F366311

General Info

Members Datasets Scaffolds Average Seq Length
256 177 254 187

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100238853|Ga0070699_1002388531
Length 203
Sequence VTPYLPPVDKPRGLVLRLVYFFTRRQFGKVPTPIAVHSARMPTAFLSFYGKVSRLDKKLELPADIAMLVRERVASVNSCLFCMDSQRWYVQHKSPDNLARLDALPEYQTSPLFTDGERAALDYATELTRDKHVAPETFARMRRHYSEREICDIVWLVASEHLYNMTNHGLNIGSDGLCELRAAPSATATKDGPSRPAARARQA

Samples

Sample ID Description Type Environment
1 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
2 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
11 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
72 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
73 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
74 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
75 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
76 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
79 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
81 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
114 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
115 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
116 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
117 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
118 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
119 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
120 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
121 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
122 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
123 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
124 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
125 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
128 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
129 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
130 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
131 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
132 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
133 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
134 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
135 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
136 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
137 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
138 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
139 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
140 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
141 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
142 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
143 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
144 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
145 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
146 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
147 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
148 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
149 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
150 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
151 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
152 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
153 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
154 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
155 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
156 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
157 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
158 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
161 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
166 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
167 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
168 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
169 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
170 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
171 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
172 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
173 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
174 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
175 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
176 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
177 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.22
Metatranscriptomes 0
Isolates 0.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.98
Nodule 0
Rhizoplane 1.17
Rhizosphere 86.72
Stem 0
Stem Tuber 0
Unclassified 3.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10005343 3300001989 Unclassified 4891
2 JGI25153J46596_10006489 3300003215 Bacteria 5901
3 rootH2_10168541 3300003320 Bacteria 1477
4 rootL2_10293290 3300003322 Unclassified 4324
5 JGI25160J50197_1007034 3300003354 Bacteria 4455
6 JGI25407J50210_10108439 3300003373 Bacteria 685
7 Ga0055526_1047133 3300003771 Bacteria 1015
8 Ga0055528_1000923 3300003790 Bacteria 19651
9 Ga0055530_10001354 3300003791 Bacteria 18212
10 Ga0065165_1000022 3300005262 Bacteria 253404
11 Ga0065707_10227186 3300005295 Unclassified 1202
12 Ga0065707_10354954 3300005295 Archaea 855
13 Ga0070658_10550103 3300005327 Bacteria 999
14 Ga0070683_100391586 3300005329 Bacteria 1325
15 Ga0070680_100164245 3300005336 Bacteria 1867
16 Ga0070689_100002083 3300005340 Bacteria 12991
17 Ga0070661_100006438 3300005344 Bacteria 8095
18 Ga0070669_100209253 3300005353 Bacteria 1538
19 Ga0070671_100216463 3300005355 Bacteria 1625
20 Ga0070688_100020835 3300005365 Unclassified 3820
21 Ga0070659_100259198 3300005366 Bacteria 1442
22 Ga0070709_10544322 3300005434 Unclassified 887
23 Ga0070714_100000021 3300005435 Bacteria 165681
24 Ga0070711_100173515 3300005439 Unclassified 1645
25 Ga0070711_100528581 3300005439 Archaea 976
26 Ga0070711_100833400 3300005439 Bacteria 784
27 Ga0070708_100047210 3300005445 Bacteria 3803
28 Ga0070663_100169324 3300005455 Bacteria 1687
29 Ga0070663_100453388 3300005455 Bacteria 1057
30 Ga0070706_100007206 3300005467 Bacteria 10450
31 Ga0070706_100012104 3300005467 Bacteria 8005
32 Ga0070706_100275036 3300005467 Bacteria 1571
33 Ga0070706_100727166 3300005467 Bacteria 920
34 Ga0070707_100004183 3300005468 Bacteria 13526
35 Ga0070707_100429500 3300005468 Bacteria 1281
36 Ga0070707_100556085 3300005468 Archaea 1110
37 Ga0070698_100001393 3300005471 Bacteria 26762
38 Ga0070698_100002470 3300005471 Bacteria 20404
39 Ga0070698_100175153 3300005471 Bacteria 2085
40 Ga0070698_100458355 3300005471 Archaea 1211
41 Ga0070699_100013953 3300005518 Bacteria 6911
42 Ga0070699_100232820 3300005518 Unclassified 1643
43 Ga0070699_100238853 3300005518 Bacteria 1621
44 Ga0070679_100018801 3300005530 Bacteria 6708
45 Ga0070679_100615805 3300005530 Unclassified 1029
46 Ga0070697_100044593 3300005536 Bacteria 3592
47 Ga0070697_100047664 3300005536 Unclassified 3474
48 Ga0070697_100209633 3300005536 Unclassified 1659
49 Ga0070697_100521739 3300005536 Bacteria 1040
50 Ga0068853_100000001 3300005539 Bacteria 715840
51 Ga0068853_100181691 3300005539 Unclassified 1908
52 Ga0068855_100384507 3300005563 Unclassified 1540
53 Ga0068855_100833475 3300005563 Bacteria 978
54 Ga0068857_100000725 3300005577 Bacteria 24603
55 Ga0068857_100010554 3300005577 Bacteria 8031
56 Ga0068857_100011439 3300005577 Bacteria 7721
57 Ga0068854_100032649 3300005578 Bacteria 3624
58 Ga0068854_100098740 3300005578 Bacteria 2186
59 Ga0068856_100021152 3300005614 Bacteria 6322
60 Ga0068856_100152117 3300005614 Bacteria 2323
61 Ga0068859_100322414 3300005617 Bacteria 1639
62 Ga0068859_101168518 3300005617 Unclassified 847
63 Ga0068870_10240040 3300005840 Bacteria 1118
64 Ga0068863_100059178 3300005841 Unclassified 3625
65 Ga0068863_101313875 3300005841 Unclassified 730
66 Ga0068862_100040190 3300005844 Bacteria 3976
67 Ga0081455_10014057 3300005937 Bacteria 7868
68 Ga0081455_10397927 3300005937 Unclassified 957
69 Ga0081538_10005578 3300005981 Bacteria 11300
70 Ga0081540_1012428 3300005983 Bacteria 5607
71 Ga0070717_10003911 3300006028 Bacteria 10720
72 Ga0070717_10006711 3300006028 Bacteria 8487
73 Ga0070717_10019889 3300006028 Bacteria 5272
74 Ga0070716_100841358 3300006173 Archaea 714
75 Ga0075362_10051751 3300006177 Bacteria 1839
76 Ga0075366_10014682 3300006195 Unclassified 4477
77 Ga0068871_100550039 3300006358 Bacteria 1045
78 Ga0075428_100005029 3300006844 Bacteria 14691
79 Ga0075428_100252456 3300006844 Bacteria 1900
80 Ga0075428_100482652 3300006844 Unclassified 1326
81 Ga0075433_10117421 3300006852 Bacteria 2360
82 Ga0075433_10439801 3300006852 Bacteria 1150
83 Ga0075429_100255309 3300006880 Bacteria 1535
84 Ga0075436_100023439 3300006914 Bacteria 4240
85 Ga0097620_100322393 3300006931 Bacteria 1639
86 Ga0097620_101168611 3300006931 Unclassified 847
87 Ga0099795_10045744 3300007788 Unclassified 1575
88 Ga0105240_10047822 3300009093 Bacteria 5410
89 Ga0111539_10026463 3300009094 Bacteria 7091
90 Ga0114129_10137039 3300009147 Unclassified 3358
91 Ga0114129_10627101 3300009147 Bacteria 1390
92 Ga0114129_10862666 3300009147 Unclassified 1150
93 Ga0114129_11548083 3300009147 Bacteria 813
94 Ga0105243_10457574 3300009148 Bacteria 1199
95 Ga0105237_10385556 3300009545 Bacteria 1406
96 Ga0105237_10705836 3300009545 Bacteria 1015
97 Ga0105238_10006404 3300009551 Bacteria 11711
98 Ga0105238_10070301 3300009551 Bacteria 3499
99 Ga0105238_10486194 3300009551 Bacteria 1234
100 Ga0105249_10455363 3300009553 Bacteria 1319
101 Ga0157373_10130409 3300013100 Bacteria 1768
102 Ga0157373_10204600 3300013100 Bacteria 1392
103 Ga0157370_10120581 3300013104 Bacteria 2448
104 Ga0157369_10046727 3300013105 Bacteria 4704
105 Ga0157369_10047246 3300013105 Bacteria 4676
106 Ga0157369_10523016 3300013105 Bacteria 1227
107 Ga0157374_10934498 3300013296 Bacteria 885
108 Ga0163162_10361501 3300013306 Bacteria 1585
109 Ga0163162_10605091 3300013306 Bacteria 1222
110 Ga0157372_10003274 3300013307 Bacteria 17504
111 Ga0157372_10023212 3300013307 Bacteria 6721
112 Ga0157380_10127728 3300014326 Bacteria 2164
113 Ga0213872_10002606 3300021361 Bacteria 10483
114 Ga0213875_10254656 3300021388 Bacteria 828
115 Ga0213871_10002790 3300021441 Unclassified 3269
116 Ga0224572_1012016 3300024225 Unclassified 1642
117 Ga0209436_100829 3300025208 Bacteria 12536
118 Ga0209673_1000517 3300025273 Bacteria 63164
119 Ga0209564_1003520 3300025295 Bacteria 10578
120 Ga0209564_1017898 3300025295 Unclassified 2732
121 Ga0209758_1002857 3300025297 Bacteria 16764
122 Ga0209758_1022633 3300025297 Bacteria 2871
123 Ga0209050_1001100 3300025298 Bacteria 32780
124 Ga0207426_1000057 3300025302 Bacteria 369548
125 Ga0207426_1039446 3300025302 Bacteria 1479
126 Ga0209051_1054571 3300025303 Bacteria 1303
127 Ga0209257_1001984 3300025304 Bacteria 22002
128 Ga0207656_10303240 3300025321 Bacteria 791
129 Ga0207647_10013246 3300025904 Bacteria 5722
130 Ga0207643_10225837 3300025908 Bacteria 1147
131 Ga0207705_10000839 3300025909 Bacteria 25170
132 Ga0207684_10028618 3300025910 Bacteria 4748
133 Ga0207684_10036708 3300025910 Bacteria 4159
134 Ga0207684_10046951 3300025910 Bacteria 3663
135 Ga0207684_10102086 3300025910 Archaea 2452
136 Ga0207707_10125927 3300025912 Unclassified 2240
137 Ga0207695_10059443 3300025913 Bacteria 3963
138 Ga0207671_10563813 3300025914 Unclassified 908
139 Ga0207671_10793766 3300025914 Archaea 751
140 Ga0207663_10080903 3300025916 Bacteria 2126
141 Ga0207663_10671808 3300025916 Archaea 819
142 Ga0207657_10021071 3300025919 Bacteria 6144
143 Ga0207649_10186061 3300025920 Bacteria 1457
144 Ga0207652_10034520 3300025921 Bacteria 4263
145 Ga0207646_10021960 3300025922 Bacteria 5887
146 Ga0207646_10932082 3300025922 Archaea 769
147 Ga0207681_10193337 3300025923 Bacteria 1558
148 Ga0207694_10092410 3300025924 Bacteria 2388
149 Ga0207694_10175774 3300025924 Bacteria 1735
150 Ga0207664_10000005 3300025929 Bacteria 485048
151 Ga0207644_10182174 3300025931 Bacteria 1647
152 Ga0207670_10001691 3300025936 Bacteria 11502
153 Ga0207665_10347409 3300025939 Bacteria 1119
154 Ga0207667_10123197 3300025949 Bacteria 2671
155 Ga0207667_10774328 3300025949 Bacteria 958
156 Ga0207712_10792901 3300025961 Bacteria 832
157 Ga0207640_10079793 3300025981 Bacteria 2232
158 Ga0207640_10751121 3300025981 Unclassified 841
159 Ga0207639_10000001 3300026041 Bacteria 1431562
160 Ga0207639_10869908 3300026041 Bacteria 842
161 Ga0207678_10001060 3300026067 Bacteria 25172
162 Ga0207702_10052666 3300026078 Bacteria 3444
163 Ga0207641_10081385 3300026088 Unclassified 2812
164 Ga0207674_10001330 3300026116 Bacteria 32057
165 Ga0207674_10008885 3300026116 Bacteria 11556
166 Ga0207674_10016612 3300026116 Bacteria 8047
167 Ga0207698_10594233 3300026142 Bacteria 1090
168 Ga0207428_10012223 3300027907 Bacteria 7551
169 Ga0268265_10125277 3300028380 Bacteria 2125
170 Ga0265327_10035773 3300031251 Bacteria 2740
171 Ga0307509_10009629 3300031507 Bacteria 12015
172 Ga0373926_0000776 3300035083 Bacteria 8963
173 Ga0373934_0029721 3300035086 Bacteria 2135
174 Ga0373956_0021865 3300035119 Bacteria 2731
175 Ga0373956_0050384 3300035119 Bacteria 1869
176 Ga0373943_0144382 3300035170 Archaea 1285
177 Ga0373946_0009203 3300035171 Unclassified 3634
178 Ga0373924_0049831 3300035410 Bacteria 1734
179 Ga0373935_0226510 3300035692 Unclassified 1300
180 Ga0373927_0000272 3300035695 Bacteria 40698
181 Ga0373933_0056585 3300035724 Bacteria 2355
182 Ga0373947_0289247 3300035725 Archaea 1091
183 Ga0373925_0000359 3300037068 Bacteria 47371
184 Ga0373925_0128710 3300037068 Archaea 1972
185 Ga0395905_0075422 3300037471 Unclassified 3161
186 Ga0436364_0403258 3300037853 Bacteria 953
187 Ga0436360_1137586 3300039438 Unclassified 3589
188 Ga0436361_0419896 3300039447 Bacteria 1176
189 Ga0436361_0732496 3300039447 Archaea 793
190 Ga0451853_2600646 3300041512 Bacteria 667
191 Ga0466969_0019344 3300044656 Bacteria 3542
192 Ga0466963_1012849 3300044694 Unclassified 585
193 Ga0451576_0377069 3300045051 Bacteria 1487
194 Ga0466967_0084136 3300045976 Bacteria 2878
195 Ga0495592_0578076 3300046454 Bacteria 688
196 Ga0495629_0066801 3300046459 Unclassified 2510
197 Ga0495651_0003029 3300046462 Bacteria 12969
198 Ga0495651_0220353 3300046462 Bacteria 1313
199 Ga0495653_0300915 3300046463 Bacteria 1046
200 Ga0495580_0225231 3300046472 Unclassified 1288
201 Ga0495580_0466371 3300046472 Unclassified 846
202 Ga0495639_0074003 3300046475 Bacteria 1578
203 Ga0495608_0019831 3300046511 Bacteria 4625
204 Ga0495608_0758277 3300046511 Bacteria 575
205 Ga0495618_0014600 3300046514 Unclassified 4787
206 Ga0495628_0098122 3300046516 Bacteria 2263
207 Ga0495628_0194246 3300046516 Bacteria 1532
208 Ga0495652_0104307 3300046529 Bacteria 2293
209 Ga0495665_0245519 3300046531 Unclassified 922
210 Ga0495586_0008895 3300046535 Bacteria 5345
211 Ga0495645_0541873 3300046543 Unclassified 722
212 Ga0495645_0585982 3300046543 Bacteria 688
213 Ga0495667_0054104 3300046559 Bacteria 2642
214 Ga0495667_0116716 3300046559 Bacteria 1724
215 Ga0495634_0010848 3300046642 Bacteria 6660
216 Ga0495613_0006984 3300046689 Bacteria 8414
217 Ga0495624_0051682 3300046690 Bacteria 2599
218 Ga0495600_0073947 3300046809 Bacteria 2225
219 Ga0495674_0170584 3300047319 Bacteria 1816
220 Ga0495680_0079942 3300047322 Unclassified 2471
221 Ga0495680_0459945 3300047322 Bacteria 870
222 Ga0495675_0251512 3300047444 Bacteria 1061
223 Ga0495684_0053441 3300047471 Bacteria 3082
224 Ga0495684_0394563 3300047471 Bacteria 973
225 Ga0495602_0261183 3300048088 Bacteria 1284
226 Ga0495602_0381098 3300048088 Bacteria 1010
227 Ga0496100_0017472 3300048903 Bacteria 4234
228 Ga0496101_0301649 3300048904 Unclassified 1255
229 Ga0496115_0004099 3300048918 Bacteria 10516
230 Ga0501033_0205963 3300049570 Archaea 1404
231 Ga0501036_0337046 3300049572 Bacteria 1260
232 Ga0501037_0087779 3300049573 Bacteria 2251
233 Ga0501038_0121135 3300049574 Bacteria 2157
234 Ga0501042_0066321 3300049578 Bacteria 2580
235 nmdc:mga03683_56800_c1 3300050489 Bacteria 1646
236 nmdc:mga0k408_146307_c1 3300050493 Bacteria 1407
237 nmdc:mga05p37_408387_c1 3300050507 Unclassified 1584
238 nmdc:mga05p37_428844_c1 3300050507 Unclassified 1536
239 nmdc:mga05p37_499138_c1 3300050507 Bacteria 1397
240 nmdc:mga09592_250645_c1 3300050508 Bacteria 1535
241 nmdc:mga08y16_1615603_c1 3300050511 Unclassified 606
242 nmdc:mga08y16_443881_c1 3300050511 Archaea 1324
243 nmdc:mga08y16_46377_c1 3300050511 Bacteria 4550
244 nmdc:mga0n895_1358736_c1 3300050512 Archaea 680
245 nmdc:mga0n895_605587_c1 3300050512 Bacteria 1097
246 nmdc:mga08x19_315565_c1 3300050514 Bacteria 1087
247 nmdc:mga0a205_158190_c1 3300050515 Archaea 2163
248 nmdc:mga0a205_421447_c1 3300050515 Bacteria 1197
249 nmdc:mga0a205_45791_c1 3300050515 Bacteria 4219
250 Ga0495612_0010767 3300053078 Bacteria 3693
251 Ga0495619_0210638 3300053085 Bacteria 1346
252 Ga0495619_0492089 3300053085 Bacteria 844
253 Ga0500578_0273521 3300053086 Unclassified 1010
254 Ga0500569_056321 3300053109 Bacteria 1202

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039447 Ga0436361_0732496 Ga0436361_0732496_82_591 162
2 3300035119 Ga0373956_0050384 Ga0373956_0050384_291_803 164
3 3300053085 Ga0495619_0492089 Ga0495619_0492089_287_799 164
4 3300035086 Ga0373934_0029721 Ga0373934_0029721_1586_2110 165
5 3300035410 Ga0373924_0049831 Ga0373924_0049831_538_1053 165
6 3300046454 Ga0495592_0578076 Ga0495592_0578076_161_676 165
7 3300046462 Ga0495651_0220353 Ga0495651_0220353_642_1157 165
8 3300046511 Ga0495608_0019831 Ga0495608_0019831_2371_2886 165
9 3300046529 Ga0495652_0104307 Ga0495652_0104307_319_834 165
10 3300046559 Ga0495667_0116716 Ga0495667_0116716_169_684 165
11 3300047444 Ga0495675_0251512 Ga0495675_0251512_263_787 165
12 3300047471 Ga0495684_0394563 Ga0495684_0394563_279_803 165
13 3300048088 Ga0495602_0261183 Ga0495602_0261183_300_815 165
14 3300025922 Ga0207646_10932082 Ga0207646_109320821 166
15 3300049578 Ga0501042_0066321 Ga0501042_0066321_1269_1787 167
16 3300005439 Ga0070711_100528581 Ga0070711_1005285812 168
17 3300006195 Ga0075366_10014682 Ga0075366_100146823 168
18 3300006358 Ga0068871_100550039 Ga0068871_1005500392 168
19 3300025914 Ga0207671_10793766 Ga0207671_107937662 168
20 3300025916 Ga0207663_10671808 Ga0207663_106718082 168
21 3300039447 Ga0436361_0419896 Ga0436361_0419896_482_1009 168
22 3300041512 Ga0451853_2600646 Ga0451853_2600646_125_634 168
23 3300044694 Ga0466963_1012849 Ga0466963_1012849_50_571 168
24 3300046511 Ga0495608_0758277 Ga0495608_0758277_12_548 168
25 3300005467 Ga0070706_100727166 Ga0070706_1007271661 169
26 3300005983 Ga0081540_1012428 Ga0081540_10124285 169
27 3300009545 Ga0105237_10385556 Ga0105237_103855561 169
28 3300035692 Ga0373935_0226510 Ga0373935_0226510_749_1273 169
29 3300037068 Ga0373925_0128710 Ga0373925_0128710_1415_1933 169
30 3300050515 nmdc:mga0a205_45791_c1 nmdc:mga0a205_45791_c1_855_1406 169
31 3300046543 Ga0495645_0585982 Ga0495645_0585982_96_626 170
32 iso_pu_bacteria 2818991460 2819677384 177
33 iso_pu_bacteria 2884791551 2884797928 179
34 3300005467 Ga0070706_100012104 Ga0070706_1000121044 182
35 3300005471 Ga0070698_100002470 Ga0070698_10000247012 182
36 3300005471 Ga0070698_100175153 Ga0070698_1001751532 182
37 3300005518 Ga0070699_100238853 Ga0070699_1002388531 182
38 3300006028 Ga0070717_10019889 Ga0070717_100198892 182
39 3300013105 Ga0157369_10046727 Ga0157369_100467275 182
40 3300024225 Ga0224572_1012016 Ga0224572_10120162 182
41 3300025910 Ga0207684_10046951 Ga0207684_100469513 182
42 3300046463 Ga0495653_0300915 Ga0495653_0300915_398_964 182
43 3300046516 Ga0495628_0194246 Ga0495628_0194246_361_927 182
44 3300047322 Ga0495680_0459945 Ga0495680_0459945_215_781 182
45 3300003322 rootL2_10293290 rootL2_102932905 183
46 3300003354 JGI25160J50197_1007034 JGI25160J50197_10070343 183
47 3300003373 JGI25407J50210_10108439 JGI25407J50210_101084391 183
48 3300003771 Ga0055526_1047133 Ga0055526_10471332 183
49 3300003790 Ga0055528_1000923 Ga0055528_10009238 183
50 3300003791 Ga0055530_10001354 Ga0055530_100013544 183
51 3300005262 Ga0065165_1000022 Ga0065165_1000022158 183
52 3300005295 Ga0065707_10227186 Ga0065707_102271863 183
53 3300005327 Ga0070658_10550103 Ga0070658_105501031 183
54 3300005329 Ga0070683_100391586 Ga0070683_1003915862 183
55 3300005336 Ga0070680_100164245 Ga0070680_1001642453 183
56 3300005340 Ga0070689_100002083 Ga0070689_1000020836 183
57 3300005344 Ga0070661_100006438 Ga0070661_1000064383 183
58 3300005353 Ga0070669_100209253 Ga0070669_1002092532 183
59 3300005365 Ga0070688_100020835 Ga0070688_1000208353 183
60 3300005366 Ga0070659_100259198 Ga0070659_1002591981 183
61 3300005434 Ga0070709_10544322 Ga0070709_105443221 183
62 3300005435 Ga0070714_100000021 Ga0070714_10000002177 183
63 3300005439 Ga0070711_100173515 Ga0070711_1001735152 183
64 3300005445 Ga0070708_100047210 Ga0070708_1000472102 183
65 3300005455 Ga0070663_100169324 Ga0070663_1001693241 183
66 3300005455 Ga0070663_100453388 Ga0070663_1004533882 183
67 3300005467 Ga0070706_100007206 Ga0070706_1000072063 183
68 3300005467 Ga0070706_100275036 Ga0070706_1002750362 183
69 3300005468 Ga0070707_100004183 Ga0070707_1000041836 183
70 3300005468 Ga0070707_100429500 Ga0070707_1004295001 183
71 3300005468 Ga0070707_100556085 Ga0070707_1005560853 183
72 3300005471 Ga0070698_100001393 Ga0070698_10000139323 183
73 3300005471 Ga0070698_100458355 Ga0070698_1004583553 183
74 3300005518 Ga0070699_100013953 Ga0070699_1000139535 183
75 3300005518 Ga0070699_100232820 Ga0070699_1002328201 183
76 3300005530 Ga0070679_100018801 Ga0070679_1000188013 183
77 3300005530 Ga0070679_100615805 Ga0070679_1006158052 183
78 3300005536 Ga0070697_100044593 Ga0070697_1000445933 183
79 3300005536 Ga0070697_100047664 Ga0070697_1000476641 183
80 3300005536 Ga0070697_100209633 Ga0070697_1002096332 183
81 3300005536 Ga0070697_100521739 Ga0070697_1005217391 183
82 3300005539 Ga0068853_100181691 Ga0068853_1001816912 183
83 3300005563 Ga0068855_100384507 Ga0068855_1003845073 183
84 3300005563 Ga0068855_100833475 Ga0068855_1008334752 183
85 3300005577 Ga0068857_100000725 Ga0068857_10000072515 183
86 3300005577 Ga0068857_100011439 Ga0068857_1000114399 183
87 3300005578 Ga0068854_100032649 Ga0068854_1000326493 183
88 3300005614 Ga0068856_100021152 Ga0068856_1000211522 183
89 3300005614 Ga0068856_100152117 Ga0068856_1001521172 183
90 3300005617 Ga0068859_100322414 Ga0068859_1003224142 183
91 3300005617 Ga0068859_101168518 Ga0068859_1011685181 183
92 3300005840 Ga0068870_10240040 Ga0068870_102400402 183
93 3300005841 Ga0068863_100059178 Ga0068863_1000591781 183
94 3300005841 Ga0068863_101313875 Ga0068863_1013138751 183
95 3300005844 Ga0068862_100040190 Ga0068862_1000401905 183
96 3300005937 Ga0081455_10014057 Ga0081455_100140572 183
97 3300005981 Ga0081538_10005578 Ga0081538_1000557814 183
98 3300006028 Ga0070717_10003911 Ga0070717_1000391110 183
99 3300006028 Ga0070717_10006711 Ga0070717_100067113 183
100 3300006173 Ga0070716_100841358 Ga0070716_1008413581 183
101 3300006177 Ga0075362_10051751 Ga0075362_100517512 183
102 3300006844 Ga0075428_100005029 Ga0075428_10000502912 183
103 3300006844 Ga0075428_100252456 Ga0075428_1002524563 183
104 3300006844 Ga0075428_100482652 Ga0075428_1004826522 183
105 3300006852 Ga0075433_10117421 Ga0075433_101174212 183
106 3300006852 Ga0075433_10439801 Ga0075433_104398012 183
107 3300006880 Ga0075429_100255309 Ga0075429_1002553092 183
108 3300006931 Ga0097620_100322393 Ga0097620_1003223931 183
109 3300006931 Ga0097620_101168611 Ga0097620_1011686111 183
110 3300007788 Ga0099795_10045744 Ga0099795_100457441 183
111 3300009093 Ga0105240_10047822 Ga0105240_100478223 183
112 3300009094 Ga0111539_10026463 Ga0111539_100264635 183
113 3300009147 Ga0114129_10137039 Ga0114129_101370392 183
114 3300009147 Ga0114129_11548083 Ga0114129_115480832 183
115 3300009148 Ga0105243_10457574 Ga0105243_104575742 183
116 3300009545 Ga0105237_10705836 Ga0105237_107058362 183
117 3300009551 Ga0105238_10006404 Ga0105238_100064042 183
118 3300009551 Ga0105238_10070301 Ga0105238_100703012 183
119 3300009551 Ga0105238_10486194 Ga0105238_104861942 183
120 3300009553 Ga0105249_10455363 Ga0105249_104553632 183
121 3300013100 Ga0157373_10130409 Ga0157373_101304092 183
122 3300013100 Ga0157373_10204600 Ga0157373_102046002 183
123 3300013105 Ga0157369_10047246 Ga0157369_100472463 183
124 3300013105 Ga0157369_10523016 Ga0157369_105230163 183
125 3300013296 Ga0157374_10934498 Ga0157374_109344982 183
126 3300013306 Ga0163162_10361501 Ga0163162_103615013 183
127 3300013307 Ga0157372_10003274 Ga0157372_100032743 183
128 3300013307 Ga0157372_10023212 Ga0157372_100232127 183
129 3300014326 Ga0157380_10127728 Ga0157380_101277282 183
130 3300021361 Ga0213872_10002606 Ga0213872_100026069 183
131 3300021388 Ga0213875_10254656 Ga0213875_102546561 183
132 3300025208 Ga0209436_100829 Ga0209436_10082911 183
133 3300025273 Ga0209673_1000517 Ga0209673_100051745 183
134 3300025295 Ga0209564_1003520 Ga0209564_10035202 183
135 3300025295 Ga0209564_1017898 Ga0209564_10178982 183
136 3300025298 Ga0209050_1001100 Ga0209050_100110014 183
137 3300025302 Ga0207426_1000057 Ga0207426_1000057250 183
138 3300025302 Ga0207426_1039446 Ga0207426_10394463 183
139 3300025303 Ga0209051_1054571 Ga0209051_10545712 183
140 3300025304 Ga0209257_1001984 Ga0209257_100198413 183
141 3300025321 Ga0207656_10303240 Ga0207656_103032401 183
142 3300025904 Ga0207647_10013246 Ga0207647_100132464 183
143 3300025908 Ga0207643_10225837 Ga0207643_102258372 183
144 3300025909 Ga0207705_10000839 Ga0207705_1000083918 183
145 3300025910 Ga0207684_10028618 Ga0207684_100286185 183
146 3300025910 Ga0207684_10036708 Ga0207684_100367082 183
147 3300025910 Ga0207684_10102086 Ga0207684_101020863 183
148 3300025912 Ga0207707_10125927 Ga0207707_101259273 183
149 3300025913 Ga0207695_10059443 Ga0207695_100594434 183
150 3300025914 Ga0207671_10563813 Ga0207671_105638131 183
151 3300025916 Ga0207663_10080903 Ga0207663_100809032 183
152 3300025919 Ga0207657_10021071 Ga0207657_100210716 183
153 3300025920 Ga0207649_10186061 Ga0207649_101860612 183
154 3300025921 Ga0207652_10034520 Ga0207652_100345204 183
155 3300025922 Ga0207646_10021960 Ga0207646_100219602 183
156 3300025923 Ga0207681_10193337 Ga0207681_101933372 183
157 3300025924 Ga0207694_10092410 Ga0207694_100924102 183
158 3300025924 Ga0207694_10175774 Ga0207694_101757741 183
159 3300025929 Ga0207664_10000005 Ga0207664_1000000557 183
160 3300025936 Ga0207670_10001691 Ga0207670_100016914 183
161 3300025939 Ga0207665_10347409 Ga0207665_103474092 183
162 3300025949 Ga0207667_10123197 Ga0207667_101231972 183
163 3300025949 Ga0207667_10774328 Ga0207667_107743282 183
164 3300025961 Ga0207712_10792901 Ga0207712_107929011 183
165 3300025981 Ga0207640_10751121 Ga0207640_107511212 183
166 3300026041 Ga0207639_10869908 Ga0207639_108699081 183
167 3300026067 Ga0207678_10001060 Ga0207678_100010604 183
168 3300026078 Ga0207702_10052666 Ga0207702_100526662 183
169 3300026088 Ga0207641_10081385 Ga0207641_100813852 183
170 3300026116 Ga0207674_10001330 Ga0207674_1000133018 183
171 3300026116 Ga0207674_10008885 Ga0207674_100088852 183
172 3300026142 Ga0207698_10594233 Ga0207698_105942331 183
173 3300027907 Ga0207428_10012223 Ga0207428_100122235 183
174 3300028380 Ga0268265_10125277 Ga0268265_101252772 183
175 3300031251 Ga0265327_10035773 Ga0265327_100357733 183
176 3300031507 Ga0307509_10009629 Ga0307509_1000962914 183
177 3300035119 Ga0373956_0021865 Ga0373956_0021865_299_880 183
178 3300035170 Ga0373943_0144382 Ga0373943_0144382_308_868 183
179 3300035724 Ga0373933_0056585 Ga0373933_0056585_385_966 183
180 3300035725 Ga0373947_0289247 Ga0373947_0289247_439_999 183
181 3300037853 Ga0436364_0403258 Ga0436364_0403258_17_571 183
182 3300044656 Ga0466969_0019344 Ga0466969_0019344_1181_1762 183
183 3300045976 Ga0466967_0084136 Ga0466967_0084136_2176_2730 183
184 3300046459 Ga0495629_0066801 Ga0495629_0066801_1080_1649 183
185 3300046462 Ga0495651_0003029 Ga0495651_0003029_8458_9063 183
186 3300046472 Ga0495580_0225231 Ga0495580_0225231_719_1276 183
187 3300046472 Ga0495580_0466371 Ga0495580_0466371_193_762 183
188 3300046475 Ga0495639_0074003 Ga0495639_0074003_253_834 183
189 3300046514 Ga0495618_0014600 Ga0495618_0014600_4094_4675 183
190 3300046516 Ga0495628_0098122 Ga0495628_0098122_375_980 183
191 3300046531 Ga0495665_0245519 Ga0495665_0245519_306_863 183
192 3300046535 Ga0495586_0008895 Ga0495586_0008895_4181_4762 183
193 3300046543 Ga0495645_0541873 Ga0495645_0541873_51_656 183
194 3300046559 Ga0495667_0054104 Ga0495667_0054104_406_987 183
195 3300046642 Ga0495634_0010848 Ga0495634_0010848_667_1248 183
196 3300046689 Ga0495613_0006984 Ga0495613_0006984_5563_6144 183
197 3300046809 Ga0495600_0073947 Ga0495600_0073947_213_818 183
198 3300047319 Ga0495674_0170584 Ga0495674_0170584_541_1122 183
199 3300047322 Ga0495680_0079942 Ga0495680_0079942_1502_2083 183
200 3300047471 Ga0495684_0053441 Ga0495684_0053441_651_1232 183
201 3300048088 Ga0495602_0381098 Ga0495602_0381098_374_979 183
202 3300048918 Ga0496115_0004099 Ga0496115_0004099_9446_10027 183
203 3300049570 Ga0501033_0205963 Ga0501033_0205963_369_920 183
204 3300049572 Ga0501036_0337046 Ga0501036_0337046_599_1150 183
205 3300049573 Ga0501037_0087779 Ga0501037_0087779_1461_2012 183
206 3300049574 Ga0501038_0121135 Ga0501038_0121135_421_972 183
207 3300050489 nmdc:mga03683_56800_c1 nmdc:mga03683_56800_c1_426_995 183
208 3300050493 nmdc:mga0k408_146307_c1 nmdc:mga0k408_146307_c1_650_1219 183
209 3300050507 nmdc:mga05p37_408387_c1 nmdc:mga05p37_408387_c1_822_1373 183
210 3300050508 nmdc:mga09592_250645_c1 nmdc:mga09592_250645_c1_371_949 183
211 3300050511 nmdc:mga08y16_1615603_c1 nmdc:mga08y16_1615603_c1_25_582 183
212 3300050511 nmdc:mga08y16_443881_c1 nmdc:mga08y16_443881_c1_21_581 183
213 3300050511 nmdc:mga08y16_46377_c1 nmdc:mga08y16_46377_c1_2955_3533 183
214 3300050515 nmdc:mga0a205_158190_c1 nmdc:mga0a205_158190_c1_933_1487 183
215 3300050515 nmdc:mga0a205_421447_c1 nmdc:mga0a205_421447_c1_178_756 183
216 3300053078 Ga0495612_0010767 Ga0495612_0010767_609_1214 183
217 3300053085 Ga0495619_0210638 Ga0495619_0210638_655_1260 183
218 3300053109 Ga0500569_056321 Ga0500569_056321_575_1126 183
219 3300005439 Ga0070711_100833400 Ga0070711_1008334001 184
220 3300009147 Ga0114129_10627101 Ga0114129_106271011 184
221 3300050507 nmdc:mga05p37_499138_c1 nmdc:mga05p37_499138_c1_74_661 184
222 3300050512 nmdc:mga0n895_1358736_c1 nmdc:mga0n895_1358736_c1_78_665 184
223 3300050514 nmdc:mga08x19_315565_c1 nmdc:mga08x19_315565_c1_187_759 185
224 3300037471 Ga0395905_0075422 Ga0395905_0075422_1926_2495 186
225 3300005539 Ga0068853_100000001 Ga0068853_100000001411 187
226 3300005577 Ga0068857_100010554 Ga0068857_1000105544 187
227 3300026041 Ga0207639_10000001 Ga0207639_10000001756 187
228 3300026116 Ga0207674_10016612 Ga0207674_100166124 187
229 3300003320 rootH2_10168541 rootH2_101685412 188
230 3300005295 Ga0065707_10354954 Ga0065707_103549542 188
231 3300045051 Ga0451576_0377069 Ga0451576_0377069_841_1431 188
232 3300013104 Ga0157370_10120581 Ga0157370_101205812 189
233 3300005355 Ga0070671_100216463 Ga0070671_1002164632 190
234 3300013306 Ga0163162_10605091 Ga0163162_106050912 190
235 3300025931 Ga0207644_10182174 Ga0207644_101821742 190
236 3300021441 Ga0213871_10002790 Ga0213871_100027903 191
237 3300039438 Ga0436360_1137586 Ga0436360_1137586_2965_3558 191
238 3300048903 Ga0496100_0017472 Ga0496100_0017472_379_963 191
239 3300048904 Ga0496101_0301649 Ga0496101_0301649_309_893 191
240 3300053086 Ga0500578_0273521 Ga0500578_0273521_67_657 195
241 3300050512 nmdc:mga0n895_605587_c1 nmdc:mga0n895_605587_c1_97_702 196
242 3300005937 Ga0081455_10397927 Ga0081455_103979272 198
243 3300006914 Ga0075436_100023439 Ga0075436_1000234392 198
244 3300009147 Ga0114129_10862666 Ga0114129_108626662 198
245 3300035083 Ga0373926_0000776 Ga0373926_0000776_5393_6004 198
246 3300035171 Ga0373946_0009203 Ga0373946_0009203_514_1125 198
247 3300035695 Ga0373927_0000272 Ga0373927_0000272_9902_10513 198
248 3300037068 Ga0373925_0000359 Ga0373925_0000359_14976_15587 198
249 3300046690 Ga0495624_0051682 Ga0495624_0051682_481_1092 198
250 3300050507 nmdc:mga05p37_428844_c1 nmdc:mga05p37_428844_c1_500_1129 198
251 3300001989 JGI24739J22299_10005343 JGI24739J22299_100053434 199
252 3300003215 JGI25153J46596_10006489 JGI25153J46596_100064892 199
253 3300005578 Ga0068854_100098740 Ga0068854_1000987402 199
254 3300025297 Ga0209758_1002857 Ga0209758_10028578 199
255 3300025297 Ga0209758_1022633 Ga0209758_10226334 199
256 3300025981 Ga0207640_10079793 Ga0207640_100797932 199

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gmy-assembly1.cif.gz_C crystal structure of a protein of unknown function atu0492 from agrobacterium tumefaciens, putative antioxidant defence protein ahpd 0.9271 52 189
7xw1-assembly1.cif.gz_A the crystal structure of ahpd from pseudomonas aeruginosa 0.9037 58 184
2ijc-assembly2.cif.gz_I structure of a conserved protein of unknown function pa0269 from pseudomonas aeruginosa 0.903 54 190
2gmy-assembly1.cif.gz_C crystal structure of a protein of unknown function atu0492 from agrobacterium tumefaciens, putative antioxidant defence protein ahpd 0.8733 52 189
3lvy-assembly3.cif.gz_E crystal structure of carboxymuconolactone decarboxylase family protein smu.961 from streptococcus mutans 0.86 29 190
ID Description Score Start End Superfamily
2gmyF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9278 52 189 1.20.1290.10
af_O53905_23_180_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9104 76 190 1.20.1290.10
af_Q2FVE0_2_139_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9096 62 186 1.20.1290.10
2ijcF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8841 56 184 1.20.1290.10
af_O53377_388_550_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8805 33 192 1.20.1290.10
ID Description Score Start End GO Terms
AF-A0A2V9QL28-F1-model_v4 Carboxymuconolactone decarboxylase family protein 0.9873 47 198
AF-A0A1D7UUI6-F1-model_v4 Carboxymuconolactone decarboxylase-like domain-containing protein 0.9845 18 191
AF-A0A6A7MID7-F1-model_v4 deleted 0.98 19 198
AF-A0A4Q5S8C7-F1-model_v4 Carboxymuconolactone decarboxylase family protein 0.9793 18 196
AF-A0A5E8A911-F1-model_v4 Alkylhydroperoxidase AhpD family core domain-containing protein 0.974 21 198 GO:0004601

Feature Viewer

pLDDT pTM Quality
90.19 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map