F366163

General Info

Members Datasets Scaffolds Average Seq Length
256 192 237 141

Family's Representative Sequence

Representative Sequence 3300003544|Ga0007417J51691_1059823|Ga0007417J51691_10598231
Length 144
Sequence MPPKKKKIVKTFTLQLKAASATPAPPVGPALGQHGVNIMEFVKAYNAATDSMRGDVVPAQITVYEDRTFTFVLKTPPAAQLLIKAAGVPKGSGVPQKDKVGKVTSAQVREIAEKKMSDLNANDIDQAMKIIAGTARSMGITVGE

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2501939600 Micromonospora sp. L5 Isolate Unclassified
3 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
4 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
5 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
6 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
7 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
8 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
9 2855683550 Micromonospora sp. RP3T Isolate Unclassified
10 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
11 2858868258 Micromonospora sp. MH33 Isolate Unclassified
12 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
13 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
14 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
15 2902582711 Micromonospora sp. AP08 Isolate Unclassified
16 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
17 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
18 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
19 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
20 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
21 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
22 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
23 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
24 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
44 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
89 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
90 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
130 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
131 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
132 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
133 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
134 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
135 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
136 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
137 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
138 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
139 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
140 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
141 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
145 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
146 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
147 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
148 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
149 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
150 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
151 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
152 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
153 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
154 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
155 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
156 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
157 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
158 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
159 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
160 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
161 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
162 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
163 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
168 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
169 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
174 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
175 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
176 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
177 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
178 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
179 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
180 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
181 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
182 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
188 649633069 Micromonospora sp. L5 Isolate Unclassified
189 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
190 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
191 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
192 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 83.59
Metatranscriptomes 8.98
Isolates 7.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.56
Nodule 0.39
Rhizoplane 4.3
Rhizosphere 88.28
Stem 0
Stem Tuber 0
Unclassified 5.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3741095 2162886007 Bacteria 2338
2 JGI24034J26672_10060635 3300002239 Bacteria 664
3 Ga0007417J51691_1059823 3300003544 Bacteria 765
4 Ga0007410J51695_1037185 3300003574 Bacteria 734
5 Ga0007429J51699_1085805 3300003579 Bacteria 858
6 Ga0058859_11748156 3300004798 Bacteria 2152
7 Ga0058859_11811491 3300004798 Bacteria 1207
8 Ga0058861_11714049 3300004800 Bacteria 597
9 Ga0058861_12007760 3300004800 Bacteria 777
10 Ga0058860_12118084 3300004801 Bacteria 1266
11 Ga0058860_12241562 3300004801 Bacteria 1475
12 Ga0058862_12692948 3300004803 Bacteria 628
13 Ga0065704_10081607 3300005289 Bacteria 3732
14 Ga0070676_10028796 3300005328 Bacteria 3155
15 Ga0070676_10073988 3300005328 Bacteria 2051
16 Ga0070683_100040890 3300005329 Bacteria 4263
17 Ga0070690_100131439 3300005330 Bacteria 1691
18 Ga0070670_100018374 3300005331 Bacteria 5999
19 Ga0070670_100203435 3300005331 Bacteria 1721
20 Ga0068869_100062316 3300005334 Bacteria 2737
21 Ga0068869_101536750 3300005334 Bacteria 592
22 Ga0070682_100875689 3300005337 Bacteria 736
23 Ga0070682_101500344 3300005337 Bacteria 580
24 Ga0068868_100028338 3300005338 Bacteria 4281
25 Ga0068868_100052642 3300005338 Bacteria 3205
26 Ga0070689_100029357 3300005340 Bacteria 4162
27 Ga0070661_100242365 3300005344 Bacteria 1389
28 Ga0070692_10031182 3300005345 Bacteria 2671
29 Ga0070668_100043325 3300005347 Bacteria 3451
30 Ga0070668_100513348 3300005347 Bacteria 1039
31 Ga0070669_100288041 3300005353 Bacteria 1318
32 Ga0070675_100031497 3300005354 Bacteria 4287
33 Ga0070675_100033839 3300005354 Bacteria 4144
34 Ga0070671_101061714 3300005355 Bacteria 711
35 Ga0070674_100008473 3300005356 Bacteria 6122
36 Ga0070674_100081833 3300005356 Bacteria 2308
37 Ga0070673_100037705 3300005364 Bacteria 3684
38 Ga0070688_100003143 3300005365 Bacteria 8449
39 Ga0070659_100091453 3300005366 Bacteria 2439
40 Ga0070714_100036937 3300005435 Bacteria 4101
41 Ga0070705_101145324 3300005440 Bacteria 638
42 Ga0070700_100029333 3300005441 Bacteria 3279
43 Ga0070700_100226599 3300005441 Bacteria 1328
44 Ga0070663_100046620 3300005455 Bacteria 3067
45 Ga0070663_100119320 3300005455 Bacteria 1990
46 Ga0070678_100211995 3300005456 Bacteria 1605
47 Ga0070678_100530320 3300005456 Bacteria 1043
48 Ga0070662_100008427 3300005457 Bacteria 6720
49 Ga0070681_10000289 3300005458 Bacteria 40654
50 Ga0070681_10615577 3300005458 Bacteria 1000
51 Ga0068867_101345958 3300005459 Unclassified 660
52 Ga0070707_100031680 3300005468 Bacteria 5038
53 Ga0070684_100053686 3300005535 Bacteria 3509
54 Ga0070684_100065485 3300005535 Bacteria 3189
55 Ga0070686_100015598 3300005544 Bacteria 4405
56 Ga0070665_100053608 3300005548 Bacteria 4044
57 Ga0070664_100003343 3300005564 Bacteria 12964
58 Ga0070664_100091217 3300005564 Bacteria 2638
59 Ga0070702_100007323 3300005615 Bacteria 5278
60 Ga0068852_100610500 3300005616 Bacteria 1096
61 Ga0068870_10007115 3300005840 Bacteria 4975
62 Ga0068870_10230306 3300005840 Bacteria 1139
63 Ga0068863_100448617 3300005841 Bacteria 1266
64 Ga0068858_100154977 3300005842 Bacteria 2155
65 Ga0068858_100825868 3300005842 Bacteria 905
66 Ga0068860_100222046 3300005843 Bacteria 1835
67 Ga0075365_10009696 3300006038 Bacteria 5557
68 Ga0075428_101931698 3300006844 Bacteria 613
69 Ga0075431_100774559 3300006847 Bacteria 934
70 Ga0075431_100821669 3300006847 Bacteria 902
71 Ga0075429_100650103 3300006880 Bacteria 924
72 Ga0068865_101218690 3300006881 Bacteria 667
73 Ga0111539_10064107 3300009094 Bacteria 4349
74 Ga0111539_11000129 3300009094 Bacteria 972
75 Ga0105245_10457185 3300009098 Bacteria 1286
76 Ga0105245_10600604 3300009098 Bacteria 1127
77 Ga0114129_10000114 3300009147 Bacteria 80730
78 Ga0114129_10154522 3300009147 Bacteria 3139
79 Ga0114129_10156027 3300009147 Bacteria 3121
80 Ga0114129_11343785 3300009147 Bacteria 884
81 Ga0105243_10051861 3300009148 Bacteria 3246
82 Ga0105243_10078294 3300009148 Bacteria 2691
83 Ga0105242_10244344 3300009176 Bacteria 1615
84 Ga0105237_11110163 3300009545 Bacteria 798
85 Ga0105238_10660178 3300009551 Bacteria 1056
86 Ga0105238_10778245 3300009551 Bacteria 972
87 Ga0105249_10225237 3300009553 Bacteria 1847
88 Ga0105239_10187690 3300010375 Bacteria 2314
89 Ga0105239_10981459 3300010375 Bacteria 971
90 Ga0105246_10009303 3300011119 Bacteria 6051
91 Ga0105246_10172691 3300011119 Bacteria 1657
92 Ga0157378_10162515 3300013297 Bacteria 2089
93 Ga0157372_10434779 3300013307 Bacteria 1529
94 Ga0157375_10026124 3300013308 Bacteria 5437
95 Ga0157375_10560386 3300013308 Bacteria 1304
96 Ga0163163_10012417 3300014325 Bacteria 7760
97 Ga0157380_10059121 3300014326 Bacteria 3058
98 Ga0157380_10132475 3300014326 Bacteria 2129
99 Ga0157377_10001184 3300014745 Bacteria 11091
100 Ga0157377_10057344 3300014745 Bacteria 2214
101 Ga0157379_10119099 3300014968 Bacteria 2375
102 Ga0157379_10373425 3300014968 Bacteria 1308
103 Ga0197907_10323729 3300020069 Bacteria 2006
104 Ga0206349_1769847 3300020075 Bacteria 670
105 Ga0206352_10158715 3300020078 Bacteria 906
106 Ga0206350_10562332 3300020080 Bacteria 668
107 Ga0206350_10664288 3300020080 Bacteria 979
108 Ga0213873_10059222 3300021358 Bacteria 1032
109 Ga0213876_10255309 3300021384 Bacteria 931
110 Ga0224712_10024657 3300022467 Bacteria 2104
111 Ga0207682_10073844 3300025893 Bacteria 1449
112 Ga0207688_10009426 3300025901 Bacteria 5315
113 Ga0207645_10031343 3300025907 Bacteria 3422
114 Ga0207645_10076041 3300025907 Bacteria 2150
115 Ga0207643_10070281 3300025908 Bacteria 2013
116 Ga0207707_10000491 3300025912 Bacteria 40909
117 Ga0207663_10278580 3300025916 Bacteria 1241
118 Ga0207657_10070777 3300025919 Bacteria 2955
119 Ga0207649_10624151 3300025920 Bacteria 831
120 Ga0207652_10261228 3300025921 Bacteria 1562
121 Ga0207646_10048284 3300025922 Bacteria 3816
122 Ga0207681_10252008 3300025923 Bacteria 1379
123 Ga0207650_10437722 3300025925 Bacteria 1087
124 Ga0207659_10016549 3300025926 Bacteria 4801
125 Ga0207687_10270499 3300025927 Bacteria 1358
126 Ga0207687_11701919 3300025927 Bacteria 541
127 Ga0207664_10172900 3300025929 Bacteria 1850
128 Ga0207644_11043771 3300025931 Bacteria 686
129 Ga0207690_10071709 3300025932 Bacteria 2390
130 Ga0207706_10041598 3300025933 Bacteria 4073
131 Ga0207686_10193402 3300025934 Bacteria 1452
132 Ga0207709_10038377 3300025935 Bacteria 2852
133 Ga0207709_10041829 3300025935 Bacteria 2752
134 Ga0207670_10058300 3300025936 Bacteria 2622
135 Ga0207670_10691843 3300025936 Bacteria 843
136 Ga0207665_10232013 3300025939 Bacteria 1357
137 Ga0207711_10158539 3300025941 Bacteria 2047
138 Ga0207689_10014990 3300025942 Bacteria 6574
139 Ga0207689_11048002 3300025942 Bacteria 688
140 Ga0207661_10018072 3300025944 Bacteria 5234
141 Ga0207679_10004175 3300025945 Bacteria 8977
142 Ga0207651_10100728 3300025960 Bacteria 2142
143 Ga0207712_10743572 3300025961 Bacteria 859
144 Ga0207712_11429424 3300025961 Bacteria 619
145 Ga0207668_10057071 3300025972 Bacteria 2722
146 Ga0207668_10455767 3300025972 Bacteria 1092
147 Ga0207658_11531736 3300025986 Bacteria 610
148 Ga0207677_10011261 3300026023 Bacteria 5091
149 Ga0207703_10190303 3300026035 Bacteria 1817
150 Ga0207703_10220466 3300026035 Bacteria 1696
151 Ga0207678_10037197 3300026067 Bacteria 4235
152 Ga0207708_10014520 3300026075 Bacteria 5895
153 Ga0207683_10016208 3300026121 Bacteria 6343
154 Ga0207698_10207512 3300026142 Bacteria 1760
155 Ga0207698_11760824 3300026142 Bacteria 635
156 Ga0207428_10016667 3300027907 Bacteria 6319
157 Ga0268264_10195686 3300028381 Bacteria 1846
158 Ga0265319_1011168 3300028563 Bacteria 3697
159 Ga0265334_10286854 3300028573 Unclassified 564
160 Ga0265318_10031509 3300028577 Bacteria 2056
161 Ga0265338_10124739 3300028800 Bacteria 2045
162 Ga0265324_10086041 3300029957 Bacteria 1069
163 Ga0265320_10008285 3300031240 Bacteria 6367
164 Ga0265320_10100501 3300031240 Bacteria 1332
165 Ga0265325_10015102 3300031241 Bacteria 4353
166 Ga0265325_10114104 3300031241 Bacteria 1310
167 Ga0265316_10102385 3300031344 Bacteria 2175
168 Ga0265316_10128008 3300031344 Unclassified 1914
169 Ga0265313_10011601 3300031595 Bacteria 5466
170 Ga0307405_10755563 3300031731 Bacteria 810
171 Ga0307406_10255777 3300031901 Bacteria 1322
172 Ga0307407_10680057 3300031903 Bacteria 773
173 Ga0307407_10925806 3300031903 Bacteria 670
174 Ga0307409_100052647 3300031995 Bacteria 3123
175 Ga0307409_100566765 3300031995 Bacteria 1117
176 Ga0307415_100084396 3300032126 Bacteria 2279
177 Ga0307415_100202208 3300032126 Bacteria 1577
178 Ga0307415_101311397 3300032126 Bacteria 686
179 Ga0316588_1000633 3300033528 Bacteria 5052
180 Ga0395899_0415902 3300037312 Bacteria 887
181 Ga0395898_0612191 3300037466 Bacteria 1032
182 Ga0436365_0453863 3300039437 Bacteria 6719
183 Ga0436362_0804259 3300039453 Bacteria 2593
184 Ga0451793_0621619 3300041452 Bacteria 684
185 Ga0451807_0085772 3300041486 Bacteria 880
186 Ga0439454_030988 3300042011 Bacteria 838
187 Ga0439456_007529 3300042013 Bacteria 2238
188 Ga0451577_0000001 3300042876 Bacteria 2461803
189 Ga0466966_0845770 3300044684 Bacteria 552
190 Ga0466961_0337768 3300044693 Bacteria 918
191 Ga0466963_0056173 3300044694 Bacteria 2619
192 Ga0466963_0150240 3300044694 Bacteria 1617
193 Ga0466963_0594788 3300044694 Bacteria 781
194 Ga0453684_0088581 3300044712 Bacteria 3832
195 Ga0451576_0000067 3300045051 Bacteria 265145
196 Ga0451576_0149610 3300045051 Bacteria 2435
197 Ga0451576_0301562 3300045051 Bacteria 1676
198 Ga0466958_0042925 3300045836 Bacteria 2723
199 Ga0466958_0101856 3300045836 Bacteria 1786
200 Ga0466967_0244589 3300045976 Bacteria 1712
201 Ga0466967_0801824 3300045976 Bacteria 935
202 Ga0495667_0465973 3300046559 Bacteria 793
203 Ga0495656_0386603 3300046615 Bacteria 730
204 Ga0495581_0814490 3300047315 Bacteria 535
205 Ga0496101_0913098 3300048904 Bacteria 691
206 Ga0496104_0330981 3300048907 Bacteria 1436
207 Ga0496108_0048957 3300048911 Bacteria 3534
208 Ga0496108_0088097 3300048911 Bacteria 2637
209 Ga0496109_0089265 3300048912 Bacteria 2849
210 Ga0496109_0523477 3300048912 Bacteria 1119
211 Ga0496110_0334381 3300048913 Bacteria 1380
212 Ga0496110_0344041 3300048913 Bacteria 1358
213 Ga0496111_0299316 3300048914 Bacteria 1192
214 Ga0501318_025239 3300049534 Bacteria 778
215 Ga0501036_1497541 3300049572 Bacteria 546
216 Ga0501040_0548054 3300049576 Bacteria 835
217 Ga0501048_1290565 3300049582 Bacteria 525
218 Ga0501249_000156 3300049679 Bacteria 21248
219 Ga0501083_0000044 3300049744 Bacteria 91900
220 nmdc:mga0yw44_426805_c1 3300050492 Bacteria 898
221 nmdc:mga05p37_1507_c1 3300050507 Bacteria 27071
222 nmdc:mga05p37_60338_c3 3300050507 Bacteria 3055
223 nmdc:mga09592_1107895_c1 3300050508 Bacteria 658
224 nmdc:mga09592_274614_c1 3300050508 Bacteria 1462
225 nmdc:mga06r32_220681_c1 3300050510 Bacteria 1884
226 nmdc:mga06r32_381526_c1 3300050510 Bacteria 1392
227 nmdc:mga06r32_440257_c1 3300050510 Bacteria 1283
228 nmdc:mga08y16_1143137_c1 3300050511 Bacteria 752
229 nmdc:mga08y16_37108_c1 3300050511 Bacteria 5118
230 Ga0500643_160004 3300053087 Bacteria 604
231 Ga0500594_0000002 3300053118 Bacteria 916890
232 Ga0587070_063767 3300059491 Bacteria 769
233 Ga0587077_132668 3300059493 Bacteria 634
234 Ga0587080_088296 3300059503 Bacteria 647
235 Ga0587101_030810 3300059623 Bacteria 836
236 Ga0587062_135405 3300059639 Bacteria 510
237 Ga0466962_0069648 3300061719 Bacteria 1680

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025939 Ga0207665_10232013 Ga0207665_102320131 118
2 3300031344 Ga0265316_10128008 Ga0265316_101280083 121
3 3300005842 Ga0068858_100154977 Ga0068858_1001549772 122
4 3300014968 Ga0157379_10119099 Ga0157379_101190993 122
5 3300026035 Ga0207703_10190303 Ga0207703_101903032 122
6 3300004800 Ga0058861_12007760 Ga0058861_120077602 125
7 3300044712 Ga0453684_0088581 Ga0453684_0088581_1651_2073 125
8 3300005468 Ga0070707_100031680 Ga0070707_1000316803 127
9 3300025921 Ga0207652_10261228 Ga0207652_102612281 127
10 3300025922 Ga0207646_10048284 Ga0207646_100482843 127
11 3300045051 Ga0451576_0000067 Ga0451576_0000067_23994_24419 127
12 3300041486 Ga0451807_0085772 Ga0451807_0085772_24_455 130
13 3300009147 Ga0114129_10154522 Ga0114129_101545224 134
14 3300048904 Ga0496101_0913098 Ga0496101_0913098_121_525 134
15 3300050508 nmdc:mga09592_274614_c1 nmdc:mga09592_274614_c1_530_940 136
16 3300050510 nmdc:mga06r32_220681_c1 nmdc:mga06r32_220681_c1_227_637 136
17 3300009147 Ga0114129_11343785 Ga0114129_113437852 139
18 3300025916 Ga0207663_10278580 Ga0207663_102785802 139
19 3300046615 Ga0495656_0386603 Ga0495656_0386603_258_677 139
20 iso_pu_bacteria 2501939600 2501945155 139
21 iso_pu_bacteria 2515154088 2515496714 139
22 iso_pu_bacteria 2515154129 2515718285 139
23 iso_pu_bacteria 2515154137 2515756953 139
24 iso_pu_bacteria 2515154202 2516083555 139
25 iso_pu_bacteria 2515154203 2516089491 139
26 iso_pu_bacteria 2675903059 2676480105 139
27 iso_pu_bacteria 2855683550 2855684494 139
28 iso_pu_bacteria 2856858025 2856858891 139
29 iso_pu_bacteria 2858868258 2858870681 139
30 iso_pu_bacteria 2858902515 2858902912 139
31 iso_pu_bacteria 2867302475 2867307190 139
32 iso_pu_bacteria 2887478801 2887486679 139
33 iso_pu_bacteria 2902582711 2902584298 139
34 iso_pu_bacteria 649633069 649810799 139
35 iso_pu_bacteria 8001781756 8001785191 139
36 iso_pu_bacteria 8003856774 8003861991 139
37 iso_pu_bacteria 8003870546 8003874673 139
38 iso_pu_bacteria 8055412473 8055412867 139
39 3300004800 Ga0058861_11714049 Ga0058861_117140491 140
40 3300004803 Ga0058862_12692948 Ga0058862_126929481 140
41 3300005440 Ga0070705_101145324 Ga0070705_1011453241 140
42 3300005458 Ga0070681_10000289 Ga0070681_100002895 140
43 3300013307 Ga0157372_10434779 Ga0157372_104347791 140
44 3300020078 Ga0206352_10158715 Ga0206352_101587152 140
45 3300021358 Ga0213873_10059222 Ga0213873_100592221 140
46 3300021384 Ga0213876_10255309 Ga0213876_102553091 140
47 3300025912 Ga0207707_10000491 Ga0207707_1000049126 140
48 3300029957 Ga0265324_10086041 Ga0265324_100860412 140
49 3300032126 Ga0307415_101311397 Ga0307415_1013113971 140
50 3300039437 Ga0436365_0453863 Ga0436365_0453863_2686_3108 140
51 3300039453 Ga0436362_0804259 Ga0436362_0804259_692_1120 140
52 3300042876 Ga0451577_0000001 Ga0451577_0000001_726709_727131 140
53 3300044684 Ga0466966_0845770 Ga0466966_0845770_53_475 140
54 3300044693 Ga0466961_0337768 Ga0466961_0337768_301_723 140
55 3300044694 Ga0466963_0150240 Ga0466963_0150240_185_607 140
56 3300044694 Ga0466963_0594788 Ga0466963_0594788_308_730 140
57 3300045051 Ga0451576_0301562 Ga0451576_0301562_157_579 140
58 3300045836 Ga0466958_0042925 Ga0466958_0042925_594_1016 140
59 3300045836 Ga0466958_0101856 Ga0466958_0101856_1336_1758 140
60 3300049582 Ga0501048_1290565 Ga0501048_1290565_42_470 140
61 3300049679 Ga0501249_000156 Ga0501249_000156_7752_8174 140
62 3300049744 Ga0501083_0000044 Ga0501083_0000044_81126_81548 140
63 3300053087 Ga0500643_160004 Ga0500643_160004_57_479 140
64 3300059493 Ga0587077_132668 Ga0587077_132668_96_518 140
65 3300059639 Ga0587062_135405 Ga0587062_135405_43_465 140
66 3300061719 Ga0466962_0069648 Ga0466962_0069648_487_909 140
67 2162886007 SwRhRL2b_contig_3741095 SwRhRL2b_0503.00000970 141
68 3300002239 JGI24034J26672_10060635 JGI24034J26672_100606351 141
69 3300003544 Ga0007417J51691_1059823 Ga0007417J51691_10598231 141
70 3300003574 Ga0007410J51695_1037185 Ga0007410J51695_10371851 141
71 3300003579 Ga0007429J51699_1085805 Ga0007429J51699_10858052 141
72 3300004798 Ga0058859_11748156 Ga0058859_117481563 141
73 3300004798 Ga0058859_11811491 Ga0058859_118114912 141
74 3300004801 Ga0058860_12118084 Ga0058860_121180842 141
75 3300004801 Ga0058860_12241562 Ga0058860_122415621 141
76 3300005289 Ga0065704_10081607 Ga0065704_100816073 141
77 3300005328 Ga0070676_10028796 Ga0070676_100287962 141
78 3300005328 Ga0070676_10073988 Ga0070676_100739882 141
79 3300005329 Ga0070683_100040890 Ga0070683_1000408902 141
80 3300005330 Ga0070690_100131439 Ga0070690_1001314391 141
81 3300005331 Ga0070670_100018374 Ga0070670_1000183745 141
82 3300005331 Ga0070670_100203435 Ga0070670_1002034351 141
83 3300005334 Ga0068869_100062316 Ga0068869_1000623162 141
84 3300005334 Ga0068869_101536750 Ga0068869_1015367501 141
85 3300005337 Ga0070682_100875689 Ga0070682_1008756892 141
86 3300005337 Ga0070682_101500344 Ga0070682_1015003441 141
87 3300005338 Ga0068868_100028338 Ga0068868_1000283382 141
88 3300005338 Ga0068868_100052642 Ga0068868_1000526425 141
89 3300005340 Ga0070689_100029357 Ga0070689_1000293572 141
90 3300005344 Ga0070661_100242365 Ga0070661_1002423652 141
91 3300005345 Ga0070692_10031182 Ga0070692_100311823 141
92 3300005347 Ga0070668_100043325 Ga0070668_1000433253 141
93 3300005347 Ga0070668_100513348 Ga0070668_1005133482 141
94 3300005353 Ga0070669_100288041 Ga0070669_1002880412 141
95 3300005354 Ga0070675_100031497 Ga0070675_1000314976 141
96 3300005354 Ga0070675_100033839 Ga0070675_1000338395 141
97 3300005355 Ga0070671_101061714 Ga0070671_1010617142 141
98 3300005356 Ga0070674_100008473 Ga0070674_1000084732 141
99 3300005356 Ga0070674_100081833 Ga0070674_1000818336 141
100 3300005364 Ga0070673_100037705 Ga0070673_1000377058 141
101 3300005365 Ga0070688_100003143 Ga0070688_1000031437 141
102 3300005366 Ga0070659_100091453 Ga0070659_1000914533 141
103 3300005435 Ga0070714_100036937 Ga0070714_1000369373 141
104 3300005441 Ga0070700_100029333 Ga0070700_1000293332 141
105 3300005441 Ga0070700_100226599 Ga0070700_1002265991 141
106 3300005455 Ga0070663_100046620 Ga0070663_1000466204 141
107 3300005455 Ga0070663_100119320 Ga0070663_1001193205 141
108 3300005456 Ga0070678_100211995 Ga0070678_1002119952 141
109 3300005456 Ga0070678_100530320 Ga0070678_1005303202 141
110 3300005457 Ga0070662_100008427 Ga0070662_1000084274 141
111 3300005458 Ga0070681_10615577 Ga0070681_106155772 141
112 3300005459 Ga0068867_101345958 Ga0068867_1013459581 141
113 3300005535 Ga0070684_100053686 Ga0070684_1000536862 141
114 3300005535 Ga0070684_100065485 Ga0070684_1000654853 141
115 3300005544 Ga0070686_100015598 Ga0070686_1000155985 141
116 3300005548 Ga0070665_100053608 Ga0070665_1000536088 141
117 3300005564 Ga0070664_100003343 Ga0070664_10000334319 141
118 3300005564 Ga0070664_100091217 Ga0070664_1000912172 141
119 3300005615 Ga0070702_100007323 Ga0070702_1000073232 141
120 3300005616 Ga0068852_100610500 Ga0068852_1006105002 141
121 3300005840 Ga0068870_10007115 Ga0068870_100071157 141
122 3300005840 Ga0068870_10230306 Ga0068870_102303062 141
123 3300005841 Ga0068863_100448617 Ga0068863_1004486171 141
124 3300005842 Ga0068858_100825868 Ga0068858_1008258681 141
125 3300005843 Ga0068860_100222046 Ga0068860_1002220462 141
126 3300006038 Ga0075365_10009696 Ga0075365_100096968 141
127 3300006844 Ga0075428_101931698 Ga0075428_1019316982 141
128 3300006847 Ga0075431_100774559 Ga0075431_1007745592 141
129 3300006847 Ga0075431_100821669 Ga0075431_1008216692 141
130 3300006880 Ga0075429_100650103 Ga0075429_1006501032 141
131 3300006881 Ga0068865_101218690 Ga0068865_1012186901 141
132 3300009094 Ga0111539_10064107 Ga0111539_100641072 141
133 3300009094 Ga0111539_11000129 Ga0111539_110001292 141
134 3300009098 Ga0105245_10457185 Ga0105245_104571852 141
135 3300009098 Ga0105245_10600604 Ga0105245_106006042 141
136 3300009147 Ga0114129_10000114 Ga0114129_1000011432 141
137 3300009147 Ga0114129_10156027 Ga0114129_101560274 141
138 3300009148 Ga0105243_10051861 Ga0105243_100518614 141
139 3300009148 Ga0105243_10078294 Ga0105243_100782943 141
140 3300009176 Ga0105242_10244344 Ga0105242_102443443 141
141 3300009545 Ga0105237_11110163 Ga0105237_111101632 141
142 3300009551 Ga0105238_10660178 Ga0105238_106601782 141
143 3300009551 Ga0105238_10778245 Ga0105238_107782452 141
144 3300009553 Ga0105249_10225237 Ga0105249_102252373 141
145 3300010375 Ga0105239_10187690 Ga0105239_101876902 141
146 3300010375 Ga0105239_10981459 Ga0105239_109814592 141
147 3300011119 Ga0105246_10009303 Ga0105246_100093039 141
148 3300011119 Ga0105246_10172691 Ga0105246_101726911 141
149 3300013297 Ga0157378_10162515 Ga0157378_101625152 141
150 3300013308 Ga0157375_10026124 Ga0157375_100261244 141
151 3300013308 Ga0157375_10560386 Ga0157375_105603862 141
152 3300014325 Ga0163163_10012417 Ga0163163_100124177 141
153 3300014326 Ga0157380_10059121 Ga0157380_100591213 141
154 3300014326 Ga0157380_10132475 Ga0157380_101324752 141
155 3300014745 Ga0157377_10001184 Ga0157377_100011843 141
156 3300014745 Ga0157377_10057344 Ga0157377_100573442 141
157 3300014968 Ga0157379_10373425 Ga0157379_103734252 141
158 3300020069 Ga0197907_10323729 Ga0197907_103237292 141
159 3300020075 Ga0206349_1769847 Ga0206349_17698471 141
160 3300020080 Ga0206350_10562332 Ga0206350_105623321 141
161 3300020080 Ga0206350_10664288 Ga0206350_106642882 141
162 3300022467 Ga0224712_10024657 Ga0224712_100246572 141
163 3300025893 Ga0207682_10073844 Ga0207682_100738442 141
164 3300025901 Ga0207688_10009426 Ga0207688_100094266 141
165 3300025907 Ga0207645_10031343 Ga0207645_100313433 141
166 3300025907 Ga0207645_10076041 Ga0207645_100760413 141
167 3300025908 Ga0207643_10070281 Ga0207643_100702812 141
168 3300025919 Ga0207657_10070777 Ga0207657_100707772 141
169 3300025920 Ga0207649_10624151 Ga0207649_106241512 141
170 3300025923 Ga0207681_10252008 Ga0207681_102520082 141
171 3300025925 Ga0207650_10437722 Ga0207650_104377222 141
172 3300025926 Ga0207659_10016549 Ga0207659_100165493 141
173 3300025927 Ga0207687_10270499 Ga0207687_102704991 141
174 3300025927 Ga0207687_11701919 Ga0207687_117019191 141
175 3300025929 Ga0207664_10172900 Ga0207664_101729003 141
176 3300025931 Ga0207644_11043771 Ga0207644_110437712 141
177 3300025932 Ga0207690_10071709 Ga0207690_100717092 141
178 3300025933 Ga0207706_10041598 Ga0207706_100415982 141
179 3300025934 Ga0207686_10193402 Ga0207686_101934022 141
180 3300025935 Ga0207709_10038377 Ga0207709_100383773 141
181 3300025935 Ga0207709_10041829 Ga0207709_100418294 141
182 3300025936 Ga0207670_10058300 Ga0207670_100583002 141
183 3300025936 Ga0207670_10691843 Ga0207670_106918432 141
184 3300025941 Ga0207711_10158539 Ga0207711_101585392 141
185 3300025942 Ga0207689_10014990 Ga0207689_1001499010 141
186 3300025942 Ga0207689_11048002 Ga0207689_110480021 141
187 3300025944 Ga0207661_10018072 Ga0207661_100180725 141
188 3300025945 Ga0207679_10004175 Ga0207679_100041755 141
189 3300025960 Ga0207651_10100728 Ga0207651_101007282 141
190 3300025961 Ga0207712_10743572 Ga0207712_107435722 141
191 3300025961 Ga0207712_11429424 Ga0207712_114294242 141
192 3300025972 Ga0207668_10057071 Ga0207668_100570711 141
193 3300025972 Ga0207668_10455767 Ga0207668_104557672 141
194 3300025986 Ga0207658_11531736 Ga0207658_115317361 141
195 3300026023 Ga0207677_10011261 Ga0207677_100112615 141
196 3300026035 Ga0207703_10220466 Ga0207703_102204662 141
197 3300026067 Ga0207678_10037197 Ga0207678_100371972 141
198 3300026075 Ga0207708_10014520 Ga0207708_100145205 141
199 3300026121 Ga0207683_10016208 Ga0207683_100162089 141
200 3300026142 Ga0207698_10207512 Ga0207698_102075122 141
201 3300026142 Ga0207698_11760824 Ga0207698_117608242 141
202 3300027907 Ga0207428_10016667 Ga0207428_100166672 141
203 3300028381 Ga0268264_10195686 Ga0268264_101956862 141
204 3300028563 Ga0265319_1011168 Ga0265319_10111685 141
205 3300028573 Ga0265334_10286854 Ga0265334_102868542 141
206 3300028577 Ga0265318_10031509 Ga0265318_100315094 141
207 3300028800 Ga0265338_10124739 Ga0265338_101247391 141
208 3300031240 Ga0265320_10008285 Ga0265320_100082852 141
209 3300031240 Ga0265320_10100501 Ga0265320_101005012 141
210 3300031241 Ga0265325_10015102 Ga0265325_100151026 141
211 3300031241 Ga0265325_10114104 Ga0265325_101141042 141
212 3300031344 Ga0265316_10102385 Ga0265316_101023853 141
213 3300031595 Ga0265313_10011601 Ga0265313_1001160111 141
214 3300031731 Ga0307405_10755563 Ga0307405_107555631 141
215 3300031901 Ga0307406_10255777 Ga0307406_102557772 141
216 3300031903 Ga0307407_10680057 Ga0307407_106800571 141
217 3300031903 Ga0307407_10925806 Ga0307407_109258061 141
218 3300031995 Ga0307409_100052647 Ga0307409_1000526472 141
219 3300031995 Ga0307409_100566765 Ga0307409_1005667652 141
220 3300032126 Ga0307415_100084396 Ga0307415_1000843963 141
221 3300032126 Ga0307415_100202208 Ga0307415_1002022081 141
222 3300033528 Ga0316588_1000633 Ga0316588_10006335 141
223 3300037312 Ga0395899_0415902 Ga0395899_0415902_359_784 141
224 3300037466 Ga0395898_0612191 Ga0395898_0612191_243_674 141
225 3300041452 Ga0451793_0621619 Ga0451793_0621619_110_544 141
226 3300042011 Ga0439454_030988 Ga0439454_030988_347_772 141
227 3300042013 Ga0439456_007529 Ga0439456_007529_1200_1625 141
228 3300044694 Ga0466963_0056173 Ga0466963_0056173_1219_1653 141
229 3300045051 Ga0451576_0149610 Ga0451576_0149610_248_673 141
230 3300045976 Ga0466967_0244589 Ga0466967_0244589_328_753 141
231 3300045976 Ga0466967_0801824 Ga0466967_0801824_206_640 141
232 3300046559 Ga0495667_0465973 Ga0495667_0465973_232_657 141
233 3300047315 Ga0495581_0814490 Ga0495581_0814490_19_453 141
234 3300048907 Ga0496104_0330981 Ga0496104_0330981_913_1338 141
235 3300048911 Ga0496108_0048957 Ga0496108_0048957_1946_2371 141
236 3300048911 Ga0496108_0088097 Ga0496108_0088097_2065_2490 141
237 3300048912 Ga0496109_0089265 Ga0496109_0089265_1269_1694 141
238 3300048912 Ga0496109_0523477 Ga0496109_0523477_182_607 141
239 3300048913 Ga0496110_0334381 Ga0496110_0334381_437_862 141
240 3300048913 Ga0496110_0344041 Ga0496110_0344041_181_606 141
241 3300048914 Ga0496111_0299316 Ga0496111_0299316_727_1152 141
242 3300049534 Ga0501318_025239 Ga0501318_025239_271_705 141
243 3300049572 Ga0501036_1497541 Ga0501036_1497541_91_522 141
244 3300049576 Ga0501040_0548054 Ga0501040_0548054_358_783 141
245 3300050492 nmdc:mga0yw44_426805_c1 nmdc:mga0yw44_426805_c1_432_863 141
246 3300050507 nmdc:mga05p37_1507_c1 nmdc:mga05p37_1507_c1_25774_26208 141
247 3300050507 nmdc:mga05p37_60338_c3 nmdc:mga05p37_60338_c3_599_1027 141
248 3300050508 nmdc:mga09592_1107895_c1 nmdc:mga09592_1107895_c1_165_590 141
249 3300050510 nmdc:mga06r32_381526_c1 nmdc:mga06r32_381526_c1_627_1061 141
250 3300050510 nmdc:mga06r32_440257_c1 nmdc:mga06r32_440257_c1_156_581 141
251 3300050511 nmdc:mga08y16_1143137_c1 nmdc:mga08y16_1143137_c1_247_678 141
252 3300050511 nmdc:mga08y16_37108_c1 nmdc:mga08y16_37108_c1_3898_4329 141
253 3300053118 Ga0500594_0000002 Ga0500594_0000002_796123_796548 141
254 3300059491 Ga0587070_063767 Ga0587070_063767_71_496 141
255 3300059503 Ga0587080_088296 Ga0587080_088296_167_598 141
256 3300059623 Ga0587101_030810 Ga0587101_030810_124_558 141

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00298

Ribosomal_L11

Ribosomal protein L11, RNA binding domain

74

142

0.99

PF03946

Ribosomal_L11_N

Ribosomal protein L11, N-terminal domain

12

69

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mms-assembly2.cif.gz_B crystal structure of the ribosomal protein l11-rna complex 0.9873 71 140
3cjt-assembly4.cif.gz_H ribosomal protein l11 methyltransferase (prma) in complex with dimethylated ribosomal protein l11 0.9845 3 72
1y39-assembly2.cif.gz_B co-evolution of protein and rna structures within a highly conserved ribosomal domain 0.9816 71 141
3egv-assembly1.cif.gz_B ribosomal protein l11 methyltransferase (prma) in complex with trimethylated ribosomal protein l11 0.9807 3 78
5gae-assembly1.cif.gz_J rnc in complex with a translocating secyeg 0.9748 71 140
ID Description Score Start End Superfamily
af_A0A0R4J4M9_4_71_3.30.1550.10 Alpha Beta;2-Layer Sandwich;Ribosomal protein L11, N-terminal domain;Ribosomal protein L11/L12, N-terminal domain 0.986 3 67 3.30.1550.10
af_I1J9L7_135_215_1.10.10.250 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Ribosomal protein L11/L12, C-terminal domain 0.9852 72 139 1.10.10.250
3egvB00 Alpha Beta;2-Layer Sandwich;Ribosomal protein L11, N-terminal domain;Ribosomal protein L11/L12, N-terminal domain 0.9807 3 78 3.30.1550.10
1hc8A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Ribosomal protein L11/L12, C-terminal domain 0.96 67 140 1.10.10.250
1vq4I00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Ribosomal protein L11/L12, C-terminal domain 0.9595 72 140 1.10.10.250
ID Description Score Start End GO Terms
AF-A0A2D7JF69-F1-model_v4 50S ribosomal protein L11 1.003 1 71 GO:0003735
GO:0006412
GO:0022625
GO:0070180
AF-A0A7J4E0X6-F1-model_v4 deleted 1.002 1 69
AF-A0A2N2LDD6-F1-model_v4 50S ribosomal protein L11 1 1 72 GO:0003735
GO:0006412
GO:0022625
GO:0070180
AF-A0A6J7VYD9-F1-model_v4 Unannotated protein 0.9955 79 141 GO:0003735
GO:0006412
GO:0022625
GO:0070180
AF-A0A7W0ZIT1-F1-model_v4 50S ribosomal protein L11 0.995 78 140 GO:0003735
GO:0006412
GO:0022625
GO:0070180

Feature Viewer

pLDDT pTM Quality
89.33 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map