F366163
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 256 | 192 | 237 | 141 |
Family's Representative Sequence
| Representative Sequence | 3300003544|Ga0007417J51691_1059823|Ga0007417J51691_10598231 |
| Length | 144 |
| Sequence | MPPKKKKIVKTFTLQLKAASATPAPPVGPALGQHGVNIMEFVKAYNAATDSMRGDVVPAQITVYEDRTFTFVLKTPPAAQLLIKAAGVPKGSGVPQKDKVGKVTSAQVREIAEKKMSDLNANDIDQAMKIIAGTARSMGITVGE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2501939600 | Micromonospora sp. L5 | Isolate | Unclassified |
| 3 | 2515154088 | Salinispora arenicola CNT800 | Isolate | Rhizosphere |
| 4 | 2515154129 | Salinispora pacifica CNS103 | Isolate | Rhizosphere |
| 5 | 2515154137 | Salinispora arenicola CNX482 | Isolate | Rhizosphere |
| 6 | 2515154202 | Salinispora pacifica CNT084 | Isolate | Rhizosphere |
| 7 | 2515154203 | Salinispora arenicola CNR921 | Isolate | Rhizosphere |
| 8 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 9 | 2855683550 | Micromonospora sp. RP3T | Isolate | Unclassified |
| 10 | 2856858025 | Micromonospora aurantiaca 110B(2018) | Isolate | Unclassified |
| 11 | 2858868258 | Micromonospora sp. MH33 | Isolate | Unclassified |
| 12 | 2858902515 | Micromonospora sp. MW-13 | Isolate | Rhizosphere |
| 13 | 2867302475 | Micromonospora globbae WPS1-2 | Isolate | Unclassified |
| 14 | 2887478801 | Catellatospora paridis NEAU-CL2 | Isolate | Rhizosphere |
| 15 | 2902582711 | Micromonospora sp. AP08 | Isolate | Unclassified |
| 16 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 17 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 18 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 19 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 20 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 21 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 22 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 23 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 24 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 30 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 32 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 42 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 51 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 59 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 60 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 61 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 62 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 63 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 64 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 65 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 66 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 67 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 85 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 86 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 87 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 88 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 89 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 90 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 91 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 128 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 130 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 131 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 132 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 133 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 134 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 135 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 136 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 137 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 138 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 139 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 140 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 141 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 142 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 143 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 144 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 145 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 146 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 147 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 148 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 149 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 150 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 151 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 152 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 153 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 154 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 155 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 156 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 157 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 158 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 159 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 160 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 164 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 165 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 166 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 167 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 168 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 169 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 170 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 171 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 172 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 173 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 174 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 176 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 177 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 178 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 179 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 180 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 181 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 182 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 183 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 184 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 185 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 186 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 187 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 188 | 649633069 | Micromonospora sp. L5 | Isolate | Unclassified |
| 189 | 8001781756 | Catellatospora tritici NEAU-YM18 | Isolate | Rhizosphere |
| 190 | 8003856774 | Micromonospora echinofusca MPMI6 | Isolate | Unclassified |
| 191 | 8003870546 | Micromonospora tarensis STR1s_6 | Isolate | Rhizosphere |
| 192 | 8055412473 | Micromonospora phytophila DSM 105363 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 83.59 |
| Metatranscriptomes | 8.98 |
| Isolates | 7.42 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.56 |
| Nodule | 0.39 |
| Rhizoplane | 4.3 |
| Rhizosphere | 88.28 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.47 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_3741095 | 2162886007 | Bacteria | 2338 |
| 2 | JGI24034J26672_10060635 | 3300002239 | Bacteria | 664 |
| 3 | Ga0007417J51691_1059823 | 3300003544 | Bacteria | 765 |
| 4 | Ga0007410J51695_1037185 | 3300003574 | Bacteria | 734 |
| 5 | Ga0007429J51699_1085805 | 3300003579 | Bacteria | 858 |
| 6 | Ga0058859_11748156 | 3300004798 | Bacteria | 2152 |
| 7 | Ga0058859_11811491 | 3300004798 | Bacteria | 1207 |
| 8 | Ga0058861_11714049 | 3300004800 | Bacteria | 597 |
| 9 | Ga0058861_12007760 | 3300004800 | Bacteria | 777 |
| 10 | Ga0058860_12118084 | 3300004801 | Bacteria | 1266 |
| 11 | Ga0058860_12241562 | 3300004801 | Bacteria | 1475 |
| 12 | Ga0058862_12692948 | 3300004803 | Bacteria | 628 |
| 13 | Ga0065704_10081607 | 3300005289 | Bacteria | 3732 |
| 14 | Ga0070676_10028796 | 3300005328 | Bacteria | 3155 |
| 15 | Ga0070676_10073988 | 3300005328 | Bacteria | 2051 |
| 16 | Ga0070683_100040890 | 3300005329 | Bacteria | 4263 |
| 17 | Ga0070690_100131439 | 3300005330 | Bacteria | 1691 |
| 18 | Ga0070670_100018374 | 3300005331 | Bacteria | 5999 |
| 19 | Ga0070670_100203435 | 3300005331 | Bacteria | 1721 |
| 20 | Ga0068869_100062316 | 3300005334 | Bacteria | 2737 |
| 21 | Ga0068869_101536750 | 3300005334 | Bacteria | 592 |
| 22 | Ga0070682_100875689 | 3300005337 | Bacteria | 736 |
| 23 | Ga0070682_101500344 | 3300005337 | Bacteria | 580 |
| 24 | Ga0068868_100028338 | 3300005338 | Bacteria | 4281 |
| 25 | Ga0068868_100052642 | 3300005338 | Bacteria | 3205 |
| 26 | Ga0070689_100029357 | 3300005340 | Bacteria | 4162 |
| 27 | Ga0070661_100242365 | 3300005344 | Bacteria | 1389 |
| 28 | Ga0070692_10031182 | 3300005345 | Bacteria | 2671 |
| 29 | Ga0070668_100043325 | 3300005347 | Bacteria | 3451 |
| 30 | Ga0070668_100513348 | 3300005347 | Bacteria | 1039 |
| 31 | Ga0070669_100288041 | 3300005353 | Bacteria | 1318 |
| 32 | Ga0070675_100031497 | 3300005354 | Bacteria | 4287 |
| 33 | Ga0070675_100033839 | 3300005354 | Bacteria | 4144 |
| 34 | Ga0070671_101061714 | 3300005355 | Bacteria | 711 |
| 35 | Ga0070674_100008473 | 3300005356 | Bacteria | 6122 |
| 36 | Ga0070674_100081833 | 3300005356 | Bacteria | 2308 |
| 37 | Ga0070673_100037705 | 3300005364 | Bacteria | 3684 |
| 38 | Ga0070688_100003143 | 3300005365 | Bacteria | 8449 |
| 39 | Ga0070659_100091453 | 3300005366 | Bacteria | 2439 |
| 40 | Ga0070714_100036937 | 3300005435 | Bacteria | 4101 |
| 41 | Ga0070705_101145324 | 3300005440 | Bacteria | 638 |
| 42 | Ga0070700_100029333 | 3300005441 | Bacteria | 3279 |
| 43 | Ga0070700_100226599 | 3300005441 | Bacteria | 1328 |
| 44 | Ga0070663_100046620 | 3300005455 | Bacteria | 3067 |
| 45 | Ga0070663_100119320 | 3300005455 | Bacteria | 1990 |
| 46 | Ga0070678_100211995 | 3300005456 | Bacteria | 1605 |
| 47 | Ga0070678_100530320 | 3300005456 | Bacteria | 1043 |
| 48 | Ga0070662_100008427 | 3300005457 | Bacteria | 6720 |
| 49 | Ga0070681_10000289 | 3300005458 | Bacteria | 40654 |
| 50 | Ga0070681_10615577 | 3300005458 | Bacteria | 1000 |
| 51 | Ga0068867_101345958 | 3300005459 | Unclassified | 660 |
| 52 | Ga0070707_100031680 | 3300005468 | Bacteria | 5038 |
| 53 | Ga0070684_100053686 | 3300005535 | Bacteria | 3509 |
| 54 | Ga0070684_100065485 | 3300005535 | Bacteria | 3189 |
| 55 | Ga0070686_100015598 | 3300005544 | Bacteria | 4405 |
| 56 | Ga0070665_100053608 | 3300005548 | Bacteria | 4044 |
| 57 | Ga0070664_100003343 | 3300005564 | Bacteria | 12964 |
| 58 | Ga0070664_100091217 | 3300005564 | Bacteria | 2638 |
| 59 | Ga0070702_100007323 | 3300005615 | Bacteria | 5278 |
| 60 | Ga0068852_100610500 | 3300005616 | Bacteria | 1096 |
| 61 | Ga0068870_10007115 | 3300005840 | Bacteria | 4975 |
| 62 | Ga0068870_10230306 | 3300005840 | Bacteria | 1139 |
| 63 | Ga0068863_100448617 | 3300005841 | Bacteria | 1266 |
| 64 | Ga0068858_100154977 | 3300005842 | Bacteria | 2155 |
| 65 | Ga0068858_100825868 | 3300005842 | Bacteria | 905 |
| 66 | Ga0068860_100222046 | 3300005843 | Bacteria | 1835 |
| 67 | Ga0075365_10009696 | 3300006038 | Bacteria | 5557 |
| 68 | Ga0075428_101931698 | 3300006844 | Bacteria | 613 |
| 69 | Ga0075431_100774559 | 3300006847 | Bacteria | 934 |
| 70 | Ga0075431_100821669 | 3300006847 | Bacteria | 902 |
| 71 | Ga0075429_100650103 | 3300006880 | Bacteria | 924 |
| 72 | Ga0068865_101218690 | 3300006881 | Bacteria | 667 |
| 73 | Ga0111539_10064107 | 3300009094 | Bacteria | 4349 |
| 74 | Ga0111539_11000129 | 3300009094 | Bacteria | 972 |
| 75 | Ga0105245_10457185 | 3300009098 | Bacteria | 1286 |
| 76 | Ga0105245_10600604 | 3300009098 | Bacteria | 1127 |
| 77 | Ga0114129_10000114 | 3300009147 | Bacteria | 80730 |
| 78 | Ga0114129_10154522 | 3300009147 | Bacteria | 3139 |
| 79 | Ga0114129_10156027 | 3300009147 | Bacteria | 3121 |
| 80 | Ga0114129_11343785 | 3300009147 | Bacteria | 884 |
| 81 | Ga0105243_10051861 | 3300009148 | Bacteria | 3246 |
| 82 | Ga0105243_10078294 | 3300009148 | Bacteria | 2691 |
| 83 | Ga0105242_10244344 | 3300009176 | Bacteria | 1615 |
| 84 | Ga0105237_11110163 | 3300009545 | Bacteria | 798 |
| 85 | Ga0105238_10660178 | 3300009551 | Bacteria | 1056 |
| 86 | Ga0105238_10778245 | 3300009551 | Bacteria | 972 |
| 87 | Ga0105249_10225237 | 3300009553 | Bacteria | 1847 |
| 88 | Ga0105239_10187690 | 3300010375 | Bacteria | 2314 |
| 89 | Ga0105239_10981459 | 3300010375 | Bacteria | 971 |
| 90 | Ga0105246_10009303 | 3300011119 | Bacteria | 6051 |
| 91 | Ga0105246_10172691 | 3300011119 | Bacteria | 1657 |
| 92 | Ga0157378_10162515 | 3300013297 | Bacteria | 2089 |
| 93 | Ga0157372_10434779 | 3300013307 | Bacteria | 1529 |
| 94 | Ga0157375_10026124 | 3300013308 | Bacteria | 5437 |
| 95 | Ga0157375_10560386 | 3300013308 | Bacteria | 1304 |
| 96 | Ga0163163_10012417 | 3300014325 | Bacteria | 7760 |
| 97 | Ga0157380_10059121 | 3300014326 | Bacteria | 3058 |
| 98 | Ga0157380_10132475 | 3300014326 | Bacteria | 2129 |
| 99 | Ga0157377_10001184 | 3300014745 | Bacteria | 11091 |
| 100 | Ga0157377_10057344 | 3300014745 | Bacteria | 2214 |
| 101 | Ga0157379_10119099 | 3300014968 | Bacteria | 2375 |
| 102 | Ga0157379_10373425 | 3300014968 | Bacteria | 1308 |
| 103 | Ga0197907_10323729 | 3300020069 | Bacteria | 2006 |
| 104 | Ga0206349_1769847 | 3300020075 | Bacteria | 670 |
| 105 | Ga0206352_10158715 | 3300020078 | Bacteria | 906 |
| 106 | Ga0206350_10562332 | 3300020080 | Bacteria | 668 |
| 107 | Ga0206350_10664288 | 3300020080 | Bacteria | 979 |
| 108 | Ga0213873_10059222 | 3300021358 | Bacteria | 1032 |
| 109 | Ga0213876_10255309 | 3300021384 | Bacteria | 931 |
| 110 | Ga0224712_10024657 | 3300022467 | Bacteria | 2104 |
| 111 | Ga0207682_10073844 | 3300025893 | Bacteria | 1449 |
| 112 | Ga0207688_10009426 | 3300025901 | Bacteria | 5315 |
| 113 | Ga0207645_10031343 | 3300025907 | Bacteria | 3422 |
| 114 | Ga0207645_10076041 | 3300025907 | Bacteria | 2150 |
| 115 | Ga0207643_10070281 | 3300025908 | Bacteria | 2013 |
| 116 | Ga0207707_10000491 | 3300025912 | Bacteria | 40909 |
| 117 | Ga0207663_10278580 | 3300025916 | Bacteria | 1241 |
| 118 | Ga0207657_10070777 | 3300025919 | Bacteria | 2955 |
| 119 | Ga0207649_10624151 | 3300025920 | Bacteria | 831 |
| 120 | Ga0207652_10261228 | 3300025921 | Bacteria | 1562 |
| 121 | Ga0207646_10048284 | 3300025922 | Bacteria | 3816 |
| 122 | Ga0207681_10252008 | 3300025923 | Bacteria | 1379 |
| 123 | Ga0207650_10437722 | 3300025925 | Bacteria | 1087 |
| 124 | Ga0207659_10016549 | 3300025926 | Bacteria | 4801 |
| 125 | Ga0207687_10270499 | 3300025927 | Bacteria | 1358 |
| 126 | Ga0207687_11701919 | 3300025927 | Bacteria | 541 |
| 127 | Ga0207664_10172900 | 3300025929 | Bacteria | 1850 |
| 128 | Ga0207644_11043771 | 3300025931 | Bacteria | 686 |
| 129 | Ga0207690_10071709 | 3300025932 | Bacteria | 2390 |
| 130 | Ga0207706_10041598 | 3300025933 | Bacteria | 4073 |
| 131 | Ga0207686_10193402 | 3300025934 | Bacteria | 1452 |
| 132 | Ga0207709_10038377 | 3300025935 | Bacteria | 2852 |
| 133 | Ga0207709_10041829 | 3300025935 | Bacteria | 2752 |
| 134 | Ga0207670_10058300 | 3300025936 | Bacteria | 2622 |
| 135 | Ga0207670_10691843 | 3300025936 | Bacteria | 843 |
| 136 | Ga0207665_10232013 | 3300025939 | Bacteria | 1357 |
| 137 | Ga0207711_10158539 | 3300025941 | Bacteria | 2047 |
| 138 | Ga0207689_10014990 | 3300025942 | Bacteria | 6574 |
| 139 | Ga0207689_11048002 | 3300025942 | Bacteria | 688 |
| 140 | Ga0207661_10018072 | 3300025944 | Bacteria | 5234 |
| 141 | Ga0207679_10004175 | 3300025945 | Bacteria | 8977 |
| 142 | Ga0207651_10100728 | 3300025960 | Bacteria | 2142 |
| 143 | Ga0207712_10743572 | 3300025961 | Bacteria | 859 |
| 144 | Ga0207712_11429424 | 3300025961 | Bacteria | 619 |
| 145 | Ga0207668_10057071 | 3300025972 | Bacteria | 2722 |
| 146 | Ga0207668_10455767 | 3300025972 | Bacteria | 1092 |
| 147 | Ga0207658_11531736 | 3300025986 | Bacteria | 610 |
| 148 | Ga0207677_10011261 | 3300026023 | Bacteria | 5091 |
| 149 | Ga0207703_10190303 | 3300026035 | Bacteria | 1817 |
| 150 | Ga0207703_10220466 | 3300026035 | Bacteria | 1696 |
| 151 | Ga0207678_10037197 | 3300026067 | Bacteria | 4235 |
| 152 | Ga0207708_10014520 | 3300026075 | Bacteria | 5895 |
| 153 | Ga0207683_10016208 | 3300026121 | Bacteria | 6343 |
| 154 | Ga0207698_10207512 | 3300026142 | Bacteria | 1760 |
| 155 | Ga0207698_11760824 | 3300026142 | Bacteria | 635 |
| 156 | Ga0207428_10016667 | 3300027907 | Bacteria | 6319 |
| 157 | Ga0268264_10195686 | 3300028381 | Bacteria | 1846 |
| 158 | Ga0265319_1011168 | 3300028563 | Bacteria | 3697 |
| 159 | Ga0265334_10286854 | 3300028573 | Unclassified | 564 |
| 160 | Ga0265318_10031509 | 3300028577 | Bacteria | 2056 |
| 161 | Ga0265338_10124739 | 3300028800 | Bacteria | 2045 |
| 162 | Ga0265324_10086041 | 3300029957 | Bacteria | 1069 |
| 163 | Ga0265320_10008285 | 3300031240 | Bacteria | 6367 |
| 164 | Ga0265320_10100501 | 3300031240 | Bacteria | 1332 |
| 165 | Ga0265325_10015102 | 3300031241 | Bacteria | 4353 |
| 166 | Ga0265325_10114104 | 3300031241 | Bacteria | 1310 |
| 167 | Ga0265316_10102385 | 3300031344 | Bacteria | 2175 |
| 168 | Ga0265316_10128008 | 3300031344 | Unclassified | 1914 |
| 169 | Ga0265313_10011601 | 3300031595 | Bacteria | 5466 |
| 170 | Ga0307405_10755563 | 3300031731 | Bacteria | 810 |
| 171 | Ga0307406_10255777 | 3300031901 | Bacteria | 1322 |
| 172 | Ga0307407_10680057 | 3300031903 | Bacteria | 773 |
| 173 | Ga0307407_10925806 | 3300031903 | Bacteria | 670 |
| 174 | Ga0307409_100052647 | 3300031995 | Bacteria | 3123 |
| 175 | Ga0307409_100566765 | 3300031995 | Bacteria | 1117 |
| 176 | Ga0307415_100084396 | 3300032126 | Bacteria | 2279 |
| 177 | Ga0307415_100202208 | 3300032126 | Bacteria | 1577 |
| 178 | Ga0307415_101311397 | 3300032126 | Bacteria | 686 |
| 179 | Ga0316588_1000633 | 3300033528 | Bacteria | 5052 |
| 180 | Ga0395899_0415902 | 3300037312 | Bacteria | 887 |
| 181 | Ga0395898_0612191 | 3300037466 | Bacteria | 1032 |
| 182 | Ga0436365_0453863 | 3300039437 | Bacteria | 6719 |
| 183 | Ga0436362_0804259 | 3300039453 | Bacteria | 2593 |
| 184 | Ga0451793_0621619 | 3300041452 | Bacteria | 684 |
| 185 | Ga0451807_0085772 | 3300041486 | Bacteria | 880 |
| 186 | Ga0439454_030988 | 3300042011 | Bacteria | 838 |
| 187 | Ga0439456_007529 | 3300042013 | Bacteria | 2238 |
| 188 | Ga0451577_0000001 | 3300042876 | Bacteria | 2461803 |
| 189 | Ga0466966_0845770 | 3300044684 | Bacteria | 552 |
| 190 | Ga0466961_0337768 | 3300044693 | Bacteria | 918 |
| 191 | Ga0466963_0056173 | 3300044694 | Bacteria | 2619 |
| 192 | Ga0466963_0150240 | 3300044694 | Bacteria | 1617 |
| 193 | Ga0466963_0594788 | 3300044694 | Bacteria | 781 |
| 194 | Ga0453684_0088581 | 3300044712 | Bacteria | 3832 |
| 195 | Ga0451576_0000067 | 3300045051 | Bacteria | 265145 |
| 196 | Ga0451576_0149610 | 3300045051 | Bacteria | 2435 |
| 197 | Ga0451576_0301562 | 3300045051 | Bacteria | 1676 |
| 198 | Ga0466958_0042925 | 3300045836 | Bacteria | 2723 |
| 199 | Ga0466958_0101856 | 3300045836 | Bacteria | 1786 |
| 200 | Ga0466967_0244589 | 3300045976 | Bacteria | 1712 |
| 201 | Ga0466967_0801824 | 3300045976 | Bacteria | 935 |
| 202 | Ga0495667_0465973 | 3300046559 | Bacteria | 793 |
| 203 | Ga0495656_0386603 | 3300046615 | Bacteria | 730 |
| 204 | Ga0495581_0814490 | 3300047315 | Bacteria | 535 |
| 205 | Ga0496101_0913098 | 3300048904 | Bacteria | 691 |
| 206 | Ga0496104_0330981 | 3300048907 | Bacteria | 1436 |
| 207 | Ga0496108_0048957 | 3300048911 | Bacteria | 3534 |
| 208 | Ga0496108_0088097 | 3300048911 | Bacteria | 2637 |
| 209 | Ga0496109_0089265 | 3300048912 | Bacteria | 2849 |
| 210 | Ga0496109_0523477 | 3300048912 | Bacteria | 1119 |
| 211 | Ga0496110_0334381 | 3300048913 | Bacteria | 1380 |
| 212 | Ga0496110_0344041 | 3300048913 | Bacteria | 1358 |
| 213 | Ga0496111_0299316 | 3300048914 | Bacteria | 1192 |
| 214 | Ga0501318_025239 | 3300049534 | Bacteria | 778 |
| 215 | Ga0501036_1497541 | 3300049572 | Bacteria | 546 |
| 216 | Ga0501040_0548054 | 3300049576 | Bacteria | 835 |
| 217 | Ga0501048_1290565 | 3300049582 | Bacteria | 525 |
| 218 | Ga0501249_000156 | 3300049679 | Bacteria | 21248 |
| 219 | Ga0501083_0000044 | 3300049744 | Bacteria | 91900 |
| 220 | nmdc:mga0yw44_426805_c1 | 3300050492 | Bacteria | 898 |
| 221 | nmdc:mga05p37_1507_c1 | 3300050507 | Bacteria | 27071 |
| 222 | nmdc:mga05p37_60338_c3 | 3300050507 | Bacteria | 3055 |
| 223 | nmdc:mga09592_1107895_c1 | 3300050508 | Bacteria | 658 |
| 224 | nmdc:mga09592_274614_c1 | 3300050508 | Bacteria | 1462 |
| 225 | nmdc:mga06r32_220681_c1 | 3300050510 | Bacteria | 1884 |
| 226 | nmdc:mga06r32_381526_c1 | 3300050510 | Bacteria | 1392 |
| 227 | nmdc:mga06r32_440257_c1 | 3300050510 | Bacteria | 1283 |
| 228 | nmdc:mga08y16_1143137_c1 | 3300050511 | Bacteria | 752 |
| 229 | nmdc:mga08y16_37108_c1 | 3300050511 | Bacteria | 5118 |
| 230 | Ga0500643_160004 | 3300053087 | Bacteria | 604 |
| 231 | Ga0500594_0000002 | 3300053118 | Bacteria | 916890 |
| 232 | Ga0587070_063767 | 3300059491 | Bacteria | 769 |
| 233 | Ga0587077_132668 | 3300059493 | Bacteria | 634 |
| 234 | Ga0587080_088296 | 3300059503 | Bacteria | 647 |
| 235 | Ga0587101_030810 | 3300059623 | Bacteria | 836 |
| 236 | Ga0587062_135405 | 3300059639 | Bacteria | 510 |
| 237 | Ga0466962_0069648 | 3300061719 | Bacteria | 1680 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025939 | Ga0207665_10232013 | Ga0207665_102320131 | 118 |
| 2 | 3300031344 | Ga0265316_10128008 | Ga0265316_101280083 | 121 |
| 3 | 3300005842 | Ga0068858_100154977 | Ga0068858_1001549772 | 122 |
| 4 | 3300014968 | Ga0157379_10119099 | Ga0157379_101190993 | 122 |
| 5 | 3300026035 | Ga0207703_10190303 | Ga0207703_101903032 | 122 |
| 6 | 3300004800 | Ga0058861_12007760 | Ga0058861_120077602 | 125 |
| 7 | 3300044712 | Ga0453684_0088581 | Ga0453684_0088581_1651_2073 | 125 |
| 8 | 3300005468 | Ga0070707_100031680 | Ga0070707_1000316803 | 127 |
| 9 | 3300025921 | Ga0207652_10261228 | Ga0207652_102612281 | 127 |
| 10 | 3300025922 | Ga0207646_10048284 | Ga0207646_100482843 | 127 |
| 11 | 3300045051 | Ga0451576_0000067 | Ga0451576_0000067_23994_24419 | 127 |
| 12 | 3300041486 | Ga0451807_0085772 | Ga0451807_0085772_24_455 | 130 |
| 13 | 3300009147 | Ga0114129_10154522 | Ga0114129_101545224 | 134 |
| 14 | 3300048904 | Ga0496101_0913098 | Ga0496101_0913098_121_525 | 134 |
| 15 | 3300050508 | nmdc:mga09592_274614_c1 | nmdc:mga09592_274614_c1_530_940 | 136 |
| 16 | 3300050510 | nmdc:mga06r32_220681_c1 | nmdc:mga06r32_220681_c1_227_637 | 136 |
| 17 | 3300009147 | Ga0114129_11343785 | Ga0114129_113437852 | 139 |
| 18 | 3300025916 | Ga0207663_10278580 | Ga0207663_102785802 | 139 |
| 19 | 3300046615 | Ga0495656_0386603 | Ga0495656_0386603_258_677 | 139 |
| 20 | iso_pu_bacteria | 2501939600 | 2501945155 | 139 |
| 21 | iso_pu_bacteria | 2515154088 | 2515496714 | 139 |
| 22 | iso_pu_bacteria | 2515154129 | 2515718285 | 139 |
| 23 | iso_pu_bacteria | 2515154137 | 2515756953 | 139 |
| 24 | iso_pu_bacteria | 2515154202 | 2516083555 | 139 |
| 25 | iso_pu_bacteria | 2515154203 | 2516089491 | 139 |
| 26 | iso_pu_bacteria | 2675903059 | 2676480105 | 139 |
| 27 | iso_pu_bacteria | 2855683550 | 2855684494 | 139 |
| 28 | iso_pu_bacteria | 2856858025 | 2856858891 | 139 |
| 29 | iso_pu_bacteria | 2858868258 | 2858870681 | 139 |
| 30 | iso_pu_bacteria | 2858902515 | 2858902912 | 139 |
| 31 | iso_pu_bacteria | 2867302475 | 2867307190 | 139 |
| 32 | iso_pu_bacteria | 2887478801 | 2887486679 | 139 |
| 33 | iso_pu_bacteria | 2902582711 | 2902584298 | 139 |
| 34 | iso_pu_bacteria | 649633069 | 649810799 | 139 |
| 35 | iso_pu_bacteria | 8001781756 | 8001785191 | 139 |
| 36 | iso_pu_bacteria | 8003856774 | 8003861991 | 139 |
| 37 | iso_pu_bacteria | 8003870546 | 8003874673 | 139 |
| 38 | iso_pu_bacteria | 8055412473 | 8055412867 | 139 |
| 39 | 3300004800 | Ga0058861_11714049 | Ga0058861_117140491 | 140 |
| 40 | 3300004803 | Ga0058862_12692948 | Ga0058862_126929481 | 140 |
| 41 | 3300005440 | Ga0070705_101145324 | Ga0070705_1011453241 | 140 |
| 42 | 3300005458 | Ga0070681_10000289 | Ga0070681_100002895 | 140 |
| 43 | 3300013307 | Ga0157372_10434779 | Ga0157372_104347791 | 140 |
| 44 | 3300020078 | Ga0206352_10158715 | Ga0206352_101587152 | 140 |
| 45 | 3300021358 | Ga0213873_10059222 | Ga0213873_100592221 | 140 |
| 46 | 3300021384 | Ga0213876_10255309 | Ga0213876_102553091 | 140 |
| 47 | 3300025912 | Ga0207707_10000491 | Ga0207707_1000049126 | 140 |
| 48 | 3300029957 | Ga0265324_10086041 | Ga0265324_100860412 | 140 |
| 49 | 3300032126 | Ga0307415_101311397 | Ga0307415_1013113971 | 140 |
| 50 | 3300039437 | Ga0436365_0453863 | Ga0436365_0453863_2686_3108 | 140 |
| 51 | 3300039453 | Ga0436362_0804259 | Ga0436362_0804259_692_1120 | 140 |
| 52 | 3300042876 | Ga0451577_0000001 | Ga0451577_0000001_726709_727131 | 140 |
| 53 | 3300044684 | Ga0466966_0845770 | Ga0466966_0845770_53_475 | 140 |
| 54 | 3300044693 | Ga0466961_0337768 | Ga0466961_0337768_301_723 | 140 |
| 55 | 3300044694 | Ga0466963_0150240 | Ga0466963_0150240_185_607 | 140 |
| 56 | 3300044694 | Ga0466963_0594788 | Ga0466963_0594788_308_730 | 140 |
| 57 | 3300045051 | Ga0451576_0301562 | Ga0451576_0301562_157_579 | 140 |
| 58 | 3300045836 | Ga0466958_0042925 | Ga0466958_0042925_594_1016 | 140 |
| 59 | 3300045836 | Ga0466958_0101856 | Ga0466958_0101856_1336_1758 | 140 |
| 60 | 3300049582 | Ga0501048_1290565 | Ga0501048_1290565_42_470 | 140 |
| 61 | 3300049679 | Ga0501249_000156 | Ga0501249_000156_7752_8174 | 140 |
| 62 | 3300049744 | Ga0501083_0000044 | Ga0501083_0000044_81126_81548 | 140 |
| 63 | 3300053087 | Ga0500643_160004 | Ga0500643_160004_57_479 | 140 |
| 64 | 3300059493 | Ga0587077_132668 | Ga0587077_132668_96_518 | 140 |
| 65 | 3300059639 | Ga0587062_135405 | Ga0587062_135405_43_465 | 140 |
| 66 | 3300061719 | Ga0466962_0069648 | Ga0466962_0069648_487_909 | 140 |
| 67 | 2162886007 | SwRhRL2b_contig_3741095 | SwRhRL2b_0503.00000970 | 141 |
| 68 | 3300002239 | JGI24034J26672_10060635 | JGI24034J26672_100606351 | 141 |
| 69 | 3300003544 | Ga0007417J51691_1059823 | Ga0007417J51691_10598231 | 141 |
| 70 | 3300003574 | Ga0007410J51695_1037185 | Ga0007410J51695_10371851 | 141 |
| 71 | 3300003579 | Ga0007429J51699_1085805 | Ga0007429J51699_10858052 | 141 |
| 72 | 3300004798 | Ga0058859_11748156 | Ga0058859_117481563 | 141 |
| 73 | 3300004798 | Ga0058859_11811491 | Ga0058859_118114912 | 141 |
| 74 | 3300004801 | Ga0058860_12118084 | Ga0058860_121180842 | 141 |
| 75 | 3300004801 | Ga0058860_12241562 | Ga0058860_122415621 | 141 |
| 76 | 3300005289 | Ga0065704_10081607 | Ga0065704_100816073 | 141 |
| 77 | 3300005328 | Ga0070676_10028796 | Ga0070676_100287962 | 141 |
| 78 | 3300005328 | Ga0070676_10073988 | Ga0070676_100739882 | 141 |
| 79 | 3300005329 | Ga0070683_100040890 | Ga0070683_1000408902 | 141 |
| 80 | 3300005330 | Ga0070690_100131439 | Ga0070690_1001314391 | 141 |
| 81 | 3300005331 | Ga0070670_100018374 | Ga0070670_1000183745 | 141 |
| 82 | 3300005331 | Ga0070670_100203435 | Ga0070670_1002034351 | 141 |
| 83 | 3300005334 | Ga0068869_100062316 | Ga0068869_1000623162 | 141 |
| 84 | 3300005334 | Ga0068869_101536750 | Ga0068869_1015367501 | 141 |
| 85 | 3300005337 | Ga0070682_100875689 | Ga0070682_1008756892 | 141 |
| 86 | 3300005337 | Ga0070682_101500344 | Ga0070682_1015003441 | 141 |
| 87 | 3300005338 | Ga0068868_100028338 | Ga0068868_1000283382 | 141 |
| 88 | 3300005338 | Ga0068868_100052642 | Ga0068868_1000526425 | 141 |
| 89 | 3300005340 | Ga0070689_100029357 | Ga0070689_1000293572 | 141 |
| 90 | 3300005344 | Ga0070661_100242365 | Ga0070661_1002423652 | 141 |
| 91 | 3300005345 | Ga0070692_10031182 | Ga0070692_100311823 | 141 |
| 92 | 3300005347 | Ga0070668_100043325 | Ga0070668_1000433253 | 141 |
| 93 | 3300005347 | Ga0070668_100513348 | Ga0070668_1005133482 | 141 |
| 94 | 3300005353 | Ga0070669_100288041 | Ga0070669_1002880412 | 141 |
| 95 | 3300005354 | Ga0070675_100031497 | Ga0070675_1000314976 | 141 |
| 96 | 3300005354 | Ga0070675_100033839 | Ga0070675_1000338395 | 141 |
| 97 | 3300005355 | Ga0070671_101061714 | Ga0070671_1010617142 | 141 |
| 98 | 3300005356 | Ga0070674_100008473 | Ga0070674_1000084732 | 141 |
| 99 | 3300005356 | Ga0070674_100081833 | Ga0070674_1000818336 | 141 |
| 100 | 3300005364 | Ga0070673_100037705 | Ga0070673_1000377058 | 141 |
| 101 | 3300005365 | Ga0070688_100003143 | Ga0070688_1000031437 | 141 |
| 102 | 3300005366 | Ga0070659_100091453 | Ga0070659_1000914533 | 141 |
| 103 | 3300005435 | Ga0070714_100036937 | Ga0070714_1000369373 | 141 |
| 104 | 3300005441 | Ga0070700_100029333 | Ga0070700_1000293332 | 141 |
| 105 | 3300005441 | Ga0070700_100226599 | Ga0070700_1002265991 | 141 |
| 106 | 3300005455 | Ga0070663_100046620 | Ga0070663_1000466204 | 141 |
| 107 | 3300005455 | Ga0070663_100119320 | Ga0070663_1001193205 | 141 |
| 108 | 3300005456 | Ga0070678_100211995 | Ga0070678_1002119952 | 141 |
| 109 | 3300005456 | Ga0070678_100530320 | Ga0070678_1005303202 | 141 |
| 110 | 3300005457 | Ga0070662_100008427 | Ga0070662_1000084274 | 141 |
| 111 | 3300005458 | Ga0070681_10615577 | Ga0070681_106155772 | 141 |
| 112 | 3300005459 | Ga0068867_101345958 | Ga0068867_1013459581 | 141 |
| 113 | 3300005535 | Ga0070684_100053686 | Ga0070684_1000536862 | 141 |
| 114 | 3300005535 | Ga0070684_100065485 | Ga0070684_1000654853 | 141 |
| 115 | 3300005544 | Ga0070686_100015598 | Ga0070686_1000155985 | 141 |
| 116 | 3300005548 | Ga0070665_100053608 | Ga0070665_1000536088 | 141 |
| 117 | 3300005564 | Ga0070664_100003343 | Ga0070664_10000334319 | 141 |
| 118 | 3300005564 | Ga0070664_100091217 | Ga0070664_1000912172 | 141 |
| 119 | 3300005615 | Ga0070702_100007323 | Ga0070702_1000073232 | 141 |
| 120 | 3300005616 | Ga0068852_100610500 | Ga0068852_1006105002 | 141 |
| 121 | 3300005840 | Ga0068870_10007115 | Ga0068870_100071157 | 141 |
| 122 | 3300005840 | Ga0068870_10230306 | Ga0068870_102303062 | 141 |
| 123 | 3300005841 | Ga0068863_100448617 | Ga0068863_1004486171 | 141 |
| 124 | 3300005842 | Ga0068858_100825868 | Ga0068858_1008258681 | 141 |
| 125 | 3300005843 | Ga0068860_100222046 | Ga0068860_1002220462 | 141 |
| 126 | 3300006038 | Ga0075365_10009696 | Ga0075365_100096968 | 141 |
| 127 | 3300006844 | Ga0075428_101931698 | Ga0075428_1019316982 | 141 |
| 128 | 3300006847 | Ga0075431_100774559 | Ga0075431_1007745592 | 141 |
| 129 | 3300006847 | Ga0075431_100821669 | Ga0075431_1008216692 | 141 |
| 130 | 3300006880 | Ga0075429_100650103 | Ga0075429_1006501032 | 141 |
| 131 | 3300006881 | Ga0068865_101218690 | Ga0068865_1012186901 | 141 |
| 132 | 3300009094 | Ga0111539_10064107 | Ga0111539_100641072 | 141 |
| 133 | 3300009094 | Ga0111539_11000129 | Ga0111539_110001292 | 141 |
| 134 | 3300009098 | Ga0105245_10457185 | Ga0105245_104571852 | 141 |
| 135 | 3300009098 | Ga0105245_10600604 | Ga0105245_106006042 | 141 |
| 136 | 3300009147 | Ga0114129_10000114 | Ga0114129_1000011432 | 141 |
| 137 | 3300009147 | Ga0114129_10156027 | Ga0114129_101560274 | 141 |
| 138 | 3300009148 | Ga0105243_10051861 | Ga0105243_100518614 | 141 |
| 139 | 3300009148 | Ga0105243_10078294 | Ga0105243_100782943 | 141 |
| 140 | 3300009176 | Ga0105242_10244344 | Ga0105242_102443443 | 141 |
| 141 | 3300009545 | Ga0105237_11110163 | Ga0105237_111101632 | 141 |
| 142 | 3300009551 | Ga0105238_10660178 | Ga0105238_106601782 | 141 |
| 143 | 3300009551 | Ga0105238_10778245 | Ga0105238_107782452 | 141 |
| 144 | 3300009553 | Ga0105249_10225237 | Ga0105249_102252373 | 141 |
| 145 | 3300010375 | Ga0105239_10187690 | Ga0105239_101876902 | 141 |
| 146 | 3300010375 | Ga0105239_10981459 | Ga0105239_109814592 | 141 |
| 147 | 3300011119 | Ga0105246_10009303 | Ga0105246_100093039 | 141 |
| 148 | 3300011119 | Ga0105246_10172691 | Ga0105246_101726911 | 141 |
| 149 | 3300013297 | Ga0157378_10162515 | Ga0157378_101625152 | 141 |
| 150 | 3300013308 | Ga0157375_10026124 | Ga0157375_100261244 | 141 |
| 151 | 3300013308 | Ga0157375_10560386 | Ga0157375_105603862 | 141 |
| 152 | 3300014325 | Ga0163163_10012417 | Ga0163163_100124177 | 141 |
| 153 | 3300014326 | Ga0157380_10059121 | Ga0157380_100591213 | 141 |
| 154 | 3300014326 | Ga0157380_10132475 | Ga0157380_101324752 | 141 |
| 155 | 3300014745 | Ga0157377_10001184 | Ga0157377_100011843 | 141 |
| 156 | 3300014745 | Ga0157377_10057344 | Ga0157377_100573442 | 141 |
| 157 | 3300014968 | Ga0157379_10373425 | Ga0157379_103734252 | 141 |
| 158 | 3300020069 | Ga0197907_10323729 | Ga0197907_103237292 | 141 |
| 159 | 3300020075 | Ga0206349_1769847 | Ga0206349_17698471 | 141 |
| 160 | 3300020080 | Ga0206350_10562332 | Ga0206350_105623321 | 141 |
| 161 | 3300020080 | Ga0206350_10664288 | Ga0206350_106642882 | 141 |
| 162 | 3300022467 | Ga0224712_10024657 | Ga0224712_100246572 | 141 |
| 163 | 3300025893 | Ga0207682_10073844 | Ga0207682_100738442 | 141 |
| 164 | 3300025901 | Ga0207688_10009426 | Ga0207688_100094266 | 141 |
| 165 | 3300025907 | Ga0207645_10031343 | Ga0207645_100313433 | 141 |
| 166 | 3300025907 | Ga0207645_10076041 | Ga0207645_100760413 | 141 |
| 167 | 3300025908 | Ga0207643_10070281 | Ga0207643_100702812 | 141 |
| 168 | 3300025919 | Ga0207657_10070777 | Ga0207657_100707772 | 141 |
| 169 | 3300025920 | Ga0207649_10624151 | Ga0207649_106241512 | 141 |
| 170 | 3300025923 | Ga0207681_10252008 | Ga0207681_102520082 | 141 |
| 171 | 3300025925 | Ga0207650_10437722 | Ga0207650_104377222 | 141 |
| 172 | 3300025926 | Ga0207659_10016549 | Ga0207659_100165493 | 141 |
| 173 | 3300025927 | Ga0207687_10270499 | Ga0207687_102704991 | 141 |
| 174 | 3300025927 | Ga0207687_11701919 | Ga0207687_117019191 | 141 |
| 175 | 3300025929 | Ga0207664_10172900 | Ga0207664_101729003 | 141 |
| 176 | 3300025931 | Ga0207644_11043771 | Ga0207644_110437712 | 141 |
| 177 | 3300025932 | Ga0207690_10071709 | Ga0207690_100717092 | 141 |
| 178 | 3300025933 | Ga0207706_10041598 | Ga0207706_100415982 | 141 |
| 179 | 3300025934 | Ga0207686_10193402 | Ga0207686_101934022 | 141 |
| 180 | 3300025935 | Ga0207709_10038377 | Ga0207709_100383773 | 141 |
| 181 | 3300025935 | Ga0207709_10041829 | Ga0207709_100418294 | 141 |
| 182 | 3300025936 | Ga0207670_10058300 | Ga0207670_100583002 | 141 |
| 183 | 3300025936 | Ga0207670_10691843 | Ga0207670_106918432 | 141 |
| 184 | 3300025941 | Ga0207711_10158539 | Ga0207711_101585392 | 141 |
| 185 | 3300025942 | Ga0207689_10014990 | Ga0207689_1001499010 | 141 |
| 186 | 3300025942 | Ga0207689_11048002 | Ga0207689_110480021 | 141 |
| 187 | 3300025944 | Ga0207661_10018072 | Ga0207661_100180725 | 141 |
| 188 | 3300025945 | Ga0207679_10004175 | Ga0207679_100041755 | 141 |
| 189 | 3300025960 | Ga0207651_10100728 | Ga0207651_101007282 | 141 |
| 190 | 3300025961 | Ga0207712_10743572 | Ga0207712_107435722 | 141 |
| 191 | 3300025961 | Ga0207712_11429424 | Ga0207712_114294242 | 141 |
| 192 | 3300025972 | Ga0207668_10057071 | Ga0207668_100570711 | 141 |
| 193 | 3300025972 | Ga0207668_10455767 | Ga0207668_104557672 | 141 |
| 194 | 3300025986 | Ga0207658_11531736 | Ga0207658_115317361 | 141 |
| 195 | 3300026023 | Ga0207677_10011261 | Ga0207677_100112615 | 141 |
| 196 | 3300026035 | Ga0207703_10220466 | Ga0207703_102204662 | 141 |
| 197 | 3300026067 | Ga0207678_10037197 | Ga0207678_100371972 | 141 |
| 198 | 3300026075 | Ga0207708_10014520 | Ga0207708_100145205 | 141 |
| 199 | 3300026121 | Ga0207683_10016208 | Ga0207683_100162089 | 141 |
| 200 | 3300026142 | Ga0207698_10207512 | Ga0207698_102075122 | 141 |
| 201 | 3300026142 | Ga0207698_11760824 | Ga0207698_117608242 | 141 |
| 202 | 3300027907 | Ga0207428_10016667 | Ga0207428_100166672 | 141 |
| 203 | 3300028381 | Ga0268264_10195686 | Ga0268264_101956862 | 141 |
| 204 | 3300028563 | Ga0265319_1011168 | Ga0265319_10111685 | 141 |
| 205 | 3300028573 | Ga0265334_10286854 | Ga0265334_102868542 | 141 |
| 206 | 3300028577 | Ga0265318_10031509 | Ga0265318_100315094 | 141 |
| 207 | 3300028800 | Ga0265338_10124739 | Ga0265338_101247391 | 141 |
| 208 | 3300031240 | Ga0265320_10008285 | Ga0265320_100082852 | 141 |
| 209 | 3300031240 | Ga0265320_10100501 | Ga0265320_101005012 | 141 |
| 210 | 3300031241 | Ga0265325_10015102 | Ga0265325_100151026 | 141 |
| 211 | 3300031241 | Ga0265325_10114104 | Ga0265325_101141042 | 141 |
| 212 | 3300031344 | Ga0265316_10102385 | Ga0265316_101023853 | 141 |
| 213 | 3300031595 | Ga0265313_10011601 | Ga0265313_1001160111 | 141 |
| 214 | 3300031731 | Ga0307405_10755563 | Ga0307405_107555631 | 141 |
| 215 | 3300031901 | Ga0307406_10255777 | Ga0307406_102557772 | 141 |
| 216 | 3300031903 | Ga0307407_10680057 | Ga0307407_106800571 | 141 |
| 217 | 3300031903 | Ga0307407_10925806 | Ga0307407_109258061 | 141 |
| 218 | 3300031995 | Ga0307409_100052647 | Ga0307409_1000526472 | 141 |
| 219 | 3300031995 | Ga0307409_100566765 | Ga0307409_1005667652 | 141 |
| 220 | 3300032126 | Ga0307415_100084396 | Ga0307415_1000843963 | 141 |
| 221 | 3300032126 | Ga0307415_100202208 | Ga0307415_1002022081 | 141 |
| 222 | 3300033528 | Ga0316588_1000633 | Ga0316588_10006335 | 141 |
| 223 | 3300037312 | Ga0395899_0415902 | Ga0395899_0415902_359_784 | 141 |
| 224 | 3300037466 | Ga0395898_0612191 | Ga0395898_0612191_243_674 | 141 |
| 225 | 3300041452 | Ga0451793_0621619 | Ga0451793_0621619_110_544 | 141 |
| 226 | 3300042011 | Ga0439454_030988 | Ga0439454_030988_347_772 | 141 |
| 227 | 3300042013 | Ga0439456_007529 | Ga0439456_007529_1200_1625 | 141 |
| 228 | 3300044694 | Ga0466963_0056173 | Ga0466963_0056173_1219_1653 | 141 |
| 229 | 3300045051 | Ga0451576_0149610 | Ga0451576_0149610_248_673 | 141 |
| 230 | 3300045976 | Ga0466967_0244589 | Ga0466967_0244589_328_753 | 141 |
| 231 | 3300045976 | Ga0466967_0801824 | Ga0466967_0801824_206_640 | 141 |
| 232 | 3300046559 | Ga0495667_0465973 | Ga0495667_0465973_232_657 | 141 |
| 233 | 3300047315 | Ga0495581_0814490 | Ga0495581_0814490_19_453 | 141 |
| 234 | 3300048907 | Ga0496104_0330981 | Ga0496104_0330981_913_1338 | 141 |
| 235 | 3300048911 | Ga0496108_0048957 | Ga0496108_0048957_1946_2371 | 141 |
| 236 | 3300048911 | Ga0496108_0088097 | Ga0496108_0088097_2065_2490 | 141 |
| 237 | 3300048912 | Ga0496109_0089265 | Ga0496109_0089265_1269_1694 | 141 |
| 238 | 3300048912 | Ga0496109_0523477 | Ga0496109_0523477_182_607 | 141 |
| 239 | 3300048913 | Ga0496110_0334381 | Ga0496110_0334381_437_862 | 141 |
| 240 | 3300048913 | Ga0496110_0344041 | Ga0496110_0344041_181_606 | 141 |
| 241 | 3300048914 | Ga0496111_0299316 | Ga0496111_0299316_727_1152 | 141 |
| 242 | 3300049534 | Ga0501318_025239 | Ga0501318_025239_271_705 | 141 |
| 243 | 3300049572 | Ga0501036_1497541 | Ga0501036_1497541_91_522 | 141 |
| 244 | 3300049576 | Ga0501040_0548054 | Ga0501040_0548054_358_783 | 141 |
| 245 | 3300050492 | nmdc:mga0yw44_426805_c1 | nmdc:mga0yw44_426805_c1_432_863 | 141 |
| 246 | 3300050507 | nmdc:mga05p37_1507_c1 | nmdc:mga05p37_1507_c1_25774_26208 | 141 |
| 247 | 3300050507 | nmdc:mga05p37_60338_c3 | nmdc:mga05p37_60338_c3_599_1027 | 141 |
| 248 | 3300050508 | nmdc:mga09592_1107895_c1 | nmdc:mga09592_1107895_c1_165_590 | 141 |
| 249 | 3300050510 | nmdc:mga06r32_381526_c1 | nmdc:mga06r32_381526_c1_627_1061 | 141 |
| 250 | 3300050510 | nmdc:mga06r32_440257_c1 | nmdc:mga06r32_440257_c1_156_581 | 141 |
| 251 | 3300050511 | nmdc:mga08y16_1143137_c1 | nmdc:mga08y16_1143137_c1_247_678 | 141 |
| 252 | 3300050511 | nmdc:mga08y16_37108_c1 | nmdc:mga08y16_37108_c1_3898_4329 | 141 |
| 253 | 3300053118 | Ga0500594_0000002 | Ga0500594_0000002_796123_796548 | 141 |
| 254 | 3300059491 | Ga0587070_063767 | Ga0587070_063767_71_496 | 141 |
| 255 | 3300059503 | Ga0587080_088296 | Ga0587080_088296_167_598 | 141 |
| 256 | 3300059623 | Ga0587101_030810 | Ga0587101_030810_124_558 | 141 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1mms-assembly2.cif.gz_B | crystal structure of the ribosomal protein l11-rna complex | 0.9873 | 71 | 140 |
| 3cjt-assembly4.cif.gz_H | ribosomal protein l11 methyltransferase (prma) in complex with dimethylated ribosomal protein l11 | 0.9845 | 3 | 72 |
| 1y39-assembly2.cif.gz_B | co-evolution of protein and rna structures within a highly conserved ribosomal domain | 0.9816 | 71 | 141 |
| 3egv-assembly1.cif.gz_B | ribosomal protein l11 methyltransferase (prma) in complex with trimethylated ribosomal protein l11 | 0.9807 | 3 | 78 |
| 5gae-assembly1.cif.gz_J | rnc in complex with a translocating secyeg | 0.9748 | 71 | 140 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R4J4M9_4_71_3.30.1550.10 | Alpha Beta;2-Layer Sandwich;Ribosomal protein L11, N-terminal domain;Ribosomal protein L11/L12, N-terminal domain | 0.986 | 3 | 67 | 3.30.1550.10 |
| af_I1J9L7_135_215_1.10.10.250 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Ribosomal protein L11/L12, C-terminal domain | 0.9852 | 72 | 139 | 1.10.10.250 |
| 3egvB00 | Alpha Beta;2-Layer Sandwich;Ribosomal protein L11, N-terminal domain;Ribosomal protein L11/L12, N-terminal domain | 0.9807 | 3 | 78 | 3.30.1550.10 |
| 1hc8A00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Ribosomal protein L11/L12, C-terminal domain | 0.96 | 67 | 140 | 1.10.10.250 |
| 1vq4I00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Ribosomal protein L11/L12, C-terminal domain | 0.9595 | 72 | 140 | 1.10.10.250 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2D7JF69-F1-model_v4 | 50S ribosomal protein L11 | 1.003 | 1 | 71 |
GO:0003735
GO:0006412 GO:0022625 GO:0070180 |
| AF-A0A7J4E0X6-F1-model_v4 | deleted | 1.002 | 1 | 69 |
|
| AF-A0A2N2LDD6-F1-model_v4 | 50S ribosomal protein L11 | 1 | 1 | 72 |
GO:0003735
GO:0006412 GO:0022625 GO:0070180 |
| AF-A0A6J7VYD9-F1-model_v4 | Unannotated protein | 0.9955 | 79 | 141 |
GO:0003735
GO:0006412 GO:0022625 GO:0070180 |
| AF-A0A7W0ZIT1-F1-model_v4 | 50S ribosomal protein L11 | 0.995 | 78 | 140 |
GO:0003735
GO:0006412 GO:0022625 GO:0070180 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar