F366311
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 256 | 177 | 254 | 187 |
Family's Representative Sequence
| Representative Sequence | 3300005518|Ga0070699_100238853|Ga0070699_1002388531 |
| Length | 203 |
| Sequence | VTPYLPPVDKPRGLVLRLVYFFTRRQFGKVPTPIAVHSARMPTAFLSFYGKVSRLDKKLELPADIAMLVRERVASVNSCLFCMDSQRWYVQHKSPDNLARLDALPEYQTSPLFTDGERAALDYATELTRDKHVAPETFARMRRHYSEREICDIVWLVASEHLYNMTNHGLNIGSDGLCELRAAPSATATKDGPSRPAARARQA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 2 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 5 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 6 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 7 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 9 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 10 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 11 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 12 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 13 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 36 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 37 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 38 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 39 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 40 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 41 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 42 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 43 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 44 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 45 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 46 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 49 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 50 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 51 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 52 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 53 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 54 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 55 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 57 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 72 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 73 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 74 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 75 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 77 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 78 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 112 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 114 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 115 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 116 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 117 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 118 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 119 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 120 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 121 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 122 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 123 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 124 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 125 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 126 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 127 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 128 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 129 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 130 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 131 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 132 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 133 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 134 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 135 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 159 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 160 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 161 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 162 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 163 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 164 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 165 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 166 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 167 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 168 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 169 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 170 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 171 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 172 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 173 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 174 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 177 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.22 |
| Metatranscriptomes | 0 |
| Isolates | 0.78 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.98 |
| Nodule | 0 |
| Rhizoplane | 1.17 |
| Rhizosphere | 86.72 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10005343 | 3300001989 | Unclassified | 4891 |
| 2 | JGI25153J46596_10006489 | 3300003215 | Bacteria | 5901 |
| 3 | rootH2_10168541 | 3300003320 | Bacteria | 1477 |
| 4 | rootL2_10293290 | 3300003322 | Unclassified | 4324 |
| 5 | JGI25160J50197_1007034 | 3300003354 | Bacteria | 4455 |
| 6 | JGI25407J50210_10108439 | 3300003373 | Bacteria | 685 |
| 7 | Ga0055526_1047133 | 3300003771 | Bacteria | 1015 |
| 8 | Ga0055528_1000923 | 3300003790 | Bacteria | 19651 |
| 9 | Ga0055530_10001354 | 3300003791 | Bacteria | 18212 |
| 10 | Ga0065165_1000022 | 3300005262 | Bacteria | 253404 |
| 11 | Ga0065707_10227186 | 3300005295 | Unclassified | 1202 |
| 12 | Ga0065707_10354954 | 3300005295 | Archaea | 855 |
| 13 | Ga0070658_10550103 | 3300005327 | Bacteria | 999 |
| 14 | Ga0070683_100391586 | 3300005329 | Bacteria | 1325 |
| 15 | Ga0070680_100164245 | 3300005336 | Bacteria | 1867 |
| 16 | Ga0070689_100002083 | 3300005340 | Bacteria | 12991 |
| 17 | Ga0070661_100006438 | 3300005344 | Bacteria | 8095 |
| 18 | Ga0070669_100209253 | 3300005353 | Bacteria | 1538 |
| 19 | Ga0070671_100216463 | 3300005355 | Bacteria | 1625 |
| 20 | Ga0070688_100020835 | 3300005365 | Unclassified | 3820 |
| 21 | Ga0070659_100259198 | 3300005366 | Bacteria | 1442 |
| 22 | Ga0070709_10544322 | 3300005434 | Unclassified | 887 |
| 23 | Ga0070714_100000021 | 3300005435 | Bacteria | 165681 |
| 24 | Ga0070711_100173515 | 3300005439 | Unclassified | 1645 |
| 25 | Ga0070711_100528581 | 3300005439 | Archaea | 976 |
| 26 | Ga0070711_100833400 | 3300005439 | Bacteria | 784 |
| 27 | Ga0070708_100047210 | 3300005445 | Bacteria | 3803 |
| 28 | Ga0070663_100169324 | 3300005455 | Bacteria | 1687 |
| 29 | Ga0070663_100453388 | 3300005455 | Bacteria | 1057 |
| 30 | Ga0070706_100007206 | 3300005467 | Bacteria | 10450 |
| 31 | Ga0070706_100012104 | 3300005467 | Bacteria | 8005 |
| 32 | Ga0070706_100275036 | 3300005467 | Bacteria | 1571 |
| 33 | Ga0070706_100727166 | 3300005467 | Bacteria | 920 |
| 34 | Ga0070707_100004183 | 3300005468 | Bacteria | 13526 |
| 35 | Ga0070707_100429500 | 3300005468 | Bacteria | 1281 |
| 36 | Ga0070707_100556085 | 3300005468 | Archaea | 1110 |
| 37 | Ga0070698_100001393 | 3300005471 | Bacteria | 26762 |
| 38 | Ga0070698_100002470 | 3300005471 | Bacteria | 20404 |
| 39 | Ga0070698_100175153 | 3300005471 | Bacteria | 2085 |
| 40 | Ga0070698_100458355 | 3300005471 | Archaea | 1211 |
| 41 | Ga0070699_100013953 | 3300005518 | Bacteria | 6911 |
| 42 | Ga0070699_100232820 | 3300005518 | Unclassified | 1643 |
| 43 | Ga0070699_100238853 | 3300005518 | Bacteria | 1621 |
| 44 | Ga0070679_100018801 | 3300005530 | Bacteria | 6708 |
| 45 | Ga0070679_100615805 | 3300005530 | Unclassified | 1029 |
| 46 | Ga0070697_100044593 | 3300005536 | Bacteria | 3592 |
| 47 | Ga0070697_100047664 | 3300005536 | Unclassified | 3474 |
| 48 | Ga0070697_100209633 | 3300005536 | Unclassified | 1659 |
| 49 | Ga0070697_100521739 | 3300005536 | Bacteria | 1040 |
| 50 | Ga0068853_100000001 | 3300005539 | Bacteria | 715840 |
| 51 | Ga0068853_100181691 | 3300005539 | Unclassified | 1908 |
| 52 | Ga0068855_100384507 | 3300005563 | Unclassified | 1540 |
| 53 | Ga0068855_100833475 | 3300005563 | Bacteria | 978 |
| 54 | Ga0068857_100000725 | 3300005577 | Bacteria | 24603 |
| 55 | Ga0068857_100010554 | 3300005577 | Bacteria | 8031 |
| 56 | Ga0068857_100011439 | 3300005577 | Bacteria | 7721 |
| 57 | Ga0068854_100032649 | 3300005578 | Bacteria | 3624 |
| 58 | Ga0068854_100098740 | 3300005578 | Bacteria | 2186 |
| 59 | Ga0068856_100021152 | 3300005614 | Bacteria | 6322 |
| 60 | Ga0068856_100152117 | 3300005614 | Bacteria | 2323 |
| 61 | Ga0068859_100322414 | 3300005617 | Bacteria | 1639 |
| 62 | Ga0068859_101168518 | 3300005617 | Unclassified | 847 |
| 63 | Ga0068870_10240040 | 3300005840 | Bacteria | 1118 |
| 64 | Ga0068863_100059178 | 3300005841 | Unclassified | 3625 |
| 65 | Ga0068863_101313875 | 3300005841 | Unclassified | 730 |
| 66 | Ga0068862_100040190 | 3300005844 | Bacteria | 3976 |
| 67 | Ga0081455_10014057 | 3300005937 | Bacteria | 7868 |
| 68 | Ga0081455_10397927 | 3300005937 | Unclassified | 957 |
| 69 | Ga0081538_10005578 | 3300005981 | Bacteria | 11300 |
| 70 | Ga0081540_1012428 | 3300005983 | Bacteria | 5607 |
| 71 | Ga0070717_10003911 | 3300006028 | Bacteria | 10720 |
| 72 | Ga0070717_10006711 | 3300006028 | Bacteria | 8487 |
| 73 | Ga0070717_10019889 | 3300006028 | Bacteria | 5272 |
| 74 | Ga0070716_100841358 | 3300006173 | Archaea | 714 |
| 75 | Ga0075362_10051751 | 3300006177 | Bacteria | 1839 |
| 76 | Ga0075366_10014682 | 3300006195 | Unclassified | 4477 |
| 77 | Ga0068871_100550039 | 3300006358 | Bacteria | 1045 |
| 78 | Ga0075428_100005029 | 3300006844 | Bacteria | 14691 |
| 79 | Ga0075428_100252456 | 3300006844 | Bacteria | 1900 |
| 80 | Ga0075428_100482652 | 3300006844 | Unclassified | 1326 |
| 81 | Ga0075433_10117421 | 3300006852 | Bacteria | 2360 |
| 82 | Ga0075433_10439801 | 3300006852 | Bacteria | 1150 |
| 83 | Ga0075429_100255309 | 3300006880 | Bacteria | 1535 |
| 84 | Ga0075436_100023439 | 3300006914 | Bacteria | 4240 |
| 85 | Ga0097620_100322393 | 3300006931 | Bacteria | 1639 |
| 86 | Ga0097620_101168611 | 3300006931 | Unclassified | 847 |
| 87 | Ga0099795_10045744 | 3300007788 | Unclassified | 1575 |
| 88 | Ga0105240_10047822 | 3300009093 | Bacteria | 5410 |
| 89 | Ga0111539_10026463 | 3300009094 | Bacteria | 7091 |
| 90 | Ga0114129_10137039 | 3300009147 | Unclassified | 3358 |
| 91 | Ga0114129_10627101 | 3300009147 | Bacteria | 1390 |
| 92 | Ga0114129_10862666 | 3300009147 | Unclassified | 1150 |
| 93 | Ga0114129_11548083 | 3300009147 | Bacteria | 813 |
| 94 | Ga0105243_10457574 | 3300009148 | Bacteria | 1199 |
| 95 | Ga0105237_10385556 | 3300009545 | Bacteria | 1406 |
| 96 | Ga0105237_10705836 | 3300009545 | Bacteria | 1015 |
| 97 | Ga0105238_10006404 | 3300009551 | Bacteria | 11711 |
| 98 | Ga0105238_10070301 | 3300009551 | Bacteria | 3499 |
| 99 | Ga0105238_10486194 | 3300009551 | Bacteria | 1234 |
| 100 | Ga0105249_10455363 | 3300009553 | Bacteria | 1319 |
| 101 | Ga0157373_10130409 | 3300013100 | Bacteria | 1768 |
| 102 | Ga0157373_10204600 | 3300013100 | Bacteria | 1392 |
| 103 | Ga0157370_10120581 | 3300013104 | Bacteria | 2448 |
| 104 | Ga0157369_10046727 | 3300013105 | Bacteria | 4704 |
| 105 | Ga0157369_10047246 | 3300013105 | Bacteria | 4676 |
| 106 | Ga0157369_10523016 | 3300013105 | Bacteria | 1227 |
| 107 | Ga0157374_10934498 | 3300013296 | Bacteria | 885 |
| 108 | Ga0163162_10361501 | 3300013306 | Bacteria | 1585 |
| 109 | Ga0163162_10605091 | 3300013306 | Bacteria | 1222 |
| 110 | Ga0157372_10003274 | 3300013307 | Bacteria | 17504 |
| 111 | Ga0157372_10023212 | 3300013307 | Bacteria | 6721 |
| 112 | Ga0157380_10127728 | 3300014326 | Bacteria | 2164 |
| 113 | Ga0213872_10002606 | 3300021361 | Bacteria | 10483 |
| 114 | Ga0213875_10254656 | 3300021388 | Bacteria | 828 |
| 115 | Ga0213871_10002790 | 3300021441 | Unclassified | 3269 |
| 116 | Ga0224572_1012016 | 3300024225 | Unclassified | 1642 |
| 117 | Ga0209436_100829 | 3300025208 | Bacteria | 12536 |
| 118 | Ga0209673_1000517 | 3300025273 | Bacteria | 63164 |
| 119 | Ga0209564_1003520 | 3300025295 | Bacteria | 10578 |
| 120 | Ga0209564_1017898 | 3300025295 | Unclassified | 2732 |
| 121 | Ga0209758_1002857 | 3300025297 | Bacteria | 16764 |
| 122 | Ga0209758_1022633 | 3300025297 | Bacteria | 2871 |
| 123 | Ga0209050_1001100 | 3300025298 | Bacteria | 32780 |
| 124 | Ga0207426_1000057 | 3300025302 | Bacteria | 369548 |
| 125 | Ga0207426_1039446 | 3300025302 | Bacteria | 1479 |
| 126 | Ga0209051_1054571 | 3300025303 | Bacteria | 1303 |
| 127 | Ga0209257_1001984 | 3300025304 | Bacteria | 22002 |
| 128 | Ga0207656_10303240 | 3300025321 | Bacteria | 791 |
| 129 | Ga0207647_10013246 | 3300025904 | Bacteria | 5722 |
| 130 | Ga0207643_10225837 | 3300025908 | Bacteria | 1147 |
| 131 | Ga0207705_10000839 | 3300025909 | Bacteria | 25170 |
| 132 | Ga0207684_10028618 | 3300025910 | Bacteria | 4748 |
| 133 | Ga0207684_10036708 | 3300025910 | Bacteria | 4159 |
| 134 | Ga0207684_10046951 | 3300025910 | Bacteria | 3663 |
| 135 | Ga0207684_10102086 | 3300025910 | Archaea | 2452 |
| 136 | Ga0207707_10125927 | 3300025912 | Unclassified | 2240 |
| 137 | Ga0207695_10059443 | 3300025913 | Bacteria | 3963 |
| 138 | Ga0207671_10563813 | 3300025914 | Unclassified | 908 |
| 139 | Ga0207671_10793766 | 3300025914 | Archaea | 751 |
| 140 | Ga0207663_10080903 | 3300025916 | Bacteria | 2126 |
| 141 | Ga0207663_10671808 | 3300025916 | Archaea | 819 |
| 142 | Ga0207657_10021071 | 3300025919 | Bacteria | 6144 |
| 143 | Ga0207649_10186061 | 3300025920 | Bacteria | 1457 |
| 144 | Ga0207652_10034520 | 3300025921 | Bacteria | 4263 |
| 145 | Ga0207646_10021960 | 3300025922 | Bacteria | 5887 |
| 146 | Ga0207646_10932082 | 3300025922 | Archaea | 769 |
| 147 | Ga0207681_10193337 | 3300025923 | Bacteria | 1558 |
| 148 | Ga0207694_10092410 | 3300025924 | Bacteria | 2388 |
| 149 | Ga0207694_10175774 | 3300025924 | Bacteria | 1735 |
| 150 | Ga0207664_10000005 | 3300025929 | Bacteria | 485048 |
| 151 | Ga0207644_10182174 | 3300025931 | Bacteria | 1647 |
| 152 | Ga0207670_10001691 | 3300025936 | Bacteria | 11502 |
| 153 | Ga0207665_10347409 | 3300025939 | Bacteria | 1119 |
| 154 | Ga0207667_10123197 | 3300025949 | Bacteria | 2671 |
| 155 | Ga0207667_10774328 | 3300025949 | Bacteria | 958 |
| 156 | Ga0207712_10792901 | 3300025961 | Bacteria | 832 |
| 157 | Ga0207640_10079793 | 3300025981 | Bacteria | 2232 |
| 158 | Ga0207640_10751121 | 3300025981 | Unclassified | 841 |
| 159 | Ga0207639_10000001 | 3300026041 | Bacteria | 1431562 |
| 160 | Ga0207639_10869908 | 3300026041 | Bacteria | 842 |
| 161 | Ga0207678_10001060 | 3300026067 | Bacteria | 25172 |
| 162 | Ga0207702_10052666 | 3300026078 | Bacteria | 3444 |
| 163 | Ga0207641_10081385 | 3300026088 | Unclassified | 2812 |
| 164 | Ga0207674_10001330 | 3300026116 | Bacteria | 32057 |
| 165 | Ga0207674_10008885 | 3300026116 | Bacteria | 11556 |
| 166 | Ga0207674_10016612 | 3300026116 | Bacteria | 8047 |
| 167 | Ga0207698_10594233 | 3300026142 | Bacteria | 1090 |
| 168 | Ga0207428_10012223 | 3300027907 | Bacteria | 7551 |
| 169 | Ga0268265_10125277 | 3300028380 | Bacteria | 2125 |
| 170 | Ga0265327_10035773 | 3300031251 | Bacteria | 2740 |
| 171 | Ga0307509_10009629 | 3300031507 | Bacteria | 12015 |
| 172 | Ga0373926_0000776 | 3300035083 | Bacteria | 8963 |
| 173 | Ga0373934_0029721 | 3300035086 | Bacteria | 2135 |
| 174 | Ga0373956_0021865 | 3300035119 | Bacteria | 2731 |
| 175 | Ga0373956_0050384 | 3300035119 | Bacteria | 1869 |
| 176 | Ga0373943_0144382 | 3300035170 | Archaea | 1285 |
| 177 | Ga0373946_0009203 | 3300035171 | Unclassified | 3634 |
| 178 | Ga0373924_0049831 | 3300035410 | Bacteria | 1734 |
| 179 | Ga0373935_0226510 | 3300035692 | Unclassified | 1300 |
| 180 | Ga0373927_0000272 | 3300035695 | Bacteria | 40698 |
| 181 | Ga0373933_0056585 | 3300035724 | Bacteria | 2355 |
| 182 | Ga0373947_0289247 | 3300035725 | Archaea | 1091 |
| 183 | Ga0373925_0000359 | 3300037068 | Bacteria | 47371 |
| 184 | Ga0373925_0128710 | 3300037068 | Archaea | 1972 |
| 185 | Ga0395905_0075422 | 3300037471 | Unclassified | 3161 |
| 186 | Ga0436364_0403258 | 3300037853 | Bacteria | 953 |
| 187 | Ga0436360_1137586 | 3300039438 | Unclassified | 3589 |
| 188 | Ga0436361_0419896 | 3300039447 | Bacteria | 1176 |
| 189 | Ga0436361_0732496 | 3300039447 | Archaea | 793 |
| 190 | Ga0451853_2600646 | 3300041512 | Bacteria | 667 |
| 191 | Ga0466969_0019344 | 3300044656 | Bacteria | 3542 |
| 192 | Ga0466963_1012849 | 3300044694 | Unclassified | 585 |
| 193 | Ga0451576_0377069 | 3300045051 | Bacteria | 1487 |
| 194 | Ga0466967_0084136 | 3300045976 | Bacteria | 2878 |
| 195 | Ga0495592_0578076 | 3300046454 | Bacteria | 688 |
| 196 | Ga0495629_0066801 | 3300046459 | Unclassified | 2510 |
| 197 | Ga0495651_0003029 | 3300046462 | Bacteria | 12969 |
| 198 | Ga0495651_0220353 | 3300046462 | Bacteria | 1313 |
| 199 | Ga0495653_0300915 | 3300046463 | Bacteria | 1046 |
| 200 | Ga0495580_0225231 | 3300046472 | Unclassified | 1288 |
| 201 | Ga0495580_0466371 | 3300046472 | Unclassified | 846 |
| 202 | Ga0495639_0074003 | 3300046475 | Bacteria | 1578 |
| 203 | Ga0495608_0019831 | 3300046511 | Bacteria | 4625 |
| 204 | Ga0495608_0758277 | 3300046511 | Bacteria | 575 |
| 205 | Ga0495618_0014600 | 3300046514 | Unclassified | 4787 |
| 206 | Ga0495628_0098122 | 3300046516 | Bacteria | 2263 |
| 207 | Ga0495628_0194246 | 3300046516 | Bacteria | 1532 |
| 208 | Ga0495652_0104307 | 3300046529 | Bacteria | 2293 |
| 209 | Ga0495665_0245519 | 3300046531 | Unclassified | 922 |
| 210 | Ga0495586_0008895 | 3300046535 | Bacteria | 5345 |
| 211 | Ga0495645_0541873 | 3300046543 | Unclassified | 722 |
| 212 | Ga0495645_0585982 | 3300046543 | Bacteria | 688 |
| 213 | Ga0495667_0054104 | 3300046559 | Bacteria | 2642 |
| 214 | Ga0495667_0116716 | 3300046559 | Bacteria | 1724 |
| 215 | Ga0495634_0010848 | 3300046642 | Bacteria | 6660 |
| 216 | Ga0495613_0006984 | 3300046689 | Bacteria | 8414 |
| 217 | Ga0495624_0051682 | 3300046690 | Bacteria | 2599 |
| 218 | Ga0495600_0073947 | 3300046809 | Bacteria | 2225 |
| 219 | Ga0495674_0170584 | 3300047319 | Bacteria | 1816 |
| 220 | Ga0495680_0079942 | 3300047322 | Unclassified | 2471 |
| 221 | Ga0495680_0459945 | 3300047322 | Bacteria | 870 |
| 222 | Ga0495675_0251512 | 3300047444 | Bacteria | 1061 |
| 223 | Ga0495684_0053441 | 3300047471 | Bacteria | 3082 |
| 224 | Ga0495684_0394563 | 3300047471 | Bacteria | 973 |
| 225 | Ga0495602_0261183 | 3300048088 | Bacteria | 1284 |
| 226 | Ga0495602_0381098 | 3300048088 | Bacteria | 1010 |
| 227 | Ga0496100_0017472 | 3300048903 | Bacteria | 4234 |
| 228 | Ga0496101_0301649 | 3300048904 | Unclassified | 1255 |
| 229 | Ga0496115_0004099 | 3300048918 | Bacteria | 10516 |
| 230 | Ga0501033_0205963 | 3300049570 | Archaea | 1404 |
| 231 | Ga0501036_0337046 | 3300049572 | Bacteria | 1260 |
| 232 | Ga0501037_0087779 | 3300049573 | Bacteria | 2251 |
| 233 | Ga0501038_0121135 | 3300049574 | Bacteria | 2157 |
| 234 | Ga0501042_0066321 | 3300049578 | Bacteria | 2580 |
| 235 | nmdc:mga03683_56800_c1 | 3300050489 | Bacteria | 1646 |
| 236 | nmdc:mga0k408_146307_c1 | 3300050493 | Bacteria | 1407 |
| 237 | nmdc:mga05p37_408387_c1 | 3300050507 | Unclassified | 1584 |
| 238 | nmdc:mga05p37_428844_c1 | 3300050507 | Unclassified | 1536 |
| 239 | nmdc:mga05p37_499138_c1 | 3300050507 | Bacteria | 1397 |
| 240 | nmdc:mga09592_250645_c1 | 3300050508 | Bacteria | 1535 |
| 241 | nmdc:mga08y16_1615603_c1 | 3300050511 | Unclassified | 606 |
| 242 | nmdc:mga08y16_443881_c1 | 3300050511 | Archaea | 1324 |
| 243 | nmdc:mga08y16_46377_c1 | 3300050511 | Bacteria | 4550 |
| 244 | nmdc:mga0n895_1358736_c1 | 3300050512 | Archaea | 680 |
| 245 | nmdc:mga0n895_605587_c1 | 3300050512 | Bacteria | 1097 |
| 246 | nmdc:mga08x19_315565_c1 | 3300050514 | Bacteria | 1087 |
| 247 | nmdc:mga0a205_158190_c1 | 3300050515 | Archaea | 2163 |
| 248 | nmdc:mga0a205_421447_c1 | 3300050515 | Bacteria | 1197 |
| 249 | nmdc:mga0a205_45791_c1 | 3300050515 | Bacteria | 4219 |
| 250 | Ga0495612_0010767 | 3300053078 | Bacteria | 3693 |
| 251 | Ga0495619_0210638 | 3300053085 | Bacteria | 1346 |
| 252 | Ga0495619_0492089 | 3300053085 | Bacteria | 844 |
| 253 | Ga0500578_0273521 | 3300053086 | Unclassified | 1010 |
| 254 | Ga0500569_056321 | 3300053109 | Bacteria | 1202 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300039447 | Ga0436361_0732496 | Ga0436361_0732496_82_591 | 162 |
| 2 | 3300035119 | Ga0373956_0050384 | Ga0373956_0050384_291_803 | 164 |
| 3 | 3300053085 | Ga0495619_0492089 | Ga0495619_0492089_287_799 | 164 |
| 4 | 3300035086 | Ga0373934_0029721 | Ga0373934_0029721_1586_2110 | 165 |
| 5 | 3300035410 | Ga0373924_0049831 | Ga0373924_0049831_538_1053 | 165 |
| 6 | 3300046454 | Ga0495592_0578076 | Ga0495592_0578076_161_676 | 165 |
| 7 | 3300046462 | Ga0495651_0220353 | Ga0495651_0220353_642_1157 | 165 |
| 8 | 3300046511 | Ga0495608_0019831 | Ga0495608_0019831_2371_2886 | 165 |
| 9 | 3300046529 | Ga0495652_0104307 | Ga0495652_0104307_319_834 | 165 |
| 10 | 3300046559 | Ga0495667_0116716 | Ga0495667_0116716_169_684 | 165 |
| 11 | 3300047444 | Ga0495675_0251512 | Ga0495675_0251512_263_787 | 165 |
| 12 | 3300047471 | Ga0495684_0394563 | Ga0495684_0394563_279_803 | 165 |
| 13 | 3300048088 | Ga0495602_0261183 | Ga0495602_0261183_300_815 | 165 |
| 14 | 3300025922 | Ga0207646_10932082 | Ga0207646_109320821 | 166 |
| 15 | 3300049578 | Ga0501042_0066321 | Ga0501042_0066321_1269_1787 | 167 |
| 16 | 3300005439 | Ga0070711_100528581 | Ga0070711_1005285812 | 168 |
| 17 | 3300006195 | Ga0075366_10014682 | Ga0075366_100146823 | 168 |
| 18 | 3300006358 | Ga0068871_100550039 | Ga0068871_1005500392 | 168 |
| 19 | 3300025914 | Ga0207671_10793766 | Ga0207671_107937662 | 168 |
| 20 | 3300025916 | Ga0207663_10671808 | Ga0207663_106718082 | 168 |
| 21 | 3300039447 | Ga0436361_0419896 | Ga0436361_0419896_482_1009 | 168 |
| 22 | 3300041512 | Ga0451853_2600646 | Ga0451853_2600646_125_634 | 168 |
| 23 | 3300044694 | Ga0466963_1012849 | Ga0466963_1012849_50_571 | 168 |
| 24 | 3300046511 | Ga0495608_0758277 | Ga0495608_0758277_12_548 | 168 |
| 25 | 3300005467 | Ga0070706_100727166 | Ga0070706_1007271661 | 169 |
| 26 | 3300005983 | Ga0081540_1012428 | Ga0081540_10124285 | 169 |
| 27 | 3300009545 | Ga0105237_10385556 | Ga0105237_103855561 | 169 |
| 28 | 3300035692 | Ga0373935_0226510 | Ga0373935_0226510_749_1273 | 169 |
| 29 | 3300037068 | Ga0373925_0128710 | Ga0373925_0128710_1415_1933 | 169 |
| 30 | 3300050515 | nmdc:mga0a205_45791_c1 | nmdc:mga0a205_45791_c1_855_1406 | 169 |
| 31 | 3300046543 | Ga0495645_0585982 | Ga0495645_0585982_96_626 | 170 |
| 32 | iso_pu_bacteria | 2818991460 | 2819677384 | 177 |
| 33 | iso_pu_bacteria | 2884791551 | 2884797928 | 179 |
| 34 | 3300005467 | Ga0070706_100012104 | Ga0070706_1000121044 | 182 |
| 35 | 3300005471 | Ga0070698_100002470 | Ga0070698_10000247012 | 182 |
| 36 | 3300005471 | Ga0070698_100175153 | Ga0070698_1001751532 | 182 |
| 37 | 3300005518 | Ga0070699_100238853 | Ga0070699_1002388531 | 182 |
| 38 | 3300006028 | Ga0070717_10019889 | Ga0070717_100198892 | 182 |
| 39 | 3300013105 | Ga0157369_10046727 | Ga0157369_100467275 | 182 |
| 40 | 3300024225 | Ga0224572_1012016 | Ga0224572_10120162 | 182 |
| 41 | 3300025910 | Ga0207684_10046951 | Ga0207684_100469513 | 182 |
| 42 | 3300046463 | Ga0495653_0300915 | Ga0495653_0300915_398_964 | 182 |
| 43 | 3300046516 | Ga0495628_0194246 | Ga0495628_0194246_361_927 | 182 |
| 44 | 3300047322 | Ga0495680_0459945 | Ga0495680_0459945_215_781 | 182 |
| 45 | 3300003322 | rootL2_10293290 | rootL2_102932905 | 183 |
| 46 | 3300003354 | JGI25160J50197_1007034 | JGI25160J50197_10070343 | 183 |
| 47 | 3300003373 | JGI25407J50210_10108439 | JGI25407J50210_101084391 | 183 |
| 48 | 3300003771 | Ga0055526_1047133 | Ga0055526_10471332 | 183 |
| 49 | 3300003790 | Ga0055528_1000923 | Ga0055528_10009238 | 183 |
| 50 | 3300003791 | Ga0055530_10001354 | Ga0055530_100013544 | 183 |
| 51 | 3300005262 | Ga0065165_1000022 | Ga0065165_1000022158 | 183 |
| 52 | 3300005295 | Ga0065707_10227186 | Ga0065707_102271863 | 183 |
| 53 | 3300005327 | Ga0070658_10550103 | Ga0070658_105501031 | 183 |
| 54 | 3300005329 | Ga0070683_100391586 | Ga0070683_1003915862 | 183 |
| 55 | 3300005336 | Ga0070680_100164245 | Ga0070680_1001642453 | 183 |
| 56 | 3300005340 | Ga0070689_100002083 | Ga0070689_1000020836 | 183 |
| 57 | 3300005344 | Ga0070661_100006438 | Ga0070661_1000064383 | 183 |
| 58 | 3300005353 | Ga0070669_100209253 | Ga0070669_1002092532 | 183 |
| 59 | 3300005365 | Ga0070688_100020835 | Ga0070688_1000208353 | 183 |
| 60 | 3300005366 | Ga0070659_100259198 | Ga0070659_1002591981 | 183 |
| 61 | 3300005434 | Ga0070709_10544322 | Ga0070709_105443221 | 183 |
| 62 | 3300005435 | Ga0070714_100000021 | Ga0070714_10000002177 | 183 |
| 63 | 3300005439 | Ga0070711_100173515 | Ga0070711_1001735152 | 183 |
| 64 | 3300005445 | Ga0070708_100047210 | Ga0070708_1000472102 | 183 |
| 65 | 3300005455 | Ga0070663_100169324 | Ga0070663_1001693241 | 183 |
| 66 | 3300005455 | Ga0070663_100453388 | Ga0070663_1004533882 | 183 |
| 67 | 3300005467 | Ga0070706_100007206 | Ga0070706_1000072063 | 183 |
| 68 | 3300005467 | Ga0070706_100275036 | Ga0070706_1002750362 | 183 |
| 69 | 3300005468 | Ga0070707_100004183 | Ga0070707_1000041836 | 183 |
| 70 | 3300005468 | Ga0070707_100429500 | Ga0070707_1004295001 | 183 |
| 71 | 3300005468 | Ga0070707_100556085 | Ga0070707_1005560853 | 183 |
| 72 | 3300005471 | Ga0070698_100001393 | Ga0070698_10000139323 | 183 |
| 73 | 3300005471 | Ga0070698_100458355 | Ga0070698_1004583553 | 183 |
| 74 | 3300005518 | Ga0070699_100013953 | Ga0070699_1000139535 | 183 |
| 75 | 3300005518 | Ga0070699_100232820 | Ga0070699_1002328201 | 183 |
| 76 | 3300005530 | Ga0070679_100018801 | Ga0070679_1000188013 | 183 |
| 77 | 3300005530 | Ga0070679_100615805 | Ga0070679_1006158052 | 183 |
| 78 | 3300005536 | Ga0070697_100044593 | Ga0070697_1000445933 | 183 |
| 79 | 3300005536 | Ga0070697_100047664 | Ga0070697_1000476641 | 183 |
| 80 | 3300005536 | Ga0070697_100209633 | Ga0070697_1002096332 | 183 |
| 81 | 3300005536 | Ga0070697_100521739 | Ga0070697_1005217391 | 183 |
| 82 | 3300005539 | Ga0068853_100181691 | Ga0068853_1001816912 | 183 |
| 83 | 3300005563 | Ga0068855_100384507 | Ga0068855_1003845073 | 183 |
| 84 | 3300005563 | Ga0068855_100833475 | Ga0068855_1008334752 | 183 |
| 85 | 3300005577 | Ga0068857_100000725 | Ga0068857_10000072515 | 183 |
| 86 | 3300005577 | Ga0068857_100011439 | Ga0068857_1000114399 | 183 |
| 87 | 3300005578 | Ga0068854_100032649 | Ga0068854_1000326493 | 183 |
| 88 | 3300005614 | Ga0068856_100021152 | Ga0068856_1000211522 | 183 |
| 89 | 3300005614 | Ga0068856_100152117 | Ga0068856_1001521172 | 183 |
| 90 | 3300005617 | Ga0068859_100322414 | Ga0068859_1003224142 | 183 |
| 91 | 3300005617 | Ga0068859_101168518 | Ga0068859_1011685181 | 183 |
| 92 | 3300005840 | Ga0068870_10240040 | Ga0068870_102400402 | 183 |
| 93 | 3300005841 | Ga0068863_100059178 | Ga0068863_1000591781 | 183 |
| 94 | 3300005841 | Ga0068863_101313875 | Ga0068863_1013138751 | 183 |
| 95 | 3300005844 | Ga0068862_100040190 | Ga0068862_1000401905 | 183 |
| 96 | 3300005937 | Ga0081455_10014057 | Ga0081455_100140572 | 183 |
| 97 | 3300005981 | Ga0081538_10005578 | Ga0081538_1000557814 | 183 |
| 98 | 3300006028 | Ga0070717_10003911 | Ga0070717_1000391110 | 183 |
| 99 | 3300006028 | Ga0070717_10006711 | Ga0070717_100067113 | 183 |
| 100 | 3300006173 | Ga0070716_100841358 | Ga0070716_1008413581 | 183 |
| 101 | 3300006177 | Ga0075362_10051751 | Ga0075362_100517512 | 183 |
| 102 | 3300006844 | Ga0075428_100005029 | Ga0075428_10000502912 | 183 |
| 103 | 3300006844 | Ga0075428_100252456 | Ga0075428_1002524563 | 183 |
| 104 | 3300006844 | Ga0075428_100482652 | Ga0075428_1004826522 | 183 |
| 105 | 3300006852 | Ga0075433_10117421 | Ga0075433_101174212 | 183 |
| 106 | 3300006852 | Ga0075433_10439801 | Ga0075433_104398012 | 183 |
| 107 | 3300006880 | Ga0075429_100255309 | Ga0075429_1002553092 | 183 |
| 108 | 3300006931 | Ga0097620_100322393 | Ga0097620_1003223931 | 183 |
| 109 | 3300006931 | Ga0097620_101168611 | Ga0097620_1011686111 | 183 |
| 110 | 3300007788 | Ga0099795_10045744 | Ga0099795_100457441 | 183 |
| 111 | 3300009093 | Ga0105240_10047822 | Ga0105240_100478223 | 183 |
| 112 | 3300009094 | Ga0111539_10026463 | Ga0111539_100264635 | 183 |
| 113 | 3300009147 | Ga0114129_10137039 | Ga0114129_101370392 | 183 |
| 114 | 3300009147 | Ga0114129_11548083 | Ga0114129_115480832 | 183 |
| 115 | 3300009148 | Ga0105243_10457574 | Ga0105243_104575742 | 183 |
| 116 | 3300009545 | Ga0105237_10705836 | Ga0105237_107058362 | 183 |
| 117 | 3300009551 | Ga0105238_10006404 | Ga0105238_100064042 | 183 |
| 118 | 3300009551 | Ga0105238_10070301 | Ga0105238_100703012 | 183 |
| 119 | 3300009551 | Ga0105238_10486194 | Ga0105238_104861942 | 183 |
| 120 | 3300009553 | Ga0105249_10455363 | Ga0105249_104553632 | 183 |
| 121 | 3300013100 | Ga0157373_10130409 | Ga0157373_101304092 | 183 |
| 122 | 3300013100 | Ga0157373_10204600 | Ga0157373_102046002 | 183 |
| 123 | 3300013105 | Ga0157369_10047246 | Ga0157369_100472463 | 183 |
| 124 | 3300013105 | Ga0157369_10523016 | Ga0157369_105230163 | 183 |
| 125 | 3300013296 | Ga0157374_10934498 | Ga0157374_109344982 | 183 |
| 126 | 3300013306 | Ga0163162_10361501 | Ga0163162_103615013 | 183 |
| 127 | 3300013307 | Ga0157372_10003274 | Ga0157372_100032743 | 183 |
| 128 | 3300013307 | Ga0157372_10023212 | Ga0157372_100232127 | 183 |
| 129 | 3300014326 | Ga0157380_10127728 | Ga0157380_101277282 | 183 |
| 130 | 3300021361 | Ga0213872_10002606 | Ga0213872_100026069 | 183 |
| 131 | 3300021388 | Ga0213875_10254656 | Ga0213875_102546561 | 183 |
| 132 | 3300025208 | Ga0209436_100829 | Ga0209436_10082911 | 183 |
| 133 | 3300025273 | Ga0209673_1000517 | Ga0209673_100051745 | 183 |
| 134 | 3300025295 | Ga0209564_1003520 | Ga0209564_10035202 | 183 |
| 135 | 3300025295 | Ga0209564_1017898 | Ga0209564_10178982 | 183 |
| 136 | 3300025298 | Ga0209050_1001100 | Ga0209050_100110014 | 183 |
| 137 | 3300025302 | Ga0207426_1000057 | Ga0207426_1000057250 | 183 |
| 138 | 3300025302 | Ga0207426_1039446 | Ga0207426_10394463 | 183 |
| 139 | 3300025303 | Ga0209051_1054571 | Ga0209051_10545712 | 183 |
| 140 | 3300025304 | Ga0209257_1001984 | Ga0209257_100198413 | 183 |
| 141 | 3300025321 | Ga0207656_10303240 | Ga0207656_103032401 | 183 |
| 142 | 3300025904 | Ga0207647_10013246 | Ga0207647_100132464 | 183 |
| 143 | 3300025908 | Ga0207643_10225837 | Ga0207643_102258372 | 183 |
| 144 | 3300025909 | Ga0207705_10000839 | Ga0207705_1000083918 | 183 |
| 145 | 3300025910 | Ga0207684_10028618 | Ga0207684_100286185 | 183 |
| 146 | 3300025910 | Ga0207684_10036708 | Ga0207684_100367082 | 183 |
| 147 | 3300025910 | Ga0207684_10102086 | Ga0207684_101020863 | 183 |
| 148 | 3300025912 | Ga0207707_10125927 | Ga0207707_101259273 | 183 |
| 149 | 3300025913 | Ga0207695_10059443 | Ga0207695_100594434 | 183 |
| 150 | 3300025914 | Ga0207671_10563813 | Ga0207671_105638131 | 183 |
| 151 | 3300025916 | Ga0207663_10080903 | Ga0207663_100809032 | 183 |
| 152 | 3300025919 | Ga0207657_10021071 | Ga0207657_100210716 | 183 |
| 153 | 3300025920 | Ga0207649_10186061 | Ga0207649_101860612 | 183 |
| 154 | 3300025921 | Ga0207652_10034520 | Ga0207652_100345204 | 183 |
| 155 | 3300025922 | Ga0207646_10021960 | Ga0207646_100219602 | 183 |
| 156 | 3300025923 | Ga0207681_10193337 | Ga0207681_101933372 | 183 |
| 157 | 3300025924 | Ga0207694_10092410 | Ga0207694_100924102 | 183 |
| 158 | 3300025924 | Ga0207694_10175774 | Ga0207694_101757741 | 183 |
| 159 | 3300025929 | Ga0207664_10000005 | Ga0207664_1000000557 | 183 |
| 160 | 3300025936 | Ga0207670_10001691 | Ga0207670_100016914 | 183 |
| 161 | 3300025939 | Ga0207665_10347409 | Ga0207665_103474092 | 183 |
| 162 | 3300025949 | Ga0207667_10123197 | Ga0207667_101231972 | 183 |
| 163 | 3300025949 | Ga0207667_10774328 | Ga0207667_107743282 | 183 |
| 164 | 3300025961 | Ga0207712_10792901 | Ga0207712_107929011 | 183 |
| 165 | 3300025981 | Ga0207640_10751121 | Ga0207640_107511212 | 183 |
| 166 | 3300026041 | Ga0207639_10869908 | Ga0207639_108699081 | 183 |
| 167 | 3300026067 | Ga0207678_10001060 | Ga0207678_100010604 | 183 |
| 168 | 3300026078 | Ga0207702_10052666 | Ga0207702_100526662 | 183 |
| 169 | 3300026088 | Ga0207641_10081385 | Ga0207641_100813852 | 183 |
| 170 | 3300026116 | Ga0207674_10001330 | Ga0207674_1000133018 | 183 |
| 171 | 3300026116 | Ga0207674_10008885 | Ga0207674_100088852 | 183 |
| 172 | 3300026142 | Ga0207698_10594233 | Ga0207698_105942331 | 183 |
| 173 | 3300027907 | Ga0207428_10012223 | Ga0207428_100122235 | 183 |
| 174 | 3300028380 | Ga0268265_10125277 | Ga0268265_101252772 | 183 |
| 175 | 3300031251 | Ga0265327_10035773 | Ga0265327_100357733 | 183 |
| 176 | 3300031507 | Ga0307509_10009629 | Ga0307509_1000962914 | 183 |
| 177 | 3300035119 | Ga0373956_0021865 | Ga0373956_0021865_299_880 | 183 |
| 178 | 3300035170 | Ga0373943_0144382 | Ga0373943_0144382_308_868 | 183 |
| 179 | 3300035724 | Ga0373933_0056585 | Ga0373933_0056585_385_966 | 183 |
| 180 | 3300035725 | Ga0373947_0289247 | Ga0373947_0289247_439_999 | 183 |
| 181 | 3300037853 | Ga0436364_0403258 | Ga0436364_0403258_17_571 | 183 |
| 182 | 3300044656 | Ga0466969_0019344 | Ga0466969_0019344_1181_1762 | 183 |
| 183 | 3300045976 | Ga0466967_0084136 | Ga0466967_0084136_2176_2730 | 183 |
| 184 | 3300046459 | Ga0495629_0066801 | Ga0495629_0066801_1080_1649 | 183 |
| 185 | 3300046462 | Ga0495651_0003029 | Ga0495651_0003029_8458_9063 | 183 |
| 186 | 3300046472 | Ga0495580_0225231 | Ga0495580_0225231_719_1276 | 183 |
| 187 | 3300046472 | Ga0495580_0466371 | Ga0495580_0466371_193_762 | 183 |
| 188 | 3300046475 | Ga0495639_0074003 | Ga0495639_0074003_253_834 | 183 |
| 189 | 3300046514 | Ga0495618_0014600 | Ga0495618_0014600_4094_4675 | 183 |
| 190 | 3300046516 | Ga0495628_0098122 | Ga0495628_0098122_375_980 | 183 |
| 191 | 3300046531 | Ga0495665_0245519 | Ga0495665_0245519_306_863 | 183 |
| 192 | 3300046535 | Ga0495586_0008895 | Ga0495586_0008895_4181_4762 | 183 |
| 193 | 3300046543 | Ga0495645_0541873 | Ga0495645_0541873_51_656 | 183 |
| 194 | 3300046559 | Ga0495667_0054104 | Ga0495667_0054104_406_987 | 183 |
| 195 | 3300046642 | Ga0495634_0010848 | Ga0495634_0010848_667_1248 | 183 |
| 196 | 3300046689 | Ga0495613_0006984 | Ga0495613_0006984_5563_6144 | 183 |
| 197 | 3300046809 | Ga0495600_0073947 | Ga0495600_0073947_213_818 | 183 |
| 198 | 3300047319 | Ga0495674_0170584 | Ga0495674_0170584_541_1122 | 183 |
| 199 | 3300047322 | Ga0495680_0079942 | Ga0495680_0079942_1502_2083 | 183 |
| 200 | 3300047471 | Ga0495684_0053441 | Ga0495684_0053441_651_1232 | 183 |
| 201 | 3300048088 | Ga0495602_0381098 | Ga0495602_0381098_374_979 | 183 |
| 202 | 3300048918 | Ga0496115_0004099 | Ga0496115_0004099_9446_10027 | 183 |
| 203 | 3300049570 | Ga0501033_0205963 | Ga0501033_0205963_369_920 | 183 |
| 204 | 3300049572 | Ga0501036_0337046 | Ga0501036_0337046_599_1150 | 183 |
| 205 | 3300049573 | Ga0501037_0087779 | Ga0501037_0087779_1461_2012 | 183 |
| 206 | 3300049574 | Ga0501038_0121135 | Ga0501038_0121135_421_972 | 183 |
| 207 | 3300050489 | nmdc:mga03683_56800_c1 | nmdc:mga03683_56800_c1_426_995 | 183 |
| 208 | 3300050493 | nmdc:mga0k408_146307_c1 | nmdc:mga0k408_146307_c1_650_1219 | 183 |
| 209 | 3300050507 | nmdc:mga05p37_408387_c1 | nmdc:mga05p37_408387_c1_822_1373 | 183 |
| 210 | 3300050508 | nmdc:mga09592_250645_c1 | nmdc:mga09592_250645_c1_371_949 | 183 |
| 211 | 3300050511 | nmdc:mga08y16_1615603_c1 | nmdc:mga08y16_1615603_c1_25_582 | 183 |
| 212 | 3300050511 | nmdc:mga08y16_443881_c1 | nmdc:mga08y16_443881_c1_21_581 | 183 |
| 213 | 3300050511 | nmdc:mga08y16_46377_c1 | nmdc:mga08y16_46377_c1_2955_3533 | 183 |
| 214 | 3300050515 | nmdc:mga0a205_158190_c1 | nmdc:mga0a205_158190_c1_933_1487 | 183 |
| 215 | 3300050515 | nmdc:mga0a205_421447_c1 | nmdc:mga0a205_421447_c1_178_756 | 183 |
| 216 | 3300053078 | Ga0495612_0010767 | Ga0495612_0010767_609_1214 | 183 |
| 217 | 3300053085 | Ga0495619_0210638 | Ga0495619_0210638_655_1260 | 183 |
| 218 | 3300053109 | Ga0500569_056321 | Ga0500569_056321_575_1126 | 183 |
| 219 | 3300005439 | Ga0070711_100833400 | Ga0070711_1008334001 | 184 |
| 220 | 3300009147 | Ga0114129_10627101 | Ga0114129_106271011 | 184 |
| 221 | 3300050507 | nmdc:mga05p37_499138_c1 | nmdc:mga05p37_499138_c1_74_661 | 184 |
| 222 | 3300050512 | nmdc:mga0n895_1358736_c1 | nmdc:mga0n895_1358736_c1_78_665 | 184 |
| 223 | 3300050514 | nmdc:mga08x19_315565_c1 | nmdc:mga08x19_315565_c1_187_759 | 185 |
| 224 | 3300037471 | Ga0395905_0075422 | Ga0395905_0075422_1926_2495 | 186 |
| 225 | 3300005539 | Ga0068853_100000001 | Ga0068853_100000001411 | 187 |
| 226 | 3300005577 | Ga0068857_100010554 | Ga0068857_1000105544 | 187 |
| 227 | 3300026041 | Ga0207639_10000001 | Ga0207639_10000001756 | 187 |
| 228 | 3300026116 | Ga0207674_10016612 | Ga0207674_100166124 | 187 |
| 229 | 3300003320 | rootH2_10168541 | rootH2_101685412 | 188 |
| 230 | 3300005295 | Ga0065707_10354954 | Ga0065707_103549542 | 188 |
| 231 | 3300045051 | Ga0451576_0377069 | Ga0451576_0377069_841_1431 | 188 |
| 232 | 3300013104 | Ga0157370_10120581 | Ga0157370_101205812 | 189 |
| 233 | 3300005355 | Ga0070671_100216463 | Ga0070671_1002164632 | 190 |
| 234 | 3300013306 | Ga0163162_10605091 | Ga0163162_106050912 | 190 |
| 235 | 3300025931 | Ga0207644_10182174 | Ga0207644_101821742 | 190 |
| 236 | 3300021441 | Ga0213871_10002790 | Ga0213871_100027903 | 191 |
| 237 | 3300039438 | Ga0436360_1137586 | Ga0436360_1137586_2965_3558 | 191 |
| 238 | 3300048903 | Ga0496100_0017472 | Ga0496100_0017472_379_963 | 191 |
| 239 | 3300048904 | Ga0496101_0301649 | Ga0496101_0301649_309_893 | 191 |
| 240 | 3300053086 | Ga0500578_0273521 | Ga0500578_0273521_67_657 | 195 |
| 241 | 3300050512 | nmdc:mga0n895_605587_c1 | nmdc:mga0n895_605587_c1_97_702 | 196 |
| 242 | 3300005937 | Ga0081455_10397927 | Ga0081455_103979272 | 198 |
| 243 | 3300006914 | Ga0075436_100023439 | Ga0075436_1000234392 | 198 |
| 244 | 3300009147 | Ga0114129_10862666 | Ga0114129_108626662 | 198 |
| 245 | 3300035083 | Ga0373926_0000776 | Ga0373926_0000776_5393_6004 | 198 |
| 246 | 3300035171 | Ga0373946_0009203 | Ga0373946_0009203_514_1125 | 198 |
| 247 | 3300035695 | Ga0373927_0000272 | Ga0373927_0000272_9902_10513 | 198 |
| 248 | 3300037068 | Ga0373925_0000359 | Ga0373925_0000359_14976_15587 | 198 |
| 249 | 3300046690 | Ga0495624_0051682 | Ga0495624_0051682_481_1092 | 198 |
| 250 | 3300050507 | nmdc:mga05p37_428844_c1 | nmdc:mga05p37_428844_c1_500_1129 | 198 |
| 251 | 3300001989 | JGI24739J22299_10005343 | JGI24739J22299_100053434 | 199 |
| 252 | 3300003215 | JGI25153J46596_10006489 | JGI25153J46596_100064892 | 199 |
| 253 | 3300005578 | Ga0068854_100098740 | Ga0068854_1000987402 | 199 |
| 254 | 3300025297 | Ga0209758_1002857 | Ga0209758_10028578 | 199 |
| 255 | 3300025297 | Ga0209758_1022633 | Ga0209758_10226334 | 199 |
| 256 | 3300025981 | Ga0207640_10079793 | Ga0207640_100797932 | 199 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2gmy-assembly1.cif.gz_C | crystal structure of a protein of unknown function atu0492 from agrobacterium tumefaciens, putative antioxidant defence protein ahpd | 0.9271 | 52 | 189 |
| 7xw1-assembly1.cif.gz_A | the crystal structure of ahpd from pseudomonas aeruginosa | 0.9037 | 58 | 184 |
| 2ijc-assembly2.cif.gz_I | structure of a conserved protein of unknown function pa0269 from pseudomonas aeruginosa | 0.903 | 54 | 190 |
| 2gmy-assembly1.cif.gz_C | crystal structure of a protein of unknown function atu0492 from agrobacterium tumefaciens, putative antioxidant defence protein ahpd | 0.8733 | 52 | 189 |
| 3lvy-assembly3.cif.gz_E | crystal structure of carboxymuconolactone decarboxylase family protein smu.961 from streptococcus mutans | 0.86 | 29 | 190 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2gmyF00 | Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like | 0.9278 | 52 | 189 | 1.20.1290.10 |
| af_O53905_23_180_1.20.1290.10 | Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like | 0.9104 | 76 | 190 | 1.20.1290.10 |
| af_Q2FVE0_2_139_1.20.1290.10 | Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like | 0.9096 | 62 | 186 | 1.20.1290.10 |
| 2ijcF00 | Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like | 0.8841 | 56 | 184 | 1.20.1290.10 |
| af_O53377_388_550_1.20.1290.10 | Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like | 0.8805 | 33 | 192 | 1.20.1290.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V9QL28-F1-model_v4 | Carboxymuconolactone decarboxylase family protein | 0.9873 | 47 | 198 |
|
| AF-A0A1D7UUI6-F1-model_v4 | Carboxymuconolactone decarboxylase-like domain-containing protein | 0.9845 | 18 | 191 |
|
| AF-A0A6A7MID7-F1-model_v4 | deleted | 0.98 | 19 | 198 |
|
| AF-A0A4Q5S8C7-F1-model_v4 | Carboxymuconolactone decarboxylase family protein | 0.9793 | 18 | 196 |
|
| AF-A0A5E8A911-F1-model_v4 | Alkylhydroperoxidase AhpD family core domain-containing protein | 0.974 | 21 | 198 |
GO:0004601
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar