | 3300025315 | Bacteria | 6762 |
| 109 | Ga0207697_10005264 | 3300025315 | Bacteria | 6030 |
| 110 | Ga0207697_10009934 | 3300025315 | Bacteria | 4088 |
| 111 | Ga0207697_10010429 | 3300025315 | Unclassified | 3972 |
| 112 | Ga0207688_10001324 | 3300025901 | Bacteria | 12871 |
| 113 | Ga0207688_10003893 | 3300025901 | Bacteria | 8140 |
| 114 | Ga0207688_10007613 | 3300025901 | Bacteria | 5895 |
| 115 | Ga0207680_10007424 | 3300025903 | Bacteria | 5343 |
| 116 | Ga0207680_10027759 | 3300025903 | Bacteria | 3157 |
| 117 | Ga0207685_10011716 | 3300025905 | Bacteria | 2648 |
| 118 | Ga0207699_10022948 | 3300025906 | Bacteria | 3389 |
| 119 | Ga0207645_10002814 | 3300025907 | Bacteria | 13507 |
| 120 | Ga0207645_10008969 | 3300025907 | Bacteria | 6945 |
| 121 | Ga0207645_10024919 | 3300025907 | Bacteria | 3875 |
| 122 | Ga0207645_10028527 | 3300025907 | Bacteria | 3603 |
| 123 | Ga0207645_10045348 | 3300025907 | Unclassified | 2810 |
| 124 | Ga0207684_10005437 | 3300025910 | Bacteria | 11748 |
| 125 | Ga0207671_10016062 | 3300025914 | Bacteria | 5833 |
| 126 | Ga0207671_10027257 | 3300025914 | Bacteria | 4271 |
| 127 | Ga0207663_10133687 | 3300025916 | Unclassified | 1718 |
| 128 | Ga0207657_10023884 | 3300025919 | Bacteria | 5679 |
| 129 | Ga0207657_10119845 | 3300025919 | Bacteria | 2165 |
| 130 | Ga0207646_10000761 | 3300025922 | Bacteria | 41842 |
| 131 | Ga0207659_10071054 | 3300025926 | Unclassified | 2540 |
| 132 | Ga0207700_10056936 | 3300025928 | Unclassified | 2945 |
| 133 | Ga0207664_10017491 | 3300025929 | Bacteria | 5258 |
| 134 | Ga0207664_10237300 | 3300025929 | Unclassified | 1587 |
| 135 | Ga0207644_10010317 | 3300025931 | Bacteria | 6156 |
| 136 | Ga0207644_10026970 | 3300025931 | Bacteria | 3966 |
| 137 | Ga0207644_10031845 | 3300025931 | Bacteria | 3677 |
| 138 | Ga0207690_10053041 | 3300025932 | Unclassified | 2719 |
| 139 | Ga0207706_10001969 | 3300025933 | Bacteria | 20134 |
| 140 | Ga0207706_10066164 | 3300025933 | Unclassified | 3181 |
| 141 | Ga0207670_10079724 | 3300025936 | Bacteria | 2287 |
| 142 | Ga0207704_10028963 | 3300025938 | Bacteria | 3081 |
| 143 | Ga0207691_10000395 | 3300025940 | Bacteria | 43692 |
| 144 | Ga0207691_10006962 | 3300025940 | Bacteria | 10907 |
| 145 | Ga0207689_10001289 | 3300025942 | Bacteria | 24149 |
| 146 | Ga0207689_10033070 | 3300025942 | Unclassified | 4298 |
| 147 | Ga0207667_10035148 | 3300025949 | Bacteria | 5377 |
| 148 | Ga0207651_10130588 | 3300025960 | Bacteria | 1922 |
| 149 | Ga0207651_10133389 | 3300025960 | Unclassified | 1905 |
| 150 | Ga0207668_10073425 | 3300025972 | Unclassified | 2451 |
| 151 | Ga0207658_10106623 | 3300025986 | Unclassified | 2206 |
| 152 | Ga0207677_10032051 | 3300026023 | Bacteria | 3374 |
| 153 | Ga0207703_10014658 | 3300026035 | Bacteria | 6116 |
| 154 | Ga0207703_10042595 | 3300026035 | Bacteria | 3642 |
| 155 | Ga0207703_10092792 | 3300026035 | Unclassified | 2542 |
| 156 | Ga0207678_10007512 | 3300026067 | Bacteria | 9636 |
| 157 | Ga0207708_10022368 | 3300026075 | Unclassified | 4774 |
| 158 | Ga0207702_10001406 | 3300026078 | Bacteria | 24034 |
| 159 | Ga0207648_10005102 | 3300026089 | Bacteria | 13303 |
| 160 | Ga0207648_10006176 | 3300026089 | Bacteria | 11934 |
| 161 | Ga0207683_10007434 | 3300026121 | Bacteria | 9393 |
| 162 | Ga0207683_10010269 | 3300026121 | Bacteria | 7984 |
| 163 | Ga0207683_10069630 | 3300026121 | Bacteria | 3107 |
| 164 | Ga0268266_10056691 | 3300028379 | Bacteria | 3370 |
| 165 | Ga0268265_10018849 | 3300028380 | Bacteria | 4788 |
| 166 | Ga0268265_10081402 | 3300028380 | Bacteria | 2557 |
| 167 | Ga0268264_10000163 | 3300028381 | Bacteria | 148007 |
| 168 | Ga0268264_10182147 | 3300028381 | Unclassified | 1909 |
| 169 | Ga0265319_1006179 | 3300028563 | Bacteria | 5587 |
| 170 | Ga0265319_1010329 | 3300028563 | Bacteria | 3902 |
| 171 | Ga0265334_10000599 | 3300028573 | Bacteria | 18222 |
| 172 | Ga0265318_10000002 | 3300028577 | Bacteria | 428208 |
| 173 | Ga0265323_10000003 | 3300028653 | Bacteria | 200487 |
| 174 | Ga0265323_10004751 | 3300028653 | Bacteria | 5823 |
| 175 | Ga0265322_10000655 | 3300028654 | Bacteria | 12985 |
| 176 | Ga0307511_10000511 | 3300030521 | Bacteria | 41762 |
| 177 | Ga0265320_10003294 | 3300031240 | Bacteria | 10899 |
| 178 | Ga0265331_10005688 | 3300031250 | Bacteria | 7485 |
| 179 | Ga0265327_10000091 | 3300031251 | Bacteria | 196369 |
| 180 | Ga0265327_10002503 | 3300031251 | Bacteria | 19206 |
| 181 | Ga0265327_10006779 | 3300031251 | Bacteria | 9038 |
| 182 | Ga0265316_10004818 | 3300031344 | Bacteria | 13311 |
| 183 | Ga0265316_10090862 | 3300031344 | Bacteria | 2330 |
| 184 | Ga0307408_100000017 | 3300031548 | Bacteria | 355890 |
| 185 | Ga0265313_10000669 | 3300031595 | Bacteria | 35282 |
| 186 | Ga0265313_10002336 | 3300031595 | Bacteria | 16601 |
| 187 | Ga0307508_10000093 | 3300031616 | Bacteria | 104212 |
| 188 | Ga0265314_10001638 | 3300031711 | Bacteria | 24539 |
| 189 | Ga0265314_10003859 | 3300031711 | Bacteria | 14300 |
| 190 | Ga0265314_10004604 | 3300031711 | Bacteria | 12726 |
| 191 | Ga0265342_10009652 | 3300031712 | Bacteria | 6769 |
| 192 | Ga0307410_10000014 | 3300031852 | Bacteria | 74664 |
| 193 | Ga0307409_100002364 | 3300031995 | Bacteria | 9811 |
| 194 | Ga0307416_100000151 | 3300032002 | Bacteria | 41211 |
| 195 | Ga0307414_10150639 | 3300032004 | Unclassified | 1835 |
| 196 | Ga0373946_0034119 | 3300035171 | Unclassified | 2053 |
| 197 | Ga0373937_0061374 | 3300036401 | Bacteria | 3456 |
| 198 | Ga0373925_0012027 | 3300037068 | Bacteria | 6267 |
| 199 | Ga0395900_0054860 | 3300037418 | Bacteria | 4103 |
| 200 | Ga0395898_0078112 | 3300037466 | Bacteria | 3194 |
| 201 | Ga0395905_0000426 | 3300037471 | Bacteria | 58859 |
| 202 | Ga0395901_0018755 | 3300038443 | Bacteria | 7068 |
| 203 | Ga0439451_007347 | 3300042009 | Bacteria | 2248 |
| 204 | Ga0451577_0000024 | 3300042876 | Bacteria | 411758 |
| 205 | Ga0451577_0034835 | 3300042876 | Bacteria | 4537 |
| 206 | Ga0451577_0038359 | 3300042876 | Bacteria | 4310 |
| 207 | Ga0451577_0168214 | 3300042876 | Bacteria | 1975 |
| 208 | Ga0453683_0002309 | 3300044673 | Bacteria | 14995 |
| 209 | Ga0453684_0000001 | 3300044712 | Bacteria | 2623166 |
| 210 | Ga0453684_0009413 | 3300044712 | Bacteria | 17090 |
| 211 | Ga0453684_0013450 | 3300044712 | Bacteria | 13288 |
| 212 | Ga0453684_0089128 | 3300044712 | Bacteria | 3817 |
| 213 | Ga0451576_0001292 | 3300045051 | Bacteria | 43381 |
| 214 | Ga0451576_0005144 | 3300045051 | Bacteria | 16566 |
| 215 | Ga0451576_0008301 | 3300045051 | Bacteria | 12207 |
| 216 | Ga0451576_0019264 | 3300045051 | Bacteria | 7450 |
| 217 | Ga0451576_0040001 | 3300045051 | Bacteria | 4964 |
| 218 | Ga0451576_0041244 | 3300045051 | Bacteria | 4881 |
| 219 | Ga0451576_0136800 | 3300045051 | Bacteria | 2555 |
| 220 | Ga0495592_0009261 | 3300046454 | Bacteria | 7407 |
| 221 | Ga0495618_0032012 | 3300046514 | Bacteria | 3294 |
| 222 | Ga0495628_0112560 | 3300046516 | Bacteria | 2092 |
| 223 | Ga0495652_0020197 | 3300046529 | Bacteria | 5921 |
| 224 | Ga0495659_0004275 | 3300046664 | Bacteria | 4503 |
| 225 | Ga0495599_0042644 | 3300046678 | Unclassified | 2847 |
| 226 | Ga0495669_0022405 | 3300046684 | Unclassified | 2743 |
| 227 | Ga0495684_0045046 | 3300047471 | Bacteria | 3376 |
| 228 | Ga0496100_0047206 | 3300048903 | Bacteria | 2773 |
| 229 | Ga0496101_0042269 | 3300048904 | Unclassified | 3253 |
| 230 | Ga0496104_0133957 | 3300048907 | Bacteria | 2380 |
| 231 | Ga0496106_0005830 | 3300048909 | Bacteria | 9110 |
| 232 | Ga0496106_0083763 | 3300048909 | Unclassified | 2453 |
| 233 | Ga0496108_0110129 | 3300048911 | Bacteria | 2354 |
| 234 | Ga0496109_0001915 | 3300048912 | Bacteria | 17286 |
| 235 | Ga0496109_0016749 | 3300048912 | Bacteria | 6413 |
| 236 | Ga0496109_0060933 | 3300048912 | Bacteria | 3449 |
| 237 | Ga0496109_0114552 | 3300048912 | Bacteria | 2508 |
| 238 | Ga0496109_0145052 | 3300048912 | Unclassified | 2221 |
| 239 | Ga0496110_0108453 | 3300048913 | Unclassified | 2493 |
| 240 | Ga0496112_0076527 | 3300048915 | Unclassified | 3310 |
| 241 | Ga0496114_0166724 | 3300048917 | Unclassified | 1918 |
| 242 | Ga0496115_0014030 | 3300048918 | Bacteria | 6065 |
| 243 | Ga0496115_0092349 | 3300048918 | Unclassified | 2474 |
| 244 | Ga0501032_0020693 | 3300049569 | Bacteria | 4580 |
| 245 | Ga0501033_0002474 | 3300049570 | Bacteria | 15659 |
| 246 | Ga0501037_0012626 | 3300049573 | Bacteria | 6224 |
| 247 | Ga0501046_0001850 | 3300049580 | Bacteria | 20144 |
| 248 | Ga0501047_0207720 | 3300049581 | Bacteria | 1817 |
| 249 | Ga0501083_0009171 | 3300049744 | Bacteria | 6990 |
| 250 | nmdc:mga05p37_167777_c1 | 3300050507 | Bacteria | 2678 |
| 251 | nmdc:mga05p37_79891_c1 | 3300050507 | Bacteria | 4027 |
| 252 | nmdc:mga08y16_168366_c1 | 3300050511 | Bacteria | 2276 |
| 253 | Ga0500555_000003 | 3300053103 | Bacteria | 392994 |
| 254 | Ga0500622_0057936 | 3300053156 | Bacteria | 1981 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042876 | Ga0451577_0168214 | Ga0451577_0168214_40_1440 | 446 |
| 2 | 3300005543 | Ga0070672_100001930 | Ga0070672_1000019308 | 449 |
| 3 | 3300026089 | Ga0207648_10006176 | Ga0207648_100061767 | 449 |
| 4 | 3300005338 | Ga0068868_100022152 | Ga0068868_1000221526 | 457 |
| 5 | 3300005340 | Ga0070689_100040158 | Ga0070689_1000401583 | 457 |
| 6 | 3300005353 | Ga0070669_100013775 | Ga0070669_1000137754 | 457 |
| 7 | 3300005354 | Ga0070675_100026349 | Ga0070675_1000263492 | 457 |
| 8 | 3300005356 | Ga0070674_100017435 | Ga0070674_1000174352 | 457 |
| 9 | 3300005365 | Ga0070688_100001049 | Ga0070688_10000104912 | 457 |
| 10 | 3300005367 | Ga0070667_100005328 | Ga0070667_1000053288 | 457 |
| 11 | 3300013306 | Ga0163162_10004541 | Ga0163162_100045412 | 457 |
| 12 | 3300013308 | Ga0157375_10006098 | Ga0157375_100060983 | 457 |
| 13 | 3300025901 | Ga0207688_10001324 | Ga0207688_100013245 | 457 |
| 14 | 3300025907 | Ga0207645_10024919 | Ga0207645_100249192 | 457 |
| 15 | 3300025940 | Ga0207691_10000395 | Ga0207691_1000039524 | 457 |
| 16 | 3300026121 | Ga0207683_10007434 | Ga0207683_100074349 | 457 |
| 17 | 3300048912 | Ga0496109_0145052 | Ga0496109_0145052_113_1705 | 457 |
| 18 | 3300013296 | Ga0157374_10087189 | Ga0157374_100871892 | 465 |
| 19 | 3300050507 | nmdc:mga05p37_167777_c1 | nmdc:mga05p37_167777_c1_224_1867 | 465 |
| 20 | 3300025936 | Ga0207670_10079724 | Ga0207670_100797241 | 472 |
| 21 | 3300044712 | Ga0453684_0000001 | Ga0453684_0000001_739075_740724 | 472 |
| 22 | 3300046454 | Ga0495592_0009261 | Ga0495592_0009261_2053_3651 | 472 |
| 23 | 3300046516 | Ga0495628_0112560 | Ga0495628_0112560_242_1840 | 472 |
| 24 | 3300046678 | Ga0495599_0042644 | Ga0495599_0042644_234_1832 | 472 |
| 25 | 3300005354 | Ga0070675_100010634 | Ga0070675_1000106349 | 474 |
| 26 | 3300005937 | Ga0081455_10004799 | Ga0081455_1000479914 | 474 |
| 27 | 3300025315 | Ga0207697_10005264 | Ga0207697_100052645 | 474 |
| 28 | 3300045051 | Ga0451576_0005144 | Ga0451576_0005144_8064_9668 | 476 |
| 29 | 3300009147 | Ga0114129_10073396 | Ga0114129_100733962 | 477 |
| 30 | 3300042876 | Ga0451577_0000024 | Ga0451577_0000024_257667_259325 | 478 |
| 31 | 3300044673 | Ga0453683_0002309 | Ga0453683_0002309_4760_6307 | 480 |
| 32 | 3300045051 | Ga0451576_0041244 | Ga0451576_0041244_3225_4772 | 481 |
| 33 | 3300005353 | Ga0070669_100122912 | Ga0070669_1001229122 | 482 |
| 34 | 3300003322 | rootL2_10162878 | rootL2_101628785 | 483 |
| 35 | 3300005985 | Ga0081539_10014017 | Ga0081539_100140175 | 483 |
| 36 | 3300009545 | Ga0105237_10016988 | Ga0105237_100169883 | 483 |
| 37 | 3300025914 | Ga0207671_10027257 | Ga0207671_100272573 | 483 |
| 38 | 3300005293 | Ga0065715_10003208 | Ga0065715_100032083 | 484 |
| 39 | 3300005327 | Ga0070658_10015442 | Ga0070658_100154424 | 484 |
| 40 | 3300005445 | Ga0070708_100070255 | Ga0070708_1000702553 | 485 |
| 41 | 3300005842 | Ga0068858_100058561 | Ga0068858_1000585612 | 486 |
| 42 | 3300025919 | Ga0207657_10119845 | Ga0207657_101198452 | 486 |
| 43 | 3300026035 | Ga0207703_10042595 | Ga0207703_100425952 | 486 |
| 44 | 3300045051 | Ga0451576_0019264 | Ga0451576_0019264_1199_2791 | 486 |
| 45 | 3300042876 | Ga0451577_0038359 | Ga0451577_0038359_2751_4298 | 488 |
| 46 | 3300005328 | Ga0070676_10006164 | Ga0070676_100061645 | 489 |
| 47 | 3300005355 | Ga0070671_100025056 | Ga0070671_1000250562 | 489 |
| 48 | 3300032004 | Ga0307414_10150639 | Ga0307414_101506391 | 489 |
| 49 | 3300037068 | Ga0373925_0012027 | Ga0373925_0012027_51_1556 | 489 |
| 50 | 3300046664 | Ga0495659_0004275 | Ga0495659_0004275_498_2003 | 489 |
| 51 | 3300046684 | Ga0495669_0022405 | Ga0495669_0022405_57_1562 | 489 |
| 52 | 3300047471 | Ga0495684_0045046 | Ga0495684_0045046_36_1562 | 489 |
| 53 | 3300005467 | Ga0070706_100068231 | Ga0070706_1000682312 | 490 |
| 54 | 3300005843 | Ga0068860_100000575 | Ga0068860_10000057516 | 490 |
| 55 | 3300028381 | Ga0268264_10000163 | Ga0268264_10000163119 | 490 |
| 56 | 3300031251 | Ga0265327_10006779 | Ga0265327_100067794 | 490 |
| 57 | 3300031344 | Ga0265316_10090862 | Ga0265316_100908622 | 491 |
| 58 | 3300050507 | nmdc:mga05p37_79891_c1 | nmdc:mga05p37_79891_c1_1775_3367 | 491 |
| 59 | 3300005334 | Ga0068869_100000360 | Ga0068869_1000003608 | 492 |
| 60 | 3300005338 | Ga0068868_100019823 | Ga0068868_1000198233 | 492 |
| 61 | 3300005445 | Ga0070708_100164566 | Ga0070708_1001645661 | 492 |
| 62 | 3300005459 | Ga0068867_100012405 | Ga0068867_1000124054 | 492 |
| 63 | 3300006358 | Ga0068871_100001317 | Ga0068871_1000013173 | 492 |
| 64 | 3300006881 | Ga0068865_100004689 | Ga0068865_1000046894 | 492 |
| 65 | 3300025929 | Ga0207664_10017491 | Ga0207664_100174912 | 492 |
| 66 | 3300025938 | Ga0207704_10028963 | Ga0207704_100289633 | 492 |
| 67 | 3300025942 | Ga0207689_10001289 | Ga0207689_100012894 | 492 |
| 68 | 3300026023 | Ga0207677_10032051 | Ga0207677_100320513 | 492 |
| 69 | 3300026089 | Ga0207648_10005102 | Ga0207648_100051023 | 492 |
| 70 | 3300045051 | Ga0451576_0040001 | Ga0451576_0040001_989_2593 | 492 |
| 71 | 3300009094 | Ga0111539_10101127 | Ga0111539_101011272 | 493 |
| 72 | 3300050511 | nmdc:mga08y16_168366_c1 | nmdc:mga08y16_168366_c1_165_1766 | 493 |
| 73 | 3300005937 | Ga0081455_10002063 | Ga0081455_1000206324 | 494 |
| 74 | 3300006028 | Ga0070717_10007457 | Ga0070717_100074572 | 494 |
| 75 | 3300005536 | Ga0070697_100071161 | Ga0070697_1000711612 | 496 |
| 76 | 3300045051 | Ga0451576_0001292 | Ga0451576_0001292_17133_18737 | 496 |
| 77 | 3300005290 | Ga0065712_10101773 | Ga0065712_101017731 | 497 |
| 78 | 3300005328 | Ga0070676_10011467 | Ga0070676_100114678 | 497 |
| 79 | 3300005354 | Ga0070675_100114543 | Ga0070675_1001145432 | 497 |
| 80 | 3300005364 | Ga0070673_100043432 | Ga0070673_1000434323 | 497 |
| 81 | 3300005435 | Ga0070714_100141181 | Ga0070714_1001411811 | 497 |
| 82 | 3300005456 | Ga0070678_100079878 | Ga0070678_1000798782 | 497 |
| 83 | 3300005468 | Ga0070707_100252153 | Ga0070707_1002521531 | 497 |
| 84 | 3300005543 | Ga0070672_100155432 | Ga0070672_1001554322 | 497 |
| 85 | 3300006028 | Ga0070717_10015759 | Ga0070717_100157595 | 497 |
| 86 | 3300013296 | Ga0157374_10017706 | Ga0157374_100177067 | 497 |
| 87 | 3300013296 | Ga0157374_10019441 | Ga0157374_100194414 | 497 |
| 88 | 3300013297 | Ga0157378_10029222 | Ga0157378_100292224 | 497 |
| 89 | 3300013297 | Ga0157378_10092299 | Ga0157378_100922992 | 497 |
| 90 | 3300013306 | Ga0163162_10072384 | Ga0163162_100723842 | 497 |
| 91 | 3300013308 | Ga0157375_10205611 | Ga0157375_102056111 | 497 |
| 92 | 3300025290 | Ga0207673_1001975 | Ga0207673_10019752 | 497 |
| 93 | 3300025315 | Ga0207697_10004370 | Ga0207697_100043702 | 497 |
| 94 | 3300025315 | Ga0207697_10009934 | Ga0207697_100099344 | 497 |
| 95 | 3300025901 | Ga0207688_10003893 | Ga0207688_100038931 | 497 |
| 96 | 3300025903 | Ga0207680_10007424 | Ga0207680_100074243 | 497 |
| 97 | 3300025905 | Ga0207685_10011716 | Ga0207685_100117162 | 497 |
| 98 | 3300025906 | Ga0207699_10022948 | Ga0207699_100229483 | 497 |
| 99 | 3300025907 | Ga0207645_10028527 | Ga0207645_100285274 | 497 |
| 100 | 3300025907 | Ga0207645_10045348 | Ga0207645_100453482 | 497 |
| 101 | 3300025916 | Ga0207663_10133687 | Ga0207663_101336871 | 497 |
| 102 | 3300025928 | Ga0207700_10056936 | Ga0207700_100569362 | 497 |
| 103 | 3300025929 | Ga0207664_10237300 | Ga0207664_102373001 | 497 |
| 104 | 3300025960 | Ga0207651_10133389 | Ga0207651_101333891 | 497 |
| 105 | 3300025986 | Ga0207658_10106623 | Ga0207658_101066232 | 497 |
| 106 | 3300026121 | Ga0207683_10069630 | Ga0207683_100696302 | 497 |
| 107 | 3300028380 | Ga0268265_10081402 | Ga0268265_100814021 | 497 |
| 108 | 3300028381 | Ga0268264_10182147 | Ga0268264_101821471 | 497 |
| 109 | 3300028653 | Ga0265323_10004751 | Ga0265323_100047513 | 497 |
| 110 | 3300037418 | Ga0395900_0054860 | Ga0395900_0054860_2392_3924 | 497 |
| 111 | 3300037466 | Ga0395898_0078112 | Ga0395898_0078112_1391_2923 | 497 |
| 112 | 3300038443 | Ga0395901_0018755 | Ga0395901_0018755_1188_2720 | 497 |
| 113 | 3300048903 | Ga0496100_0047206 | Ga0496100_0047206_187_1719 | 497 |
| 114 | 3300048904 | Ga0496101_0042269 | Ga0496101_0042269_1285_2817 | 497 |
| 115 | 3300048907 | Ga0496104_0133957 | Ga0496104_0133957_73_1605 | 497 |
| 116 | 3300048909 | Ga0496106_0005830 | Ga0496106_0005830_6513_8045 | 497 |
| 117 | 3300048911 | Ga0496108_0110129 | Ga0496108_0110129_686_2221 | 497 |
| 118 | 3300048912 | Ga0496109_0016749 | Ga0496109_0016749_4689_6221 | 497 |
| 119 | 3300048912 | Ga0496109_0060933 | Ga0496109_0060933_590_2125 | 497 |
| 120 | 3300048913 | Ga0496110_0108453 | Ga0496110_0108453_368_1900 | 497 |
| 121 | 3300048915 | Ga0496112_0076527 | Ga0496112_0076527_1278_2810 | 497 |
| 122 | 3300048917 | Ga0496114_0166724 | Ga0496114_0166724_31_1563 | 497 |
| 123 | 3300048918 | Ga0496115_0092349 | Ga0496115_0092349_332_1864 | 497 |
| 124 | 3300013297 | Ga0157378_10063257 | Ga0157378_100632572 | 498 |
| 125 | 3300003203 | JGI25406J46586_10000005 | JGI25406J46586_1000000564 | 499 |
| 126 | 3300005327 | Ga0070658_10020846 | Ga0070658_100208463 | 499 |
| 127 | 3300005366 | Ga0070659_100024501 | Ga0070659_1000245012 | 499 |
| 128 | 3300005440 | Ga0070705_100072094 | Ga0070705_1000720941 | 499 |
| 129 | 3300005441 | Ga0070700_100027809 | Ga0070700_1000278092 | 499 |
| 130 | 3300005535 | Ga0070684_100008518 | Ga0070684_1000085185 | 499 |
| 131 | 3300005536 | Ga0070697_100006008 | Ga0070697_1000060084 | 499 |
| 132 | 3300005842 | Ga0068858_100024619 | Ga0068858_1000246194 | 499 |
| 133 | 3300005985 | Ga0081539_10000026 | Ga0081539_10000026240 | 499 |
| 134 | 3300025315 | Ga0207697_10010429 | Ga0207697_100104293 | 499 |
| 135 | 3300025919 | Ga0207657_10023884 | Ga0207657_100238844 | 499 |
| 136 | 3300025926 | Ga0207659_10071054 | Ga0207659_100710541 | 499 |
| 137 | 3300025932 | Ga0207690_10053041 | Ga0207690_100530412 | 499 |
| 138 | 3300025933 | Ga0207706_10066164 | Ga0207706_100661642 | 499 |
| 139 | 3300026035 | Ga0207703_10092792 | Ga0207703_100927921 | 499 |
| 140 | 3300026075 | Ga0207708_10022368 | Ga0207708_100223684 | 499 |
| 141 | 3300028563 | Ga0265319_1006179 | Ga0265319_10061793 | 499 |
| 142 | 3300031250 | Ga0265331_10005688 | Ga0265331_100056882 | 499 |
| 143 | 3300048909 | Ga0496106_0083763 | Ga0496106_0083763_187_1776 | 499 |
| 144 | 3300005456 | Ga0070678_100041029 | Ga0070678_1000410293 | 500 |
| 145 | 3300014969 | Ga0157376_10023192 | Ga0157376_100231922 | 500 |
| 146 | 3300026121 | Ga0207683_10010269 | Ga0207683_100102693 | 500 |
| 147 | 3300049569 | Ga0501032_0020693 | Ga0501032_0020693_201_1817 | 500 |
| 148 | 3300049570 | Ga0501033_0002474 | Ga0501033_0002474_4587_6203 | 500 |
| 149 | 3300049573 | Ga0501037_0012626 | Ga0501037_0012626_2584_4200 | 500 |
| 150 | 3300049580 | Ga0501046_0001850 | Ga0501046_0001850_16487_18103 | 500 |
| 151 | 3300049581 | Ga0501047_0207720 | Ga0501047_0207720_130_1746 | 500 |
| 152 | 3300003322 | rootL2_10008384 | rootL2_100083848 | 501 |
| 153 | 3300005328 | Ga0070676_10051704 | Ga0070676_100517041 | 501 |
| 154 | 3300005356 | Ga0070674_100007282 | Ga0070674_1000072826 | 501 |
| 155 | 3300005364 | Ga0070673_100098948 | Ga0070673_1000989481 | 501 |
| 156 | 3300009545 | Ga0105237_10027404 | Ga0105237_100274043 | 501 |
| 157 | 3300013296 | Ga0157374_10029998 | Ga0157374_100299985 | 501 |
| 158 | 3300025901 | Ga0207688_10007613 | Ga0207688_100076136 | 501 |
| 159 | 3300025903 | Ga0207680_10027759 | Ga0207680_100277592 | 501 |
| 160 | 3300025907 | Ga0207645_10002814 | Ga0207645_100028147 | 501 |
| 161 | 3300025914 | Ga0207671_10016062 | Ga0207671_100160623 | 501 |
| 162 | 3300025931 | Ga0207644_10026970 | Ga0207644_100269702 | 501 |
| 163 | 3300025940 | Ga0207691_10006962 | Ga0207691_100069626 | 501 |
| 164 | 3300025960 | Ga0207651_10130588 | Ga0207651_101305882 | 501 |
| 165 | 3300028379 | Ga0268266_10056691 | Ga0268266_100566912 | 501 |
| 166 | 3300031548 | Ga0307408_100000017 | Ga0307408_100000017300 | 501 |
| 167 | 3300031852 | Ga0307410_10000014 | Ga0307410_100000144 | 501 |
| 168 | 3300031995 | Ga0307409_100002364 | Ga0307409_1000023644 | 501 |
| 169 | 3300032002 | Ga0307416_100000151 | Ga0307416_10000015125 | 501 |
| 170 | 3300005295 | Ga0065707_10006787 | Ga0065707_100067871 | 502 |
| 171 | 3300005328 | Ga0070676_10017832 | Ga0070676_100178324 | 502 |
| 172 | 3300005338 | Ga0068868_100098496 | Ga0068868_1000984961 | 502 |
| 173 | 3300005367 | Ga0070667_100008620 | Ga0070667_1000086203 | 502 |
| 174 | 3300005439 | Ga0070711_100021075 | Ga0070711_1000210755 | 502 |
| 175 | 3300005445 | Ga0070708_100007375 | Ga0070708_1000073759 | 502 |
| 176 | 3300005445 | Ga0070708_100023166 | Ga0070708_1000231663 | 502 |
| 177 | 3300005467 | Ga0070706_100025040 | Ga0070706_1000250405 | 502 |
| 178 | 3300005468 | Ga0070707_100000049 | Ga0070707_10000004917 | 502 |
| 179 | 3300005536 | Ga0070697_100001899 | Ga0070697_10000189913 | 502 |
| 180 | 3300005536 | Ga0070697_100039077 | Ga0070697_1000390773 | 502 |
| 181 | 3300005536 | Ga0070697_100073691 | Ga0070697_1000736912 | 502 |
| 182 | 3300009098 | Ga0105245_10088734 | Ga0105245_100887341 | 502 |
| 183 | 3300013296 | Ga0157374_10018160 | Ga0157374_100181601 | 502 |
| 184 | 3300013296 | Ga0157374_10160953 | Ga0157374_101609532 | 502 |
| 185 | 3300013306 | Ga0163162_10033084 | Ga0163162_100330842 | 502 |
| 186 | 3300025271 | Ga0207666_1002517 | Ga0207666_10025171 | 502 |
| 187 | 3300025907 | Ga0207645_10008969 | Ga0207645_100089692 | 502 |
| 188 | 3300025910 | Ga0207684_10005437 | Ga0207684_100054379 | 502 |
| 189 | 3300025922 | Ga0207646_10000761 | Ga0207646_1000076114 | 502 |
| 190 | 3300025933 | Ga0207706_10001969 | Ga0207706_1000196910 | 502 |
| 191 | 3300025942 | Ga0207689_10033070 | Ga0207689_100330704 | 502 |
| 192 | 3300025972 | Ga0207668_10073425 | Ga0207668_100734252 | 502 |
| 193 | 3300026067 | Ga0207678_10007512 | Ga0207678_1000751210 | 502 |
| 194 | 3300028380 | Ga0268265_10018849 | Ga0268265_100188493 | 502 |
| 195 | 3300028563 | Ga0265319_1010329 | Ga0265319_10103292 | 502 |
| 196 | 3300042009 | Ga0439451_007347 | Ga0439451_007347_368_1960 | 502 |
| 197 | 3300045051 | Ga0451576_0136800 | Ga0451576_0136800_92_1684 | 502 |
| 198 | 3300048912 | Ga0496109_0001915 | Ga0496109_0001915_15288_16850 | 502 |
| 199 | 3300048912 | Ga0496109_0114552 | Ga0496109_0114552_607_2166 | 502 |
| 200 | 3300048918 | Ga0496115_0014030 | Ga0496115_0014030_293_1852 | 502 |
| 201 | 3300005290 | Ga0065712_10094700 | Ga0065712_100947002 | 503 |
| 202 | 3300005331 | Ga0070670_100086535 | Ga0070670_1000865352 | 503 |
| 203 | 3300005548 | Ga0070665_100188056 | Ga0070665_1001880562 | 503 |
| 204 | 3300005983 | Ga0081540_1048253 | Ga0081540_10482531 | 503 |
| 205 | 3300006237 | Ga0097621_100005263 | Ga0097621_1000052633 | 503 |
| 206 | 3300013296 | Ga0157374_10011222 | Ga0157374_100112227 | 503 |
| 207 | 3300013306 | Ga0163162_10012686 | Ga0163162_100126866 | 503 |
| 208 | 3300013308 | Ga0157375_10004081 | Ga0157375_100040813 | 503 |
| 209 | 3300025931 | Ga0207644_10010317 | Ga0207644_100103177 | 503 |
| 210 | iso_pu_bacteria | 2786546940 | 2788435586 | 505 |
| 211 | 3300030521 | Ga0307511_10000511 | Ga0307511_1000051129 | 506 |
| 212 | 3300031251 | Ga0265327_10002503 | Ga0265327_100025035 | 508 |
| 213 | 3300042876 | Ga0451577_0034835 | Ga0451577_0034835_961_2649 | 508 |
| 214 | 3300003320 | rootH2_10035222 | rootH2_1003522212 | 509 |
| 215 | 3300003320 | rootH2_10137323 | rootH2_101373232 | 509 |
| 216 | 3300003323 | rootH1_10159213 | rootH1_101592132 | 509 |
| 217 | 3300026078 | Ga0207702_10001406 | Ga0207702_1000140618 | 509 |
| 218 | 3300028573 | Ga0265334_10000599 | Ga0265334_100005993 | 509 |
| 219 | 3300028577 | Ga0265318_10000002 | Ga0265318_10000002330 | 509 |
| 220 | 3300028653 | Ga0265323_10000003 | Ga0265323_10000003122 | 509 |
| 221 | 3300028654 | Ga0265322_10000655 | Ga0265322_100006554 | 509 |
| 222 | 3300031240 | Ga0265320_10003294 | Ga0265320_100032949 | 509 |
| 223 | 3300031344 | Ga0265316_10004818 | Ga0265316_100048184 | 509 |
| 224 | 3300031595 | Ga0265313_10002336 | Ga0265313_100023369 | 509 |
| 225 | 3300031711 | Ga0265314_10001638 | Ga0265314_1000163811 | 509 |
| 226 | 3300031712 | Ga0265342_10009652 | Ga0265342_100096525 | 509 |
| 227 | 3300044712 | Ga0453684_0013450 | Ga0453684_0013450_6093_7700 | 509 |
| 228 | 3300045051 | Ga0451576_0008301 | Ga0451576_0008301_8220_9869 | 509 |
| 229 | 3300053103 | Ga0500555_000003 | Ga0500555_000003_193896_195581 | 509 |
| 230 | 3300003320 | rootH2_10014434 | rootH2_100144348 | 510 |
| 231 | 3300006028 | Ga0070717_10000011 | Ga0070717_10000011113 | 510 |
| 232 | 3300013297 | Ga0157378_10060607 | Ga0157378_100606072 | 510 |
| 233 | 3300031251 | Ga0265327_10000091 | Ga0265327_10000091187 | 510 |
| 234 | 3300031595 | Ga0265313_10000669 | Ga0265313_1000066913 | 510 |
| 235 | 3300031616 | Ga0307508_10000093 | Ga0307508_1000009355 | 510 |
| 236 | 3300031711 | Ga0265314_10003859 | Ga0265314_100038599 | 510 |
| 237 | 3300031711 | Ga0265314_10004604 | Ga0265314_100046045 | 510 |
| 238 | 3300035171 | Ga0373946_0034119 | Ga0373946_0034119_110_1729 | 510 |
| 239 | 3300036401 | Ga0373937_0061374 | Ga0373937_0061374_332_1951 | 510 |
| 240 | 3300037471 | Ga0395905_0000426 | Ga0395905_0000426_25379_26980 | 510 |
| 241 | 3300044712 | Ga0453684_0009413 | Ga0453684_0009413_4637_6286 | 510 |
| 242 | 3300044712 | Ga0453684_0089128 | Ga0453684_0089128_1964_3610 | 510 |
| 243 | 3300046514 | Ga0495618_0032012 | Ga0495618_0032012_136_1755 | 510 |
| 244 | 3300046529 | Ga0495652_0020197 | Ga0495652_0020197_2840_4459 | 510 |
| 245 | 3300049744 | Ga0501083_0009171 | Ga0501083_0009171_4538_6397 | 510 |
| 246 | 3300000545 | CNXas_1000112 | CNXas_10001127 | 511 |
| 247 | 3300005563 | Ga0068855_100004104 | Ga0068855_1000041048 | 511 |
| 248 | 3300005842 | Ga0068858_100021014 | Ga0068858_1000210142 | 511 |
| 249 | 3300005985 | Ga0081539_10000511 | Ga0081539_1000051112 | 511 |
| 250 | 3300009098 | Ga0105245_10049736 | Ga0105245_100497363 | 511 |
| 251 | 3300013297 | Ga0157378_10103902 | Ga0157378_101039022 | 511 |
| 252 | 3300025931 | Ga0207644_10031845 | Ga0207644_100318452 | 511 |
| 253 | 3300025949 | Ga0207667_10035148 | Ga0207667_100351481 | 511 |
| 254 | 3300026035 | Ga0207703_10014658 | Ga0207703_100146582 | 511 |
| 255 | 3300053156 | Ga0500622_0057936 | Ga0500622_0057936_224_1897 | 511 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
384
604
0.83
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3tuz-assembly2.cif.gz_F | inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form | 0.7862 | 270 | 505 |
| 3dhw-assembly2.cif.gz_F | crystal structure of methionine importer metni | 0.7518 | 270 | 499 |
| 3dhw-assembly1.cif.gz_A | crystal structure of methionine importer metni | 0.7491 | 267 | 497 |
| 3dhw-assembly2.cif.gz_F | crystal structure of methionine importer metni | 0.7386 | 270 | 499 |
| 3tuz-assembly2.cif.gz_F | inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form | 0.7261 | 270 | 505 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FYP8_79_307_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8258 | 265 | 509 | 1.10.3720.10 |
| af_Q2FYP8_79_307_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8224 | 265 | 509 | 1.10.3720.10 |
| 3tuzF00 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.7862 | 270 | 505 | 1.10.3720.10 |
| af_Q2G225_74_270_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.7824 | 265 | 505 | 1.10.3720.10 |
| af_Q2G225_74_270_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.7754 | 265 | 505 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A377C8X3-F1-model_v4 | Phosphate transporter permease subunit PstC | 0.8663 | 267 | 425 |
GO:0005886
GO:0006817 GO:0055085 |
| AF-A0A7V4Y2N9-F1-model_v4 | Phosphate transport system permease protein | 0.8412 | 267 | 510 |
GO:0005315
GO:0005886 GO:0006817 |
| AF-A0A7Y5SL38-F1-model_v4 | Phosphate transport system permease protein | 0.8382 | 246 | 507 |
GO:0005315
GO:0005886 GO:0006817 |
| AF-A0A1V5KHN3-F1-model_v4 | Phosphate transport system permease protein | 0.8229 | 273 | 505 |
GO:0005315
GO:0005886 GO:0006817 |
| AF-A0A5C8D3V3-F1-model_v4 | Phosphate ABC transporter permease subunit PstC | 0.8226 | 244 | 503 |
GO:0005315
GO:0005886 GO:0035435 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar