F366161

General Info

Members Datasets Scaffolds Average Seq Length
256 150 512 333

Family's Representative Sequence

Representative Sequence 3300003323|rootH1_10150387|rootH1_101503873
Length 358
Sequence MTIISHNIKKTLTRPLGGWGDRVKVGVVGGAGYTGGELLRILINHPDVDIAFVHSNSNAGNYIYEVHTDLFGDTELKFGSELSDDIDVLFLCVGHGDARKFLDANAIASHIRIIDLSQDFRLSQNSKFQIQNITADPEPSFRQFVYGLPELNRESIKTARNIANPGCFATCLQLGLLPLASKGLLTNEVHITATTGSTGAGQSLSPTSHFTWRNDNLSVYKVFEHQHLNEIGESLKQLQSNQEVGALNFIPYRGDFTRGIIASMYTESDLTEEEALKLYTDFYAGHPFTHVTKRNIDLKQIVNTNKCFIQVKKHGNKLFIISIIDNLLKGASGQAVQNMNLVFGLPEDSGLRLKAVAF

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
57 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
60 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
61 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
62 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
63 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
64 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
65 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
66 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
67 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
68 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
89 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
90 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
91 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
92 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
93 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
94 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
95 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
96 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
97 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
98 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
99 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
100 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
101 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
102 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
105 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
106 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
107 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
108 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
109 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
110 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
111 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
112 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
113 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
114 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
115 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
116 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
117 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
118 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
119 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
120 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
121 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
122 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
123 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
124 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
125 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
126 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
127 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
128 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
129 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
130 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
131 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
132 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
133 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
134 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
135 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
136 2738541284 Pedobacter sp. YR016 Isolate Unclassified
137 2739367656 Pedobacter sp. CF523 Isolate Unclassified
138 2739367663 Pedobacter sp. YR510 Isolate Unclassified
139 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
140 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
141 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
142 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
143 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
144 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
145 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
146 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
147 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
148 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
149 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
150 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.75
Metatranscriptomes 0
Isolates 6.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.03
Nodule 0
Rhizoplane 0.78
Rhizosphere 80.47
Stem 0
Stem Tuber 0
Unclassified 0.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10150387 3300003323 Bacteria 3235
2 JGI24739J22299_10004155 3300001989 Bacteria 5539
3 JGI24737J22298_10002537 3300001990 Bacteria 6482
4 JGI24737J22298_10015760 3300001990 Bacteria 2444
5 JGI24743J22301_10020279 3300001991 Bacteria 1266
6 JGI24735J21928_10000002 3300002067 Bacteria 624895
7 JGI24735J21928_10005097 3300002067 Bacteria 4373
8 JGI24744J21845_10007642 3300002077 Bacteria 2234
9 JGI25162J39368_1000024 3300002737 Bacteria 229507
10 JGI25162J39368_1001318 3300002737 Bacteria 13921
11 JGI25157J39369_1004360 3300002741 Bacteria 2591
12 JGI25157J39369_1008109 3300002741 Bacteria 1478
13 JGI25164J39214_1000855 3300002772 Bacteria 10454
14 JGI25165J46597_1001051 3300003214 Bacteria 17893
15 rootH1_10034281 3300003316 Bacteria 2378
16 rootH1_10034282 3300003316 Bacteria 9753
17 rootH2_10005719 3300003320 Bacteria 108734
18 rootH2_10037397 3300003320 Bacteria 2200
19 rootH2_10051333 3300003320 Bacteria 3078
20 rootH1_10002666 3300003323 Bacteria 23641
21 rootH1_10009087 3300003323 Bacteria 3829
22 rootH1_10012302 3300003323 Bacteria 2701
23 rootH1_10062121 3300003323 Bacteria 7043
24 rootH1_10207268 3300003323 Bacteria 3154
25 rootH1_10229938 3300003323 Bacteria 2061
26 rootH1_10256108 3300003323 Bacteria 2093
27 Ga0065714_10007893 3300005288 Bacteria 4048
28 Ga0070658_10000011 3300005327 Bacteria 294396
29 Ga0070658_10201583 3300005327 Bacteria 1679
30 Ga0070676_10000277 3300005328 Bacteria 22624
31 Ga0068868_100005721 3300005338 Bacteria 8753
32 Ga0070660_100015693 3300005339 Bacteria 5477
33 Ga0070660_100047390 3300005339 Bacteria 3298
34 Ga0070675_100051700 3300005354 Bacteria 3377
35 Ga0070671_100042113 3300005355 Bacteria 3796
36 Ga0070673_100003782 3300005364 Bacteria 9493
37 Ga0070659_100000449 3300005366 Bacteria 30726
38 Ga0070659_100002083 3300005366 Bacteria 14235
39 Ga0070659_100263994 3300005366 Bacteria 1429
40 Ga0070678_100006236 3300005456 Bacteria 6976
41 Ga0070662_100000032 3300005457 Bacteria 78824
42 Ga0068867_100009759 3300005459 Bacteria 6765
43 Ga0068853_100008727 3300005539 Bacteria 8154
44 Ga0068853_100038977 3300005539 Bacteria 4051
45 Ga0070665_100000003 3300005548 Bacteria 811857
46 Ga0068855_100010454 3300005563 Bacteria 11197
47 Ga0068855_100032170 3300005563 Bacteria 6263
48 Ga0068857_100045223 3300005577 Bacteria 3905
49 Ga0068854_100278374 3300005578 Bacteria 1346
50 Ga0068856_100040048 3300005614 Bacteria 4601
51 Ga0068852_100002452 3300005616 Bacteria 12774
52 Ga0068852_100139862 3300005616 Bacteria 2239
53 Ga0068860_100056476 3300005843 Bacteria 3732
54 Ga0075366_10000804 3300006195 Bacteria 15009
55 Ga0075366_10045142 3300006195 Bacteria 2612
56 Ga0097621_100000165 3300006237 Bacteria 41398
57 Ga0068871_100000018 3300006358 Bacteria 89690
58 Ga0075431_100005370 3300006847 Bacteria 12650
59 Ga0068865_100000396 3300006881 Bacteria 24307
60 Ga0068865_100407076 3300006881 Bacteria 1115
61 Ga0105240_10000237 3300009093 Bacteria 109895
62 Ga0105240_10022011 3300009093 Bacteria 8465
63 Ga0105240_10029393 3300009093 Bacteria 7160
64 Ga0105240_10208449 3300009093 Bacteria 2286
65 Ga0105240_10293589 3300009093 Bacteria 1862
66 Ga0105240_10477687 3300009093 Bacteria 1390
67 Ga0114129_10012446 3300009147 Bacteria 12112
68 Ga0105243_10249038 3300009148 Bacteria 1585
69 Ga0105241_10007004 3300009174 Bacteria 8292
70 Ga0105241_10021319 3300009174 Bacteria 4789
71 Ga0105241_10030640 3300009174 Bacteria 4022
72 Ga0105242_10005497 3300009176 Bacteria 9783
73 Ga0105237_10000224 3300009545 Bacteria 79854
74 Ga0105237_10000963 3300009545 Bacteria 38740
75 Ga0105237_10001948 3300009545 Bacteria 26296
76 Ga0105237_10019011 3300009545 Bacteria 7101
77 Ga0105237_10061353 3300009545 Bacteria 3759
78 Ga0105237_10061401 3300009545 Bacteria 3757
79 Ga0105238_10037769 3300009551 Bacteria 4907
80 Ga0105238_10081151 3300009551 Bacteria 3233
81 Ga0105239_10000002 3300010375 Bacteria 610298
82 Ga0105239_10000013 3300010375 Bacteria 327371
83 Ga0105239_10001207 3300010375 Bacteria 35283
84 Ga0105239_10004436 3300010375 Bacteria 16776
85 Ga0105239_10006888 3300010375 Bacteria 13111
86 Ga0105239_10014078 3300010375 Bacteria 8880
87 Ga0105239_10016752 3300010375 Bacteria 8101
88 Ga0105239_10136791 3300010375 Bacteria 2728
89 Ga0105239_10391458 3300010375 Bacteria 1572
90 Ga0105246_10161741 3300011119 Bacteria 1706
91 Ga0157373_10000256 3300013100 Bacteria 43374
92 Ga0157373_10002482 3300013100 Bacteria 14050
93 Ga0157373_10025856 3300013100 Bacteria 4243
94 Ga0157373_10032956 3300013100 Bacteria 3729
95 Ga0157371_10000216 3300013102 Bacteria 83975
96 Ga0157371_10027826 3300013102 Bacteria 4097
97 Ga0157371_10066358 3300013102 Bacteria 2555
98 Ga0157370_10002361 3300013104 Bacteria 22770
99 Ga0157370_10021398 3300013104 Bacteria 6445
100 Ga0157370_10030370 3300013104 Bacteria 5295
101 Ga0157370_10108740 3300013104 Bacteria 2592
102 Ga0157369_10000046 3300013105 Bacteria 172851
103 Ga0157369_10089547 3300013105 Bacteria 3285
104 Ga0157369_10115336 3300013105 Bacteria 2853
105 Ga0157374_10000348 3300013296 Bacteria 42744
106 Ga0157374_10010541 3300013296 Bacteria 7955
107 Ga0157378_10035235 3300013297 Bacteria 4426
108 Ga0163162_10000031 3300013306 Bacteria 157666
109 Ga0163162_10009851 3300013306 Bacteria 9295
110 Ga0163162_10485823 3300013306 Bacteria 1366
111 Ga0157372_10003090 3300013307 Bacteria 17926
112 Ga0157372_10023256 3300013307 Bacteria 6716
113 Ga0157372_10029405 3300013307 Bacteria 5999
114 Ga0157372_10038494 3300013307 Bacteria 5278
115 Ga0157375_10033488 3300013308 Bacteria 4883
116 Ga0157375_10118550 3300013308 Bacteria 2753
117 Ga0182008_10000025 3300014497 Bacteria 191222
118 Ga0157377_10036751 3300014745 Bacteria 2696
119 Ga0157376_10044224 3300014969 Bacteria 3659
120 Ga0182007_10050298 3300015262 Bacteria 1376
121 Ga0183373_1008 3300015682 Bacteria 255339
122 Ga0163161_10029615 3300017792 Bacteria 3892
123 Ga0163161_10308308 3300017792 Bacteria 1248
124 Ga0213872_10035880 3300021361 Bacteria 2267
125 Ga0207427_100103 3300025231 Bacteria 119618
126 Ga0209437_100017 3300025233 Bacteria 694471
127 Ga0209437_100101 3300025233 Bacteria 226668
128 Ga0209026_1002049 3300025250 Bacteria 7962
129 Ga0209026_1003574 3300025250 Bacteria 5024
130 Ga0209129_1008535 3300025258 Bacteria 2838
131 Ga0209233_1000124 3300025261 Bacteria 226743
132 Ga0209233_1003362 3300025261 Bacteria 5655
133 Ga0209233_1011737 3300025261 Bacteria 2572
134 Ga0207647_10000104 3300025904 Bacteria 65696
135 Ga0207647_10028212 3300025904 Bacteria 3649
136 Ga0207645_10000650 3300025907 Bacteria 28882
137 Ga0207705_10000015 3300025909 Bacteria 382901
138 Ga0207705_10161618 3300025909 Bacteria 1683
139 Ga0207654_10007717 3300025911 Bacteria 5429
140 Ga0207654_10012469 3300025911 Bacteria 4356
141 Ga0207654_10019327 3300025911 Bacteria 3594
142 Ga0207695_10000013 3300025913 Bacteria 821265
143 Ga0207695_10005995 3300025913 Bacteria 15895
144 Ga0207695_10012058 3300025913 Bacteria 10392
145 Ga0207695_10295943 3300025913 Bacteria 1510
146 Ga0207695_10339707 3300025913 Bacteria 1389
147 Ga0207695_10389267 3300025913 Bacteria 1279
148 Ga0207671_10002707 3300025914 Bacteria 18581
149 Ga0207671_10005976 3300025914 Bacteria 11017
150 Ga0207671_10010699 3300025914 Bacteria 7545
151 Ga0207671_10015114 3300025914 Bacteria 6065
152 Ga0207671_10059455 3300025914 Bacteria 2834
153 Ga0207671_10162419 3300025914 Bacteria 1730
154 Ga0207657_10029952 3300025919 Bacteria 4946
155 Ga0207657_10057706 3300025919 Bacteria 3344
156 Ga0207694_10295411 3300025924 Bacteria 1333
157 Ga0207690_10003150 3300025932 Bacteria 9903
158 Ga0207690_10030854 3300025932 Bacteria 3424
159 Ga0207706_10000191 3300025933 Bacteria 68535
160 Ga0207709_10071013 3300025935 Bacteria 2209
161 Ga0207704_10000053 3300025938 Bacteria 79904
162 Ga0207667_10054870 3300025949 Bacteria 4191
163 Ga0207667_10066475 3300025949 Bacteria 3758
164 Ga0207651_10219916 3300025960 Bacteria 1535
165 Ga0207639_10006469 3300026041 Bacteria 7969
166 Ga0207639_10141665 3300026041 Bacteria 2004
167 Ga0207639_10346484 3300026041 Bacteria 1326
168 Ga0207702_10024798 3300026078 Bacteria 4975
169 Ga0207702_10206281 3300026078 Bacteria 1825
170 Ga0207648_10000175 3300026089 Bacteria 66839
171 Ga0207698_10004722 3300026142 Bacteria 8333
172 Ga0268266_10000018 3300028379 Bacteria 569141
173 Ga0268264_10031052 3300028381 Bacteria 4380
174 Ga0265326_10027091 3300028558 Bacteria 1634
175 Ga0307517_10002197 3300028786 Bacteria 31568
176 Ga0307515_10000927 3300028794 Bacteria 67260
177 Ga0307515_10001771 3300028794 Bacteria 48123
178 Ga0265338_10001011 3300028800 Bacteria 47254
179 Ga0265327_10000248 3300031251 Bacteria 107284
180 Ga0265327_10015148 3300031251 Bacteria 4997
181 Ga0307509_10045900 3300031507 Bacteria 4707
182 Ga0307410_10060760 3300031852 Bacteria 2584
183 Ga0307412_10459637 3300031911 Bacteria 1051
184 Ga0307414_10001471 3300032004 Bacteria 12250
185 Ga0307414_10034737 3300032004 Bacteria 3347
186 Ga0307414_10046227 3300032004 Bacteria 2986
187 Ga0307507_10000064 3300033179 Bacteria 161226
188 Ga0307510_10000328 3300033180 Bacteria 44214
189 Ga0395899_0000033 3300037312 Bacteria 306589
190 Ga0395899_0001077 3300037312 Bacteria 24592
191 Ga0395899_0065670 3300037312 Bacteria 2666
192 Ga0395900_0001393 3300037418 Bacteria 28920
193 Ga0395900_0003225 3300037418 Bacteria 17664
194 Ga0395898_0013831 3300037466 Bacteria 8295
195 Ga0395905_0001914 3300037471 Bacteria 23897
196 Ga0395901_0017854 3300038443 Bacteria 7241
197 Ga0395901_0111873 3300038443 Bacteria 2868
198 Ga0395901_0323341 3300038443 Bacteria 1595
199 Ga0436361_0307685 3300039447 Bacteria 5871
200 Ga0495627_023291 3300046453 Bacteria 2030
201 Ga0495650_0000003 3300046471 Bacteria 900730
202 Ga0495585_0000079 3300046492 Bacteria 100159
203 Ga0495585_0000411 3300046492 Bacteria 41565
204 Ga0495583_0041858 3300046506 Bacteria 2143
205 Ga0495606_0000116 3300046507 Bacteria 134901
206 Ga0495606_0012165 3300046507 Bacteria 6938
207 Ga0495606_0023782 3300046507 Bacteria 4431
208 Ga0495606_0026181 3300046507 Bacteria 4160
209 Ga0495606_0122159 3300046507 Unclassified 1558
210 Ga0495610_0004188 3300046512 Bacteria 10774
211 Ga0495616_0008226 3300046513 Bacteria 6192
212 Ga0495631_0037702 3300046518 Bacteria 2152
213 Ga0495644_0018713 3300046523 Bacteria 2643
214 Ga0495648_0002877 3300046524 Bacteria 15501
215 Ga0495648_0034727 3300046524 Bacteria 3278
216 Ga0495609_0033930 3300046538 Bacteria 2314
217 Ga0495622_0045381 3300046557 Bacteria 2042
218 Ga0495633_0000056 3300046558 Bacteria 149334
219 Ga0495625_0000159 3300046660 Bacteria 104355
220 Ga0495625_0001186 3300046660 Bacteria 33408
221 Ga0495625_0002144 3300046660 Bacteria 21944
222 Ga0495661_0001360 3300046665 Bacteria 20657
223 Ga0495661_0015325 3300046665 Bacteria 5118
224 Ga0495649_0000003 3300046694 Bacteria 880817
225 Ga0495600_0026176 3300046809 Bacteria 3763
226 Ga0495636_0000446 3300047318 Bacteria 15278
227 Ga0495687_002367 3300047443 Bacteria 15256
228 Ga0495677_0055187 3300047445 Bacteria 1466
229 Ga0495686_0001122 3300047472 Bacteria 31676
230 Ga0495686_0046959 3300047472 Bacteria 2728
231 Ga0496114_0418430 3300048917 Bacteria 1187
232 Ga0495678_010545 3300049459 Bacteria 4486
233 nmdc:mga0k408_51_c1 3300050493 Bacteria 15009
234 nmdc:mga0k408_7355_c1 3300050493 Bacteria 5881
235 nmdc:mga05p37_23296_c2 3300050507 Bacteria 4315
236 nmdc:mga09592_66506_c1 3300050508 Bacteria 3055
237 nmdc:mga06r32_4922_c1 3300050510 Bacteria 12034
238 Ga0500635_0000678 3300053080 Bacteria 8618
239 Ga0500608_005011 3300053122 Bacteria 5204
240 Ga0500618_000003 3300053125 Bacteria 338706
241 2599478629 2599185184 Bacteria 6430550
242 2738761461 2738541284 Bacteria 5199923
243 2739614666 2739367656 Bacteria 5152243
244 2739648075 2739367663 Bacteria 5040914
245 2849283553 2849281842 Bacteria 6065644
246 2852628110 2852627209 Bacteria 5896285
247 2857630510 2857627736 Bacteria 5625397
248 2881957557 2881955468 Bacteria 3545609
249 2902050712 2902048731 Bacteria 4976191
250 2910247850 2910245624 Bacteria 6935613
251 2919441317 2919437846 Bacteria 6199444
252 2928080313 2928078545 Bacteria 6534839
253 2928149512 2928147474 Bacteria 6512076
254 2932083343 2932082852 Bacteria 6563563
255 2977232888 2977232053 Bacteria 5485925
256 8055591253 8055588893 Bacteria 3619545
257 rootH1_10150387
258 JGI24739J22299_10004155
259 JGI24737J22298_10002537
260 JGI24737J22298_10015760
261 JGI24743J22301_10020279
262 JGI24735J21928_10000002
263 JGI24735J21928_10005097
264 JGI24744J21845_10007642
265 JGI25162J39368_1000024
266 JGI25162J39368_1001318
267 JGI25157J39369_1004360
268 JGI25157J39369_1008109
269 JGI25164J39214_1000855
270 JGI25165J46597_1001051
271 rootH1_10034281
272 rootH1_10034282
273 rootH2_10005719
274 rootH2_10037397
275 rootH2_10051333
276 rootH1_10002666
277 rootH1_10009087
278 rootH1_10012302
279 rootH1_10062121
280 rootH1_10207268
281 rootH1_10229938
282 rootH1_10256108
283 Ga0065714_10007893
284 Ga0070658_10000011
285 Ga0070658_10201583
286 Ga0070676_10000277
287 Ga0068868_100005721
288 Ga0070660_100015693
289 Ga0070660_100047390
290 Ga0070675_100051700
291 Ga0070671_100042113
292 Ga0070673_100003782
293 Ga0070659_100000449
294 Ga0070659_100002083
295 Ga0070659_100263994
296 Ga0070678_100006236
297 Ga0070662_100000032
298 Ga0068867_100009759
299 Ga0068853_100008727
300 Ga0068853_100038977
301 Ga0070665_100000003
302 Ga0068855_100010454
303 Ga0068855_100032170
304 Ga0068857_100045223
305 Ga0068854_100278374
306 Ga0068856_100040048
307 Ga0068852_100002452
308 Ga0068852_100139862
309 Ga0068860_100056476
310 Ga0075366_10000804
311 Ga0075366_10045142
312 Ga0097621_100000165
313 Ga0068871_100000018
314 Ga0075431_100005370
315 Ga0068865_100000396
316 Ga0068865_100407076
317 Ga0105240_10000237
318 Ga0105240_10022011
319 Ga0105240_10029393
320 Ga0105240_10208449
321 Ga0105240_10293589
322 Ga0105240_10477687
323 Ga0114129_10012446
324 Ga0105243_10249038
325 Ga0105241_10007004
326 Ga0105241_10021319
327 Ga0105241_10030640
328 Ga0105242_10005497
329 Ga0105237_10000224
330 Ga0105237_10000963
331 Ga0105237_10001948
332 Ga0105237_10019011
333 Ga0105237_10061353
334 Ga0105237_10061401
335 Ga0105238_10037769
336 Ga0105238_10081151
337 Ga0105239_10000002
338 Ga0105239_10000013
339 Ga0105239_10001207
340 Ga0105239_10004436
341 Ga0105239_10006888
342 Ga0105239_10014078
343 Ga0105239_10016752
344 Ga0105239_10136791
345 Ga0105239_10391458
346 Ga0105246_10161741
347 Ga0157373_10000256
348 Ga0157373_10002482
349 Ga0157373_10025856
350 Ga0157373_10032956
351 Ga0157371_10000216
352 Ga0157371_10027826
353 Ga0157371_10066358
354 Ga0157370_10002361
355 Ga0157370_10021398
356 Ga0157370_10030370
357 Ga0157370_10108740
358 Ga0157369_10000046
359 Ga0157369_10089547
360 Ga0157369_10115336
361 Ga0157374_10000348
362 Ga0157374_10010541
363 Ga0157378_10035235
364 Ga0163162_10000031
365 Ga0163162_10009851
366 Ga0163162_10485823
367 Ga0157372_10003090
368 Ga0157372_10023256
369 Ga0157372_10029405
370 Ga0157372_10038494
371 Ga0157375_10033488
372 Ga0157375_10118550
373 Ga0182008_10000025
374 Ga0157377_10036751
375 Ga0157376_10044224
376 Ga0182007_10050298
377 Ga0183373_1008
378 Ga0163161_10029615
379 Ga0163161_10308308
380 Ga0213872_10035880
381 Ga0207427_100103
382 Ga0209437_100017
383 Ga0209437_100101
384 Ga0209026_1002049
385 Ga0209026_1003574
386 Ga0209129_1008535
387 Ga0209233_1000124
388 Ga0209233_1003362
389 Ga0209233_1011737
390 Ga0207647_10000104
391 Ga0207647_10028212
392 Ga0207645_10000650
393 Ga0207705_10000015
394 Ga0207705_10161618
395 Ga0207654_10007717
396 Ga0207654_10012469
397 Ga0207654_10019327
398 Ga0207695_10000013
399 Ga0207695_10005995
400 Ga0207695_10012058
401 Ga0207695_10295943
402 Ga0207695_10339707
403 Ga0207695_10389267
404 Ga0207671_10002707
405 Ga0207671_10005976
406 Ga0207671_10010699
407 Ga0207671_10015114
408 Ga0207671_10059455
409 Ga0207671_10162419
410 Ga0207657_10029952
411 Ga0207657_10057706
412 Ga0207694_10295411
413 Ga0207690_10003150
414 Ga0207690_10030854
415 Ga0207706_10000191
416 Ga0207709_10071013
417 Ga0207704_10000053
418 Ga0207667_10054870
419 Ga0207667_10066475
420 Ga0207651_10219916
421 Ga0207639_10006469
422 Ga0207639_10141665
423 Ga0207639_10346484
424 Ga0207702_10024798
425 Ga0207702_10206281
426 Ga0207648_10000175
427 Ga0207698_10004722
428 Ga0268266_10000018
429 Ga0268264_10031052
430 Ga0265326_10027091
431 Ga0307517_10002197
432 Ga0307515_10000927
433 Ga0307515_10001771
434 Ga0265338_10001011
435 Ga0265327_10000248
436 Ga0265327_10015148
437 Ga0307509_10045900
438 Ga0307410_10060760
439 Ga0307412_10459637
440 Ga0307414_10001471
441 Ga0307414_10034737
442 Ga0307414_10046227
443 Ga0307507_10000064
444 Ga0307510_10000328
445 Ga0395899_0000033
446 Ga0395899_0001077
447 Ga0395899_0065670
448 Ga0395900_0001393
449 Ga0395900_0003225
450 Ga0395898_0013831
451 Ga0395905_0001914
452 Ga0395901_0017854
453 Ga0395901_0111873
454 Ga0395901_0323341
455 Ga0436361_0307685
456 Ga0495627_023291
457 Ga0495650_0000003
458 Ga0495585_0000079
459 Ga0495585_0000411
460 Ga0495583_0041858
461 Ga0495606_0000116
462 Ga0495606_0012165
463 Ga0495606_0023782
464 Ga0495606_0026181
465 Ga0495606_0122159
466 Ga0495610_0004188
467 Ga0495616_0008226
468 Ga0495631_0037702
469 Ga0495644_0018713
470 Ga0495648_0002877
471 Ga0495648_0034727
472 Ga0495609_0033930
473 Ga0495622_0045381
474 Ga0495633_0000056
475 Ga0495625_0000159
476 Ga0495625_0001186
477 Ga0495625_0002144
478 Ga0495661_0001360
479 Ga0495661_0015325
480 Ga0495649_0000003
481 Ga0495600_0026176
482 Ga0495636_0000446
483 Ga0495687_002367
484 Ga0495677_0055187
485 Ga0495686_0001122
486 Ga0495686_0046959
487 Ga0496114_0418430
488 Ga0495678_010545
489 nmdc:mga0k408_51_c1
490 nmdc:mga0k408_7355_c1
491 nmdc:mga05p37_23296_c2
492 nmdc:mga09592_66506_c1
493 nmdc:mga06r32_4922_c1
494 Ga0500635_0000678
495 Ga0500608_005011
496 Ga0500618_000003
497 2599478629
498 2738761461
499 2739614666
500 2739648075
501 2849283553
502 2852628110
503 2857630510
504 2881957557
505 2902050712
506 2910247850
507 2919441317
508 2928080313
509 2928149512
510 2932083343
511 2977232888
512 8055591253

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22698

Semialdhyde_dhC_1

Semialdehyde dehydrogenase, dimerisation domain

167

326

0.96

PF01118

Semialdhyde_dh

Semialdehyde dehydrogenase, NAD binding domain

24

159

0.96

PF02774

Semialdhyde_dhC

Semialdehyde dehydrogenase, dimerisation domain

176

329

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cvo-assembly1.cif.gz_C crystal structure of putative n-acetyl-gamma-glutamyl-phosphate reductase (ak071544) from rice (oryza sativa) 0.8901 12 332
8afv-assembly1.cif.gz_B daargc3 - engineered formyl phosphate reductase with 3 substitutions (s178v, g182v, l233i) 0.881 13 329
1vkn-assembly1.cif.gz_B crystal structure of n-acetyl-gamma-glutamyl-phosphate reductase (tm1782) from thermotoga maritima at 1.80 a resolution 0.8803 12 332
1vkn-assembly1.cif.gz_C crystal structure of n-acetyl-gamma-glutamyl-phosphate reductase (tm1782) from thermotoga maritima at 1.80 a resolution 0.8775 12 332
8afv-assembly2.cif.gz_C daargc3 - engineered formyl phosphate reductase with 3 substitutions (s178v, g182v, l233i) 0.8771 13 328
ID Description Score Start End Superfamily
af_Q10SL7_36_116_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9002 13 55 3.40.50.720
2i3gB02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.8725 144 303 3.30.360.10
3dr3A02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.8681 145 305 3.30.360.10
af_G5ECJ8_3_395_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8677 11 49 3.50.50.60
af_Q2G1H4_146_311_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.8666 145 303 3.30.360.10
ID Description Score Start End GO Terms
AF-A0A4Q3R1R8-F1-model_v4 N-acetyl-gamma-glutamyl-phosphate reductase 1.001 12 105 GO:0006526
GO:0016620
GO:0051287
AF-A0A520H2P5-F1-model_v4 Semialdehyde dehydrogenase NAD-binding domain-containing protein 0.9987 12 110 GO:0006526
GO:0016620
GO:0051287
AF-A0A3D1I3L4-F1-model_v4 deleted 0.9924 12 95
AF-A0A4Q3TDH7-F1-model_v4 deleted 0.987 9 165
AF-A0A3D1I3L4-F1-model_v4 deleted 0.9808 12 95

Map