F366241

General Info

Members Datasets Scaffolds Average Seq Length
256 153 512 385

Family's Representative Sequence

Representative Sequence 3300005339|Ga0070660_100016534|Ga0070660_1000165343
Length 408
Sequence MKRIAILGSTGSIGQSALAVVDAHADRLQVVGLAAGENADRLGEQIARYRPRIAAMATGAALDRLALNGGVGDTLIAGTGRDGLVAVASHPDADLVLCASSGTEALEAVLAAIELGKTIALANKEVLVMAGGIVIDAARRRGVAVLPVDSEHNAIHQCLHGRSASDVARLILTASGGPFRGRSADSLVHVTAAEALKHPTWRMGRKITIDSATLMNKGLEMIEAYWLFGVRPSQIEVLVHPQSVVHSMVELTDGSIIAQLGVTDMRLPIQYACSYPERWSGPLPSLDLTKAGGLEFGVPDTNAFPCLRLAYRALELPIREIAASTRCTTPFSAPGSMPVVLNAANELAVAWFLEGRIGFTAIPQVIEQTMDAHVPAEVSTIAAVRAVDSWARVQAQEMARRLQSKLEG

Samples

Sample ID Description Type Environment
1 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
97 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
98 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
99 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
100 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
101 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
102 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
103 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
104 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
105 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
106 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
107 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
108 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
109 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
110 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
111 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
112 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
113 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
114 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
115 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
116 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
117 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
118 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
119 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
120 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
121 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
122 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
123 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
124 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
125 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
126 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
127 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
128 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
129 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
130 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
131 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
132 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
135 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
136 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
137 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
138 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
139 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
140 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
142 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
143 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
144 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
145 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
146 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
147 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
148 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
149 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
150 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
151 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
152 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
153 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.08
Rhizosphere 94.53
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070660_100016534 3300005339 Bacteria 5356
2 Ga0065712_10073379 3300005290 Bacteria 4411
3 Ga0065715_10002254 3300005293 Bacteria 10415
4 Ga0070676_10010406 3300005328 Bacteria 5047
5 Ga0070683_100140764 3300005329 Bacteria 2286
6 Ga0070670_100133374 3300005331 Bacteria 2146
7 Ga0068869_100028444 3300005334 Bacteria 3906
8 Ga0068868_100063568 3300005338 Bacteria 2927
9 Ga0068868_100087631 3300005338 Bacteria 2504
10 Ga0070689_100146350 3300005340 Bacteria 1903
11 Ga0070691_10001464 3300005341 Bacteria 10125
12 Ga0070661_100152286 3300005344 Bacteria 1749
13 Ga0070668_100006636 3300005347 Bacteria 8578
14 Ga0070669_100020374 3300005353 Bacteria 4736
15 Ga0070669_100073395 3300005353 Bacteria 2534
16 Ga0070674_100000235 3300005356 Bacteria 27333
17 Ga0070674_100074445 3300005356 Bacteria 2410
18 Ga0070673_100059497 3300005364 Bacteria 3024
19 Ga0070659_100072625 3300005366 Bacteria 2738
20 Ga0070667_100018630 3300005367 Bacteria 5758
21 Ga0070701_10011284 3300005438 Bacteria 3989
22 Ga0070705_100014698 3300005440 Bacteria 4033
23 Ga0070700_100005804 3300005441 Bacteria 6553
24 Ga0070662_100045085 3300005457 Bacteria 3162
25 Ga0070681_10003693 3300005458 Bacteria 14358
26 Ga0068867_100003053 3300005459 Bacteria 11801
27 Ga0068867_100031732 3300005459 Bacteria 3817
28 Ga0070698_100038961 3300005471 Bacteria 4896
29 Ga0070698_100410002 3300005471 Bacteria 1289
30 Ga0070699_100041060 3300005518 Bacteria 4004
31 Ga0070699_100060877 3300005518 Bacteria 3272
32 Ga0070679_100002683 3300005530 Bacteria 16214
33 Ga0070697_100132789 3300005536 Bacteria 2089
34 Ga0070672_100020024 3300005543 Bacteria 4873
35 Ga0070672_100181985 3300005543 Bacteria 1752
36 Ga0070695_100004711 3300005545 Bacteria 8023
37 Ga0070695_100132430 3300005545 Bacteria 1720
38 Ga0070696_100169857 3300005546 Bacteria 1611
39 Ga0070665_100001492 3300005548 Bacteria 27240
40 Ga0070665_100005070 3300005548 Bacteria 13668
41 Ga0068857_100098005 3300005577 Bacteria 2629
42 Ga0068854_100041508 3300005578 Bacteria 3251
43 Ga0070702_100004668 3300005615 Bacteria 6285
44 Ga0068859_100042000 3300005617 Bacteria 4593
45 Ga0068859_100046920 3300005617 Bacteria 4338
46 Ga0068859_100053618 3300005617 Bacteria 4056
47 Ga0068864_100005089 3300005618 Bacteria 10771
48 Ga0068864_100066196 3300005618 Bacteria 3136
49 Ga0068864_100159527 3300005618 Bacteria 2049
50 Ga0068866_10058211 3300005718 Bacteria 1995
51 Ga0068861_100003453 3300005719 Bacteria 10493
52 Ga0068863_100012842 3300005841 Bacteria 8077
53 Ga0068858_100007987 3300005842 Bacteria 10200
54 Ga0068858_100026803 3300005842 Bacteria 5354
55 Ga0068858_100176508 3300005842 Bacteria 2016
56 Ga0068860_100054977 3300005843 Bacteria 3783
57 Ga0068860_100141350 3300005843 Bacteria 2314
58 Ga0068860_100231677 3300005843 Bacteria 1795
59 Ga0068862_100012037 3300005844 Bacteria 7149
60 Ga0068862_100023014 3300005844 Bacteria 5217
61 Ga0068862_100134920 3300005844 Bacteria 2187
62 Ga0081539_10025602 3300005985 Bacteria 3793
63 Ga0075432_10029810 3300006058 Bacteria 1885
64 Ga0070716_100097300 3300006173 Bacteria 1796
65 Ga0097621_100005127 3300006237 Bacteria 9204
66 Ga0097621_100008625 3300006237 Bacteria 7353
67 Ga0097621_100009684 3300006237 Bacteria 7008
68 Ga0068871_100001848 3300006358 Bacteria 14311
69 Ga0068871_100022437 3300006358 Bacteria 4865
70 Ga0068871_100038554 3300006358 Bacteria 3817
71 Ga0075428_100023548 3300006844 Bacteria 6817
72 Ga0075428_100109642 3300006844 Bacteria 3007
73 Ga0075431_100014869 3300006847 Bacteria 7880
74 Ga0075431_100035152 3300006847 Bacteria 5160
75 Ga0075433_10014211 3300006852 Bacteria 6499
76 Ga0075433_10021567 3300006852 Bacteria 5403
77 Ga0075433_10059951 3300006852 Bacteria 3331
78 Ga0075433_10101866 3300006852 Bacteria 2542
79 Ga0075434_100052692 3300006871 Bacteria 4043
80 Ga0075434_100074240 3300006871 Bacteria 3395
81 Ga0075434_100241993 3300006871 Bacteria 1824
82 Ga0075434_100452079 3300006871 Bacteria 1306
83 Ga0075429_100114093 3300006880 Bacteria 2362
84 Ga0068865_100016508 3300006881 Bacteria 4727
85 Ga0075436_100015713 3300006914 Bacteria 5182
86 Ga0075436_100158290 3300006914 Bacteria 1596
87 Ga0097620_100042000 3300006931 Bacteria 4593
88 Ga0097620_100046920 3300006931 Bacteria 4338
89 Ga0097620_100053616 3300006931 Bacteria 4056
90 Ga0075435_100047892 3300007076 Bacteria 3432
91 Ga0105240_10017120 3300009093 Bacteria 9785
92 Ga0111539_10016826 3300009094 Bacteria 9057
93 Ga0111539_10020699 3300009094 Bacteria 8100
94 Ga0111539_10090471 3300009094 Bacteria 3597
95 Ga0111539_10323483 3300009094 Bacteria 1795
96 Ga0111539_10406384 3300009094 Bacteria 1586
97 Ga0105245_10036033 3300009098 Bacteria 4393
98 Ga0105247_10002386 3300009101 Bacteria 12782
99 Ga0114129_10001999 3300009147 Bacteria 27921
100 Ga0114129_10008750 3300009147 Bacteria 14437
101 Ga0114129_10011138 3300009147 Bacteria 12820
102 Ga0114129_10011232 3300009147 Bacteria 12768
103 Ga0114129_10019359 3300009147 Bacteria 9694
104 Ga0114129_10041879 3300009147 Bacteria 6448
105 Ga0114129_10178177 3300009147 Bacteria 2894
106 Ga0114129_10220292 3300009147 Bacteria 2560
107 Ga0105242_10003253 3300009176 Bacteria 12673
108 Ga0105242_10021810 3300009176 Bacteria 5033
109 Ga0105242_10232629 3300009176 Bacteria 1652
110 Ga0105248_10004005 3300009177 Bacteria 16285
111 Ga0105248_10018657 3300009177 Bacteria 7669
112 Ga0105248_10041623 3300009177 Bacteria 5151
113 Ga0105248_10117295 3300009177 Bacteria 3002
114 Ga0105248_10167983 3300009177 Bacteria 2473
115 Ga0105238_10313340 3300009551 Bacteria 1554
116 Ga0157378_10003271 3300013297 Bacteria 14401
117 Ga0157375_10126133 3300013308 Bacteria 2674
118 Ga0157379_10012371 3300014968 Bacteria 7455
119 Ga0157379_10185010 3300014968 Bacteria 1882
120 Ga0157376_10020674 3300014969 Bacteria 5099
121 Ga0157376_10114231 3300014969 Bacteria 2382
122 Ga0207645_10000630 3300025907 Bacteria 29240
123 Ga0207695_10264549 3300025913 Bacteria 1617
124 Ga0207657_10002909 3300025919 Bacteria 18389
125 Ga0207681_10016848 3300025923 Bacteria 4581
126 Ga0207681_10062560 3300025923 Bacteria 2563
127 Ga0207681_10083771 3300025923 Bacteria 2258
128 Ga0207687_10032049 3300025927 Bacteria 3557
129 Ga0207644_10069191 3300025931 Bacteria 2577
130 Ga0207706_10022246 3300025933 Bacteria 5689
131 Ga0207686_10010265 3300025934 Bacteria 5094
132 Ga0207686_10045745 3300025934 Bacteria 2695
133 Ga0207686_10098961 3300025934 Bacteria 1943
134 Ga0207686_10155358 3300025934 Bacteria 1598
135 Ga0207670_10078360 3300025936 Bacteria 2304
136 Ga0207704_10036101 3300025938 Bacteria 2841
137 Ga0207704_10139791 3300025938 Bacteria 1692
138 Ga0207665_10116303 3300025939 Bacteria 1885
139 Ga0207711_10012316 3300025941 Bacteria 7108
140 Ga0207711_10040466 3300025941 Bacteria 3966
141 Ga0207711_10062816 3300025941 Bacteria 3205
142 Ga0207711_10227077 3300025941 Bacteria 1709
143 Ga0207661_10198693 3300025944 Bacteria 1762
144 Ga0207679_10207051 3300025945 Bacteria 1643
145 Ga0207651_10006484 3300025960 Bacteria 6134
146 Ga0207668_10025835 3300025972 Bacteria 3806
147 Ga0207677_10032257 3300026023 Bacteria 3365
148 Ga0207677_10035548 3300026023 Bacteria 3237
149 Ga0207703_10005353 3300026035 Bacteria 10336
150 Ga0207703_10017508 3300026035 Bacteria 5593
151 Ga0207703_10052302 3300026035 Bacteria 3316
152 Ga0207703_10111646 3300026035 Bacteria 2334
153 Ga0207703_10144667 3300026035 Bacteria 2066
154 Ga0207708_10000978 3300026075 Bacteria 21433
155 Ga0207708_10130395 3300026075 Bacteria 1965
156 Ga0207641_10169940 3300026088 Bacteria 1989
157 Ga0207648_10004331 3300026089 Bacteria 14617
158 Ga0207648_10021936 3300026089 Bacteria 5737
159 Ga0207648_10208337 3300026089 Bacteria 1735
160 Ga0207676_10127561 3300026095 Bacteria 2157
161 Ga0207676_10134755 3300026095 Bacteria 2105
162 Ga0207675_100002071 3300026118 Bacteria 19965
163 Ga0207675_100003564 3300026118 Bacteria 15160
164 Ga0207428_10005407 3300027907 Bacteria 11912
165 Ga0207428_10013293 3300027907 Bacteria 7197
166 Ga0268266_10003785 3300028379 Bacteria 14810
167 Ga0268266_10034425 3300028379 Bacteria 4308
168 Ga0268265_10113073 3300028380 Bacteria 2221
169 Ga0268264_10035383 3300028381 Bacteria 4111
170 Ga0268264_10144090 3300028381 Bacteria 2128
171 Ga0307409_100081745 3300031995 Bacteria 2613
172 Ga0373956_0035711 3300035119 Bacteria 2193
173 Ga0373943_0045841 3300035170 Bacteria 2132
174 Ga0373955_0037150 3300035172 Bacteria 2589
175 Ga0373955_0077039 3300035172 Bacteria 1877
176 Ga0373935_0115115 3300035692 Bacteria 1790
177 Ga0373937_0014933 3300036401 Bacteria 6859
178 Ga0436365_1126612 3300039437 Bacteria 1772
179 Ga0439460_0007885 3300042461 Bacteria 2676
180 Ga0451577_0012810 3300042876 Bacteria 7870
181 Ga0495592_0080918 3300046454 Bacteria 2349
182 Ga0495580_0101016 3300046472 Bacteria 2006
183 Ga0495580_0224549 3300046472 Bacteria 1290
184 Ga0495582_0075734 3300046473 Bacteria 1864
185 Ga0495608_0008013 3300046511 Bacteria 7428
186 Ga0495630_0009226 3300046517 Bacteria 7092
187 Ga0495645_0005003 3300046543 Bacteria 9084
188 Ga0495645_0062300 3300046543 Bacteria 2701
189 Ga0495667_0060922 3300046559 Bacteria 2475
190 Ga0495656_0110322 3300046615 Bacteria 1286
191 Ga0495634_0067447 3300046642 Bacteria 2367
192 Ga0495635_0030260 3300046663 Bacteria 3762
193 Ga0495658_0075682 3300046683 Bacteria 1965
194 Ga0495669_0004174 3300046684 Bacteria 5944
195 Ga0495669_0008559 3300046684 Bacteria 4308
196 Ga0495613_0003890 3300046689 Bacteria 11176
197 Ga0495604_0031490 3300047317 Bacteria 4206
198 Ga0495674_0129258 3300047319 Bacteria 2129
199 Ga0495684_0017049 3300047471 Bacteria 5594
200 Ga0496100_0000818 3300048903 Bacteria 14930
201 Ga0496101_0001661 3300048904 Bacteria 13342
202 Ga0496102_0010055 3300048905 Bacteria 8138
203 Ga0496104_0003527 3300048907 Bacteria 13490
204 Ga0496104_0030167 3300048907 Bacteria 5037
205 Ga0496105_0052742 3300048908 Bacteria 3359
206 Ga0496106_0011246 3300048909 Bacteria 6623
207 Ga0496107_0146173 3300048910 Bacteria 1748
208 Ga0496108_0014183 3300048911 Bacteria 6501
209 Ga0496108_0276585 3300048911 Bacteria 1462
210 Ga0496109_0355416 3300048912 Bacteria 1384
211 Ga0496112_0010102 3300048915 Bacteria 8546
212 Ga0496114_0000958 3300048917 Bacteria 21594
213 Ga0501036_0059342 3300049572 Bacteria 3242
214 Ga0501039_0296168 3300049575 Bacteria 1272
215 Ga0501072_0013227 3300049588 Bacteria 6320
216 Ga0501074_0236033 3300049590 Bacteria 1301
217 Ga0501075_0046871 3300049591 Bacteria 3248
218 Ga0501075_0104756 3300049591 Bacteria 2150
219 Ga0501075_0221924 3300049591 Bacteria 1442
220 Ga0501076_0061399 3300049592 Bacteria 2991
221 Ga0501076_0068187 3300049592 Bacteria 2841
222 Ga0501079_0108071 3300049741 Bacteria 2160
223 Ga0501081_0028362 3300049743 Bacteria 3778
224 Ga0501035_0120795 3300049822 Bacteria 2291
225 Ga0501045_0011044 3300049824 Bacteria 6331
226 nmdc:mga05p37_136958_c1 3300050507 Bacteria 3001
227 nmdc:mga05p37_14704_c1 3300050507 Bacteria 9403
228 nmdc:mga05p37_19584_c1 3300050507 Bacteria 8185
229 nmdc:mga05p37_24585_c1 3300050507 Bacteria 7323
230 nmdc:mga05p37_3190_c1 3300050507 Bacteria 19076
231 nmdc:mga05p37_40683_c1 3300050507 Bacteria 5708
232 nmdc:mga05p37_9543_c1 3300050507 Bacteria 11492
233 nmdc:mga09592_153459_c1 3300050508 Bacteria 1987
234 nmdc:mga09592_253689_c1 3300050508 Bacteria 1525
235 nmdc:mga09592_98226_c1 3300050508 Bacteria 2506
236 nmdc:mga06r32_149532_c1 3300050510 Bacteria 2313
237 nmdc:mga06r32_36579_c1 3300050510 Bacteria 4640
238 nmdc:mga08y16_104605_c1 3300050511 Bacteria 2947
239 nmdc:mga08y16_22957_c1 3300050511 Bacteria 6586
240 nmdc:mga08y16_41120_c1 3300050511 Bacteria 4843
241 nmdc:mga0n895_19221_c1 3300050512 Bacteria 6345
242 nmdc:mga0n895_92171_c1 3300050512 Bacteria 3033
243 nmdc:mga0rr50_36608_c1 3300050513 Bacteria 3536
244 nmdc:mga0rr50_55402_c1 3300050513 Bacteria 2958
245 nmdc:mga0a205_25158_c2 3300050515 Bacteria 5346
246 nmdc:mga0a205_30478_c1 3300050515 Bacteria 5165
247 nmdc:mga0a205_62927_c1 3300050515 Bacteria 3584
248 Ga0495601_0009584 3300053077 Bacteria 5735
249 Ga0495601_0068271 3300053077 Bacteria 2266
250 Ga0495595_0018639 3300053084 Bacteria 3002
251 Ga0495619_0000485 3300053085 Bacteria 26622
252 Ga0495619_0002018 3300053085 Bacteria 13495
253 Ga0495619_0096064 3300053085 Bacteria 2012
254 Ga0590071_001202 3300059421 Bacteria 7002
255 Ga0590071_009235 3300059421 Bacteria 2316
256 Ga0590077_000251 3300059426 Bacteria 15342
257 Ga0070660_100016534
258 Ga0065712_10073379
259 Ga0065715_10002254
260 Ga0070676_10010406
261 Ga0070683_100140764
262 Ga0070670_100133374
263 Ga0068869_100028444
264 Ga0068868_100063568
265 Ga0068868_100087631
266 Ga0070689_100146350
267 Ga0070691_10001464
268 Ga0070661_100152286
269 Ga0070668_100006636
270 Ga0070669_100020374
271 Ga0070669_100073395
272 Ga0070674_100000235
273 Ga0070674_100074445
274 Ga0070673_100059497
275 Ga0070659_100072625
276 Ga0070667_100018630
277 Ga0070701_10011284
278 Ga0070705_100014698
279 Ga0070700_100005804
280 Ga0070662_100045085
281 Ga0070681_10003693
282 Ga0068867_100003053
283 Ga0068867_100031732
284 Ga0070698_100038961
285 Ga0070698_100410002
286 Ga0070699_100041060
287 Ga0070699_100060877
288 Ga0070679_100002683
289 Ga0070697_100132789
290 Ga0070672_100020024
291 Ga0070672_100181985
292 Ga0070695_100004711
293 Ga0070695_100132430
294 Ga0070696_100169857
295 Ga0070665_100001492
296 Ga0070665_100005070
297 Ga0068857_100098005
298 Ga0068854_100041508
299 Ga0070702_100004668
300 Ga0068859_100042000
301 Ga0068859_100046920
302 Ga0068859_100053618
303 Ga0068864_100005089
304 Ga0068864_100066196
305 Ga0068864_100159527
306 Ga0068866_10058211
307 Ga0068861_100003453
308 Ga0068863_100012842
309 Ga0068858_100007987
310 Ga0068858_100026803
311 Ga0068858_100176508
312 Ga0068860_100054977
313 Ga0068860_100141350
314 Ga0068860_100231677
315 Ga0068862_100012037
316 Ga0068862_100023014
317 Ga0068862_100134920
318 Ga0081539_10025602
319 Ga0075432_10029810
320 Ga0070716_100097300
321 Ga0097621_100005127
322 Ga0097621_100008625
323 Ga0097621_100009684
324 Ga0068871_100001848
325 Ga0068871_100022437
326 Ga0068871_100038554
327 Ga0075428_100023548
328 Ga0075428_100109642
329 Ga0075431_100014869
330 Ga0075431_100035152
331 Ga0075433_10014211
332 Ga0075433_10021567
333 Ga0075433_10059951
334 Ga0075433_10101866
335 Ga0075434_100052692
336 Ga0075434_100074240
337 Ga0075434_100241993
338 Ga0075434_100452079
339 Ga0075429_100114093
340 Ga0068865_100016508
341 Ga0075436_100015713
342 Ga0075436_100158290
343 Ga0097620_100042000
344 Ga0097620_100046920
345 Ga0097620_100053616
346 Ga0075435_100047892
347 Ga0105240_10017120
348 Ga0111539_10016826
349 Ga0111539_10020699
350 Ga0111539_10090471
351 Ga0111539_10323483
352 Ga0111539_10406384
353 Ga0105245_10036033
354 Ga0105247_10002386
355 Ga0114129_10001999
356 Ga0114129_10008750
357 Ga0114129_10011138
358 Ga0114129_10011232
359 Ga0114129_10019359
360 Ga0114129_10041879
361 Ga0114129_10178177
362 Ga0114129_10220292
363 Ga0105242_10003253
364 Ga0105242_10021810
365 Ga0105242_10232629
366 Ga0105248_10004005
367 Ga0105248_10018657
368 Ga0105248_10041623
369 Ga0105248_10117295
370 Ga0105248_10167983
371 Ga0105238_10313340
372 Ga0157378_10003271
373 Ga0157375_10126133
374 Ga0157379_10012371
375 Ga0157379_10185010
376 Ga0157376_10020674
377 Ga0157376_10114231
378 Ga0207645_10000630
379 Ga0207695_10264549
380 Ga0207657_10002909
381 Ga0207681_10016848
382 Ga0207681_10062560
383 Ga0207681_10083771
384 Ga0207687_10032049
385 Ga0207644_10069191
386 Ga0207706_10022246
387 Ga0207686_10010265
388 Ga0207686_10045745
389 Ga0207686_10098961
390 Ga0207686_10155358
391 Ga0207670_10078360
392 Ga0207704_10036101
393 Ga0207704_10139791
394 Ga0207665_10116303
395 Ga0207711_10012316
396 Ga0207711_10040466
397 Ga0207711_10062816
398 Ga0207711_10227077
399 Ga0207661_10198693
400 Ga0207679_10207051
401 Ga0207651_10006484
402 Ga0207668_10025835
403 Ga0207677_10032257
404 Ga0207677_10035548
405 Ga0207703_10005353
406 Ga0207703_10017508
407 Ga0207703_10052302
408 Ga0207703_10111646
409 Ga0207703_10144667
410 Ga0207708_10000978
411 Ga0207708_10130395
412 Ga0207641_10169940
413 Ga0207648_10004331
414 Ga0207648_10021936
415 Ga0207648_10208337
416 Ga0207676_10127561
417 Ga0207676_10134755
418 Ga0207675_100002071
419 Ga0207675_100003564
420 Ga0207428_10005407
421 Ga0207428_10013293
422 Ga0268266_10003785
423 Ga0268266_10034425
424 Ga0268265_10113073
425 Ga0268264_10035383
426 Ga0268264_10144090
427 Ga0307409_100081745
428 Ga0373956_0035711
429 Ga0373943_0045841
430 Ga0373955_0037150
431 Ga0373955_0077039
432 Ga0373935_0115115
433 Ga0373937_0014933
434 Ga0436365_1126612
435 Ga0439460_0007885
436 Ga0451577_0012810
437 Ga0495592_0080918
438 Ga0495580_0101016
439 Ga0495580_0224549
440 Ga0495582_0075734
441 Ga0495608_0008013
442 Ga0495630_0009226
443 Ga0495645_0005003
444 Ga0495645_0062300
445 Ga0495667_0060922
446 Ga0495656_0110322
447 Ga0495634_0067447
448 Ga0495635_0030260
449 Ga0495658_0075682
450 Ga0495669_0004174
451 Ga0495669_0008559
452 Ga0495613_0003890
453 Ga0495604_0031490
454 Ga0495674_0129258
455 Ga0495684_0017049
456 Ga0496100_0000818
457 Ga0496101_0001661
458 Ga0496102_0010055
459 Ga0496104_0003527
460 Ga0496104_0030167
461 Ga0496105_0052742
462 Ga0496106_0011246
463 Ga0496107_0146173
464 Ga0496108_0014183
465 Ga0496108_0276585
466 Ga0496109_0355416
467 Ga0496112_0010102
468 Ga0496114_0000958
469 Ga0501036_0059342
470 Ga0501039_0296168
471 Ga0501072_0013227
472 Ga0501074_0236033
473 Ga0501075_0046871
474 Ga0501075_0104756
475 Ga0501075_0221924
476 Ga0501076_0061399
477 Ga0501076_0068187
478 Ga0501079_0108071
479 Ga0501081_0028362
480 Ga0501035_0120795
481 Ga0501045_0011044
482 nmdc:mga05p37_136958_c1
483 nmdc:mga05p37_14704_c1
484 nmdc:mga05p37_19584_c1
485 nmdc:mga05p37_24585_c1
486 nmdc:mga05p37_3190_c1
487 nmdc:mga05p37_40683_c1
488 nmdc:mga05p37_9543_c1
489 nmdc:mga09592_153459_c1
490 nmdc:mga09592_253689_c1
491 nmdc:mga09592_98226_c1
492 nmdc:mga06r32_149532_c1
493 nmdc:mga06r32_36579_c1
494 nmdc:mga08y16_104605_c1
495 nmdc:mga08y16_22957_c1
496 nmdc:mga08y16_41120_c1
497 nmdc:mga0n895_19221_c1
498 nmdc:mga0n895_92171_c1
499 nmdc:mga0rr50_36608_c1
500 nmdc:mga0rr50_55402_c1
501 nmdc:mga0a205_25158_c2
502 nmdc:mga0a205_30478_c1
503 nmdc:mga0a205_62927_c1
504 Ga0495601_0009584
505 Ga0495601_0068271
506 Ga0495595_0018639
507 Ga0495619_0000485
508 Ga0495619_0002018
509 Ga0495619_0096064
510 Ga0590071_001202
511 Ga0590071_009235
512 Ga0590077_000251

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08436

DXP_redisom_C

1-deoxy-D-xylulose 5-phosphate reductoisomerase C-terminal domain

145

228

0.99

PF02670

DXP_reductoisom

1-deoxy-D-xylulose 5-phosphate reductoisomerase

4

131

0.97

PF13288

DXPR_C

DXP reductoisomerase C-terminal domain

260

394

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6mh5-assembly1.cif.gz_A crystal structure of 1-deoxy-d-xylulose-5-phosphate reductoisomerase from staphylococcus schleiferi in complex with fosmidomycin (fom) 0.9628 1 375
1r0k-assembly2.cif.gz_D crystal structure of 1-deoxy-d-xylulose 5-phosphate reductoisomerase from zymomonas mobilis 0.9624 2 383
1r0k-assembly2.cif.gz_C crystal structure of 1-deoxy-d-xylulose 5-phosphate reductoisomerase from zymomonas mobilis 0.9619 2 385
7s04-assembly1.cif.gz_A-2 1-deoxy-d-xylulose 5-phosphate reductoisomerase (ispc) from acinetobacter baumannii in complex with fr900098, nadph, and a magnesium ion 0.9601 1 385
1r0l-assembly1.cif.gz_A 1-deoxy-d-xylulose 5-phosphate reductoisomerase from zymomonas mobilis in complex with nadph 0.9585 2 382
ID Description Score Start End Superfamily
4zn6B03 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.9945 301 386 1.10.1740.10
1r0kC03 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.9783 302 385 1.10.1740.10
2eghA03 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.9754 302 386 1.10.1740.10
5dulA03 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.9737 302 383 1.10.1740.10
3zhyB03 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.9725 301 383 1.10.1740.10
ID Description Score Start End GO Terms
AF-A0A3N5YD20-F1-model_v4 1-deoxy-D-xylulose-5-phosphate reductoisomerase (EC 1.1.1.267) 0.9925 123 389 GO:0016853
GO:0030145
GO:0030604
GO:0051484
GO:0070402
AF-X0XH03-F1-model_v4 1-deoxy-D-xylulose-5-phosphate reductoisomerase (EC 1.1.1.267) 0.9895 112 347 GO:0030145
GO:0030604
GO:0051484
GO:0070402
AF-A0A350D9B2-F1-model_v4 1-deoxy-D-xylulose-5-phosphate reductoisomerase (EC 1.1.1.267) 0.9892 79 378 GO:0016853
GO:0030145
GO:0030604
GO:0051484
GO:0070402
AF-A0A3N5YD20-F1-model_v4 1-deoxy-D-xylulose-5-phosphate reductoisomerase (EC 1.1.1.267) 0.9889 123 389 GO:0016853
GO:0030145
GO:0030604
GO:0051484
GO:0070402
AF-A0A7C5HGZ8-F1-model_v4 1-deoxy-D-xylulose-5-phosphate reductoisomerase (EC 1.1.1.267) 0.9881 87 382 GO:0030145
GO:0030604
GO:0051484
GO:0070402

Map