F366353

General Info

Members Datasets Scaffolds Average Seq Length
256 192 513 245

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10037091|Ga0081455_100370914
Length 232
Sequence MQWSDEGIVLGIRRHGEANAILELLTRAHGRHLGLVRGGAGTRLQAVLQPGNRIISTWRARLDEHLGHYAVEALDSRAASFLSVPHALYGMTHLAALCRLLPERDPHPDLARAGASVVRFELLLLGELGFGLDLATCAVSGRTDDLVYVSPKSGRAVSRREGEPWKDKLLALPAFLREPCDPSPQDIADGFALTGFFLLRHALEPRGLGFADARANFIAALERDGRDALAVG

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
34 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
43 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
59 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
60 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
61 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
62 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
90 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
91 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
93 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
94 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
95 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
96 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
97 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
98 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
99 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
100 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
101 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
102 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
103 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
104 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
105 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
106 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
107 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
109 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
110 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
111 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
112 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
113 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
114 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
115 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
116 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
117 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
118 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
119 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
120 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
121 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
122 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
123 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
124 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
125 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
126 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
127 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
128 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
129 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
130 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
131 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
132 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
133 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
134 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
135 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
136 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
137 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
138 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
139 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
151 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
152 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
153 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
154 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
155 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
156 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
157 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
158 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
159 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
160 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
161 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
162 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
165 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
166 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
167 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
168 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
169 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
170 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
171 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
172 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
173 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
174 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
175 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
176 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
177 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
178 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
179 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
180 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
181 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
182 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
183 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
184 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
185 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
186 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
187 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
188 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
189 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
190 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
191 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
192 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.22
Metatranscriptomes 0.39
Isolates 0.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.77
Nodule 0
Rhizoplane 3.91
Rhizosphere 82.03
Stem 0
Stem Tuber 0
Unclassified 0.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10037091 3300005937 Bacteria 4333
2 rootH1_10093318 3300003316 Bacteria 1516
3 rootH1_10093318 3300003323 Bacteria 1480
4 JGI25405J52794_10007168 3300003911 Bacteria 2051
5 Ga0070683_100261331 3300005329 Bacteria 1647
6 Ga0070680_100082617 3300005336 Bacteria 2652
7 Ga0070682_100092986 3300005337 Bacteria 1977
8 Ga0070689_100255379 3300005340 Bacteria 1447
9 Ga0070692_10249342 3300005345 Bacteria 1062
10 Ga0070675_100132103 3300005354 Bacteria 2128
11 Ga0070674_100010528 3300005356 Bacteria 5596
12 Ga0070688_100583511 3300005365 Bacteria 854
13 Ga0070667_100224216 3300005367 Bacteria 1674
14 Ga0070714_100401166 3300005435 Bacteria 1296
15 Ga0070713_100025816 3300005436 Bacteria 4601
16 Ga0070713_100466622 3300005436 Bacteria 1188
17 Ga0070713_100742224 3300005436 Bacteria 939
18 Ga0070711_100058857 3300005439 Bacteria 2666
19 Ga0070711_100151530 3300005439 Bacteria 1749
20 Ga0070678_100013045 3300005456 Bacteria 5193
21 Ga0070681_10641915 3300005458 Bacteria 976
22 Ga0070672_100242426 3300005543 Bacteria 1516
23 Ga0070693_100080412 3300005547 Bacteria 1942
24 Ga0070693_100418145 3300005547 Bacteria 933
25 Ga0070665_100167962 3300005548 Bacteria 2196
26 Ga0068855_100309355 3300005563 Bacteria 1748
27 Ga0068857_100386445 3300005577 Bacteria 1300
28 Ga0068856_100184259 3300005614 Bacteria 2101
29 Ga0068859_100416089 3300005617 Bacteria 1440
30 Ga0068861_100414443 3300005719 Bacteria 1199
31 Ga0068858_100211173 3300005842 Bacteria 1837
32 Ga0068858_100494151 3300005842 Bacteria 1182
33 Ga0070717_10498151 3300006028 Bacteria 1101
34 Ga0075365_10159272 3300006038 Bacteria 1572
35 Ga0075363_100009047 3300006048 Bacteria 4672
36 Ga0075364_10039820 3300006051 Bacteria 3047
37 Ga0075364_10217415 3300006051 Bacteria 1296
38 Ga0070716_100194483 3300006173 Bacteria 1343
39 Ga0070712_100006908 3300006175 Bacteria 7072
40 Ga0075362_10003265 3300006177 Bacteria 5635
41 Ga0075362_10101461 3300006177 Bacteria 1346
42 Ga0075366_10005988 3300006195 Bacteria 6623
43 Ga0075428_100005019 3300006844 Bacteria 14707
44 Ga0075430_100003454 3300006846 Bacteria 13221
45 Ga0075431_100075149 3300006847 Bacteria 3487
46 Ga0075434_100084692 3300006871 Bacteria 3169
47 Ga0075429_100011493 3300006880 Bacteria 7676
48 Ga0068865_100652236 3300006881 Bacteria 895
49 Ga0097620_100416104 3300006931 Bacteria 1440
50 Ga0099794_10026795 3300007265 Bacteria 2668
51 Ga0099795_10018656 3300007788 Bacteria 2233
52 Ga0105240_10927241 3300009093 Bacteria 935
53 Ga0111539_10003464 3300009094 Bacteria 20784
54 Ga0111539_10018734 3300009094 Bacteria 8570
55 Ga0105245_10126286 3300009098 Bacteria 2395
56 Ga0105245_10287432 3300009098 Bacteria 1609
57 Ga0105247_10009531 3300009101 Bacteria 5892
58 Ga0114129_10003903 3300009147 Bacteria 21043
59 Ga0105243_10313930 3300009148 Bacteria 1425
60 Ga0105241_10080010 3300009174 Bacteria 2556
61 Ga0105241_10225546 3300009174 Bacteria 1577
62 Ga0105238_10085445 3300009551 Bacteria 3143
63 Ga0099796_10066271 3300010159 Unclassified 1293
64 Ga0157370_10172647 3300013104 Bacteria 2009
65 Ga0157369_10432465 3300013105 Bacteria 1364
66 Ga0157378_10273561 3300013297 Bacteria 1625
67 Ga0157380_10109386 3300014326 Bacteria 2319
68 Ga0206356_10955678 3300020070 Bacteria 1152
69 Ga0213874_10047407 3300021377 Bacteria 1307
70 Ga0213876_10158128 3300021384 Bacteria 1205
71 Ga0213875_10000025 3300021388 Bacteria 197787
72 Ga0209233_1006564 3300025261 Bacteria 3740
73 Ga0207682_10001000 3300025893 Bacteria 13076
74 Ga0207688_10094012 3300025901 Bacteria 1724
75 Ga0207699_10009691 3300025906 Bacteria 4807
76 Ga0207643_10075204 3300025908 Bacteria 1949
77 Ga0207643_10210374 3300025908 Bacteria 1187
78 Ga0207707_10207526 3300025912 Bacteria 1707
79 Ga0207695_10596393 3300025913 Bacteria 986
80 Ga0207693_10013245 3300025915 Bacteria 6653
81 Ga0207693_10035798 3300025915 Bacteria 3914
82 Ga0207663_10030050 3300025916 Bacteria 3200
83 Ga0207663_10037008 3300025916 Bacteria 2939
84 Ga0207663_10158751 3300025916 Bacteria 1594
85 Ga0207663_10224966 3300025916 Bacteria 1367
86 Ga0207662_10029966 3300025918 Bacteria 3155
87 Ga0207681_10177141 3300025923 Bacteria 1621
88 Ga0207694_10144899 3300025924 Bacteria 1911
89 Ga0207687_10089373 3300025927 Bacteria 2243
90 Ga0207700_10006284 3300025928 Bacteria 7169
91 Ga0207700_10146716 3300025928 Bacteria 1945
92 Ga0207669_10017878 3300025937 Bacteria 3649
93 Ga0207704_10202224 3300025938 Bacteria 1455
94 Ga0207704_10348227 3300025938 Bacteria 1153
95 Ga0207691_10008196 3300025940 Bacteria 10037
96 Ga0207711_10236615 3300025941 Bacteria 1674
97 Ga0207689_10042470 3300025942 Bacteria 3761
98 Ga0207679_10313452 3300025945 Bacteria 1356
99 Ga0207667_10122490 3300025949 Bacteria 2679
100 Ga0207651_10167537 3300025960 Bacteria 1729
101 Ga0207651_10426585 3300025960 Bacteria 1133
102 Ga0207658_10328588 3300025986 Bacteria 1326
103 Ga0207703_10158780 3300026035 Bacteria 1979
104 Ga0207639_10340837 3300026041 Bacteria 1336
105 Ga0207676_10076512 3300026095 Bacteria 2704
106 Ga0207674_10576810 3300026116 Bacteria 1087
107 Ga0207683_10072471 3300026121 Bacteria 3046
108 Ga0209813_10026082 3300027866 Bacteria 1687
109 Ga0207428_10028509 3300027907 Bacteria 4638
110 Ga0207428_10041467 3300027907 Bacteria 3726
111 Ga0268265_10228369 3300028380 Bacteria 1634
112 Ga0268265_10554800 3300028380 Bacteria 1091
113 Ga0265337_1012331 3300028556 Bacteria 2909
114 Ga0265338_10261627 3300028800 Bacteria 1272
115 Ga0265325_10014439 3300031241 Bacteria 4464
116 Ga0307513_10309038 3300031456 Bacteria 1344
117 Ga0265313_10111798 3300031595 Bacteria 1200
118 Ga0265314_10086344 3300031711 Bacteria 2055
119 Ga0373950_0007236 3300034818 Bacteria 1718
120 Ga0373960_0050596 3300035121 Bacteria 1232
121 Ga0373946_0022794 3300035171 Bacteria 2441
122 Ga0373955_0070670 3300035172 Bacteria 1951
123 Ga0373931_0030255 3300035691 Bacteria 2786
124 Ga0373935_0051874 3300035692 Bacteria 2606
125 Ga0373933_0151381 3300035724 Bacteria 1469
126 Ga0373937_0091006 3300036401 Bacteria 2826
127 Ga0373937_0272891 3300036401 Bacteria 1596
128 Ga0316584_0026489 3300036712 Bacteria 4262
129 Ga0373925_0053300 3300037068 Bacteria 3023
130 Ga0373925_0167227 3300037068 Bacteria 1735
131 Ga0436364_0318172 3300037853 Bacteria 79481
132 Ga0436365_0015900 3300039437 Bacteria 1026
133 Ga0436365_0555806 3300039437 Bacteria 3466
134 Ga0436365_0580827 3300039437 Bacteria 3925
135 Ga0436363_0490513 3300039450 Bacteria 3798
136 Ga0439443_002033 3300042003 Bacteria 2363
137 Ga0439446_0090252 3300042156 Bacteria 959
138 Ga0439435_0060113 3300042436 Bacteria 1106
139 Ga0439460_0006973 3300042461 Bacteria 2817
140 Ga0495592_0008136 3300046454 Bacteria 7877
141 Ga0495638_0000936 3300046460 Bacteria 29581
142 Ga0495651_0052684 3300046462 Bacteria 3134
143 Ga0495605_0150899 3300046474 Bacteria 1037
144 Ga0495628_0002339 3300046516 Bacteria 17109
145 Ga0495637_0173273 3300046520 Bacteria 804
146 Ga0495652_0007265 3300046529 Bacteria 10223
147 Ga0495640_0323121 3300046533 Bacteria 955
148 Ga0495645_0000537 3300046543 Bacteria 26052
149 Ga0495668_0309730 3300046616 Bacteria 866
150 Ga0495635_0005336 3300046663 Bacteria 8947
151 Ga0495599_0005425 3300046678 Bacteria 7621
152 Ga0495600_0025030 3300046809 Bacteria 3845
153 Ga0495680_0016448 3300047322 Bacteria 6352
154 Ga0495675_0075269 3300047444 Bacteria 2128
155 Ga0495685_100879 3300047447 Bacteria 953
156 Ga0495615_0050164 3300048090 Bacteria 1072
157 Ga0496104_0000761 3300048907 Bacteria 27599
158 Ga0496104_0049016 3300048907 Bacteria 3983
159 Ga0496104_0196900 3300048907 Bacteria 1927
160 Ga0496105_0000600 3300048908 Bacteria 24051
161 Ga0496106_0082259 3300048909 Bacteria 2475
162 Ga0496107_0221281 3300048910 Bacteria 1408
163 Ga0496112_0701412 3300048915 Bacteria 940
164 Ga0496114_0022959 3300048917 Bacteria 5086
165 Ga0496115_0211829 3300048918 Bacteria 1600
166 Ga0496115_0339172 3300048918 Bacteria 1227
167 Ga0501031_0049323 3300049568 Bacteria 2744
168 Ga0501032_0092658 3300049569 Bacteria 2004
169 Ga0501033_0035224 3300049570 Bacteria 3753
170 Ga0501034_0000097 3300049571 Bacteria 161027
171 Ga0501034_0002259 3300049571 Bacteria 23638
172 Ga0501034_0047106 3300049571 Bacteria 4355
173 Ga0501034_0321728 3300049571 Bacteria 1480
174 Ga0501034_0527208 3300049571 Bacteria 1092
175 Ga0501036_0000954 3300049572 Bacteria 21767
176 Ga0501036_0022035 3300049572 Bacteria 5358
177 Ga0501036_0198883 3300049572 Bacteria 1686
178 Ga0501038_0131646 3300049574 Bacteria 2053
179 Ga0501038_0227045 3300049574 Bacteria 1487
180 Ga0501041_0317772 3300049577 Bacteria 982
181 Ga0501043_0043237 3300049579 Bacteria 3541
182 Ga0501046_0030532 3300049580 Bacteria 4373
183 Ga0501046_0160892 3300049580 Bacteria 1689
184 Ga0501047_0000218 3300049581 Bacteria 68952
185 Ga0501047_0067483 3300049581 Bacteria 3447
186 Ga0501048_0000313 3300049582 Bacteria 33165
187 Ga0501068_0013944 3300049584 Bacteria 4584
188 Ga0501069_0084219 3300049585 Bacteria 1793
189 Ga0501070_0013530 3300049586 Bacteria 6878
190 Ga0501070_0018953 3300049586 Bacteria 5771
191 Ga0501070_0414992 3300049586 Bacteria 1087
192 Ga0501072_0001601 3300049588 Bacteria 16914
193 Ga0501072_0034802 3300049588 Bacteria 3947
194 Ga0501072_0164976 3300049588 Bacteria 1767
195 Ga0501073_0032682 3300049589 Bacteria 3709
196 Ga0501074_0027394 3300049590 Bacteria 4132
197 Ga0501074_0040419 3300049590 Bacteria 3378
198 Ga0501074_0107164 3300049590 Bacteria 2001
199 Ga0501075_0060800 3300049591 Bacteria 2846
200 Ga0501076_0055802 3300049592 Bacteria 3133
201 Ga0501079_0126617 3300049741 Bacteria 1987
202 Ga0501079_0169314 3300049741 Bacteria 1703
203 Ga0501080_0001471 3300049742 Bacteria 19833
204 Ga0501080_0028798 3300049742 Bacteria 5170
205 Ga0501080_0391749 3300049742 Bacteria 1250
206 Ga0501081_0017467 3300049743 Bacteria 4750
207 Ga0501081_0597163 3300049743 Bacteria 826
208 Ga0501083_0001547 3300049744 Bacteria 15730
209 Ga0501083_0085161 3300049744 Bacteria 2092
210 Ga0501035_0003871 3300049822 Bacteria 14283
211 Ga0501035_0186721 3300049822 Bacteria 1784
212 Ga0501035_0779637 3300049822 Bacteria 765
213 Ga0501044_0003277 3300049823 Bacteria 18223
214 Ga0501044_0078504 3300049823 Bacteria 3345
215 Ga0501044_0112130 3300049823 Bacteria 2735
216 Ga0501044_0236595 3300049823 Bacteria 1772
217 Ga0501044_0265075 3300049823 Bacteria 1655
218 Ga0501045_0269235 3300049824 Bacteria 1268
219 nmdc:mga03683_113696_c1 3300050489 Bacteria 1199
220 nmdc:mga03683_50034_c1 3300050489 Bacteria 1741
221 nmdc:mga00v17_13730_c1 3300050491 Bacteria 4502
222 nmdc:mga0yw44_229402_c1 3300050492 Bacteria 1232
223 nmdc:mga0k408_2346_c1 3300050493 Bacteria 10067
224 nmdc:mga09592_723_c2 3300050508 Bacteria 15482
225 nmdc:mga0qj67_264_c1 3300050509 Bacteria 36047
226 nmdc:mga06r32_62324_c1 3300050510 Bacteria 3593
227 nmdc:mga08y16_54300_c1 3300050511 Bacteria 4186
228 nmdc:mga0n895_11697_c1 3300050512 Bacteria 7842
229 nmdc:mga0a205_94868_c1 3300050515 Bacteria 2882
230 Ga0495601_0000956 3300053077 Bacteria 15775
231 Ga0495601_0188798 3300053077 Bacteria 1347
232 Ga0495612_0004057 3300053078 Bacteria 6065
233 Ga0495595_0002992 3300053084 Bacteria 6676
234 Ga0495595_0025051 3300053084 Bacteria 2639
235 Ga0495619_0000931 3300053085 Bacteria 19252
236 Ga0495619_0058912 3300053085 Bacteria 2551
237 Ga0495619_0179148 3300053085 Bacteria 1466
238 Ga0495619_0184327 3300053085 Bacteria 1444
239 Ga0500578_0228657 3300053086 Bacteria 1128
240 Ga0500651_0238071 3300053093 Bacteria 1062
241 Ga0500641_0040973 3300053096 Bacteria 1872
242 Ga0500595_000002 3300053119 Bacteria 1074388
243 Ga0500642_0159937 3300053130 Bacteria 1056
244 Ga0500652_031566 3300053131 Bacteria 2079
245 Ga0500658_0030775 3300053134 Bacteria 2096
246 Ga0500604_0062862 3300053151 Bacteria 1169
247 Ga0500616_0000002 3300053153 Bacteria 1611257
248 Ga0500616_0078941 3300053153 Bacteria 1658
249 Ga0500645_000079 3300053730 Bacteria 76832
250 Ga0501084_0111951 3300054114 Bacteria 2294
251 Ga0501084_0120437 3300054114 Bacteria 2206
252 Ga0501084_0571484 3300054114 Bacteria 955
253 Ga0590071_012790 3300059421 Bacteria 1967
254 Ga0530510_0023248 3300061734 Bacteria 4415
255 Ga0530510_0042601 3300061734 Bacteria 3280
256 Ga0530510_0412049 3300061734 Bacteria 1019
257 2643756079 2643221547 Bacteria 4740017
258 Ga0081455_10037091
259 rootH1_10093318
260 JGI25405J52794_10007168
261 Ga0070683_100261331
262 Ga0070680_100082617
263 Ga0070682_100092986
264 Ga0070689_100255379
265 Ga0070692_10249342
266 Ga0070675_100132103
267 Ga0070674_100010528
268 Ga0070688_100583511
269 Ga0070667_100224216
270 Ga0070714_100401166
271 Ga0070713_100025816
272 Ga0070713_100466622
273 Ga0070713_100742224
274 Ga0070711_100058857
275 Ga0070711_100151530
276 Ga0070678_100013045
277 Ga0070681_10641915
278 Ga0070672_100242426
279 Ga0070693_100080412
280 Ga0070693_100418145
281 Ga0070665_100167962
282 Ga0068855_100309355
283 Ga0068857_100386445
284 Ga0068856_100184259
285 Ga0068859_100416089
286 Ga0068861_100414443
287 Ga0068858_100211173
288 Ga0068858_100494151
289 Ga0070717_10498151
290 Ga0075365_10159272
291 Ga0075363_100009047
292 Ga0075364_10039820
293 Ga0075364_10217415
294 Ga0070716_100194483
295 Ga0070712_100006908
296 Ga0075362_10003265
297 Ga0075362_10101461
298 Ga0075366_10005988
299 Ga0075428_100005019
300 Ga0075430_100003454
301 Ga0075431_100075149
302 Ga0075434_100084692
303 Ga0075429_100011493
304 Ga0068865_100652236
305 Ga0097620_100416104
306 Ga0099794_10026795
307 Ga0099795_10018656
308 Ga0105240_10927241
309 Ga0111539_10003464
310 Ga0111539_10018734
311 Ga0105245_10126286
312 Ga0105245_10287432
313 Ga0105247_10009531
314 Ga0114129_10003903
315 Ga0105243_10313930
316 Ga0105241_10080010
317 Ga0105241_10225546
318 Ga0105238_10085445
319 Ga0099796_10066271
320 Ga0157370_10172647
321 Ga0157369_10432465
322 Ga0157378_10273561
323 Ga0157380_10109386
324 Ga0206356_10955678
325 Ga0213874_10047407
326 Ga0213876_10158128
327 Ga0213875_10000025
328 Ga0209233_1006564
329 Ga0207682_10001000
330 Ga0207688_10094012
331 Ga0207699_10009691
332 Ga0207643_10075204
333 Ga0207643_10210374
334 Ga0207707_10207526
335 Ga0207695_10596393
336 Ga0207693_10013245
337 Ga0207693_10035798
338 Ga0207663_10030050
339 Ga0207663_10037008
340 Ga0207663_10158751
341 Ga0207663_10224966
342 Ga0207662_10029966
343 Ga0207681_10177141
344 Ga0207694_10144899
345 Ga0207687_10089373
346 Ga0207700_10006284
347 Ga0207700_10146716
348 Ga0207669_10017878
349 Ga0207704_10202224
350 Ga0207704_10348227
351 Ga0207691_10008196
352 Ga0207711_10236615
353 Ga0207689_10042470
354 Ga0207679_10313452
355 Ga0207667_10122490
356 Ga0207651_10167537
357 Ga0207651_10426585
358 Ga0207658_10328588
359 Ga0207703_10158780
360 Ga0207639_10340837
361 Ga0207676_10076512
362 Ga0207674_10576810
363 Ga0207683_10072471
364 Ga0209813_10026082
365 Ga0207428_10028509
366 Ga0207428_10041467
367 Ga0268265_10228369
368 Ga0268265_10554800
369 Ga0265337_1012331
370 Ga0265338_10261627
371 Ga0265325_10014439
372 Ga0307513_10309038
373 Ga0265313_10111798
374 Ga0265314_10086344
375 Ga0373950_0007236
376 Ga0373960_0050596
377 Ga0373946_0022794
378 Ga0373955_0070670
379 Ga0373931_0030255
380 Ga0373935_0051874
381 Ga0373933_0151381
382 Ga0373937_0091006
383 Ga0373937_0272891
384 Ga0316584_0026489
385 Ga0373925_0053300
386 Ga0373925_0167227
387 Ga0436364_0318172
388 Ga0436365_0015900
389 Ga0436365_0555806
390 Ga0436365_0580827
391 Ga0436363_0490513
392 Ga0439443_002033
393 Ga0439446_0090252
394 Ga0439435_0060113
395 Ga0439460_0006973
396 Ga0495592_0008136
397 Ga0495638_0000936
398 Ga0495651_0052684
399 Ga0495605_0150899
400 Ga0495628_0002339
401 Ga0495637_0173273
402 Ga0495652_0007265
403 Ga0495640_0323121
404 Ga0495645_0000537
405 Ga0495668_0309730
406 Ga0495635_0005336
407 Ga0495599_0005425
408 Ga0495600_0025030
409 Ga0495680_0016448
410 Ga0495675_0075269
411 Ga0495685_100879
412 Ga0495615_0050164
413 Ga0496104_0000761
414 Ga0496104_0049016
415 Ga0496104_0196900
416 Ga0496105_0000600
417 Ga0496106_0082259
418 Ga0496107_0221281
419 Ga0496112_0701412
420 Ga0496114_0022959
421 Ga0496115_0211829
422 Ga0496115_0339172
423 Ga0501031_0049323
424 Ga0501032_0092658
425 Ga0501033_0035224
426 Ga0501034_0000097
427 Ga0501034_0002259
428 Ga0501034_0047106
429 Ga0501034_0321728
430 Ga0501034_0527208
431 Ga0501036_0000954
432 Ga0501036_0022035
433 Ga0501036_0198883
434 Ga0501038_0131646
435 Ga0501038_0227045
436 Ga0501041_0317772
437 Ga0501043_0043237
438 Ga0501046_0030532
439 Ga0501046_0160892
440 Ga0501047_0000218
441 Ga0501047_0067483
442 Ga0501048_0000313
443 Ga0501068_0013944
444 Ga0501069_0084219
445 Ga0501070_0013530
446 Ga0501070_0018953
447 Ga0501070_0414992
448 Ga0501072_0001601
449 Ga0501072_0034802
450 Ga0501072_0164976
451 Ga0501073_0032682
452 Ga0501074_0027394
453 Ga0501074_0040419
454 Ga0501074_0107164
455 Ga0501075_0060800
456 Ga0501076_0055802
457 Ga0501079_0126617
458 Ga0501079_0169314
459 Ga0501080_0001471
460 Ga0501080_0028798
461 Ga0501080_0391749
462 Ga0501081_0017467
463 Ga0501081_0597163
464 Ga0501083_0001547
465 Ga0501083_0085161
466 Ga0501035_0003871
467 Ga0501035_0186721
468 Ga0501035_0779637
469 Ga0501044_0003277
470 Ga0501044_0078504
471 Ga0501044_0112130
472 Ga0501044_0236595
473 Ga0501044_0265075
474 Ga0501045_0269235
475 nmdc:mga03683_113696_c1
476 nmdc:mga03683_50034_c1
477 nmdc:mga00v17_13730_c1
478 nmdc:mga0yw44_229402_c1
479 nmdc:mga0k408_2346_c1
480 nmdc:mga09592_723_c2
481 nmdc:mga0qj67_264_c1
482 nmdc:mga06r32_62324_c1
483 nmdc:mga08y16_54300_c1
484 nmdc:mga0n895_11697_c1
485 nmdc:mga0a205_94868_c1
486 Ga0495601_0000956
487 Ga0495601_0188798
488 Ga0495612_0004057
489 Ga0495595_0002992
490 Ga0495595_0025051
491 Ga0495619_0000931
492 Ga0495619_0058912
493 Ga0495619_0179148
494 Ga0495619_0184327
495 Ga0500578_0228657
496 Ga0500651_0238071
497 Ga0500641_0040973
498 Ga0500595_000002
499 Ga0500642_0159937
500 Ga0500652_031566
501 Ga0500658_0030775
502 Ga0500604_0062862
503 Ga0500616_0000002
504 Ga0500616_0078941
505 Ga0500645_000079
506 Ga0501084_0111951
507 Ga0501084_0120437
508 Ga0501084_0571484
509 Ga0590071_012790
510 Ga0530510_0023248
511 Ga0530510_0042601
512 Ga0530510_0412049
513 2643756079

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11967

RecO_N

Recombination protein O N terminal

1

77

0.93

PF02565

RecO_C

Recombination protein O C terminal

111

207

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2bay-assembly3.cif.gz_E crystal structure of the prp19 u-box dimer 0.7779 149 186
2bay-assembly2.cif.gz_B crystal structure of the prp19 u-box dimer 0.7628 150 186
3q8d-assembly1.cif.gz_A e. coli reco complex with ssb c-terminus 0.7501 4 235
3q8d-assembly1.cif.gz_A e. coli reco complex with ssb c-terminus 0.7355 4 235
1h9m-assembly1.cif.gz_A two crystal structures of the cytoplasmic molybdate-binding protein modg suggest a novel cooperative binding mechanism and provide insights into ligand-binding specificity. peg-grown form with molybdate bound 0.733 3 60
ID Description Score Start End Superfamily
3q8dB01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8678 4 76 2.40.50.140
af_Q2FY07_1_75_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8662 3 75 2.40.50.140
af_P9WHI5_1_82_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8636 1 79 2.40.50.140
af_Q2FY07_1_75_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8351 3 75 2.40.50.140
4jcvF01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8304 3 76 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A1H4LEY0-F1-model_v4 DNA repair protein RecO (Recombination protein O) 0.9762 1 237 GO:0006302
GO:0006310
GO:0043590
AF-A0A6B1HSI7-F1-model_v4 deleted 0.9734 1 70
AF-A0A358PD05-F1-model_v4 DNA repair protein RecO 0.9702 1 74 GO:0006302
GO:0006310
GO:0043590
AF-A0A4R2SXK0-F1-model_v4 deleted 0.9698 1 240
AF-A0A526UX37-F1-model_v4 DNA repair protein RecO 0.9694 25 237 GO:0006302
GO:0006310
GO:0043590

Map