F366367

General Info

Members Datasets Scaffolds Average Seq Length
256 183 512 136

Family's Representative Sequence

Representative Sequence 3300006038|Ga0075365_10220801|Ga0075365_102208012
Length 147
Sequence MPITRGYRALVDQAMAEVKTYSVADVRARLGEAGLQLVDIRDVRELQAEGTVPGSYHAPRGMLEFWVDPDSPYHKKVFADEGREFVLFCGAGWRSALAAKTLQDMGMANVAHIEGGFAEWVKQGGPTETLEARKAKKAIGRNDDPTN

Samples

Sample ID Description Type Environment
1 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
13 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
14 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
15 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
16 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
17 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
22 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
58 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
63 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
64 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
65 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
66 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
67 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
68 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
71 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
74 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
76 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
79 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
97 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
98 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
99 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
100 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
101 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
102 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
103 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
104 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
105 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
106 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
107 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
108 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
109 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
110 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
111 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
112 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
113 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
114 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
115 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
116 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
117 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
118 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
119 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
120 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
121 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
122 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
123 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
124 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
125 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
126 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
127 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
128 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
129 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
130 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
131 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
132 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
133 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
134 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
135 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
136 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
137 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
147 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
148 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
149 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
150 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
151 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
152 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
153 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
154 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
155 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
156 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
157 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
158 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
161 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
162 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
163 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
164 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
165 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
166 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
167 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
168 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
169 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
170 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
171 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
172 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
173 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
174 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
175 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
176 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
177 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
178 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
179 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
180 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
181 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
182 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
183 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.09
Metatranscriptomes 2.34
Isolates 1.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.56
Nodule 0.39
Rhizoplane 2.73
Rhizosphere 63.67
Stem 0
Stem Tuber 0
Unclassified 0.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075365_10220801 3300006038 Bacteria 1329
2 MRS1b_contig_3250830 2162886011 Bacteria 1567
3 JGI25155J39150_1000059 3300002704 Bacteria 72038
4 JGI25156J39149_1000081 3300002705 Bacteria 72221
5 JGI25154J39366_1000109 3300002738 Bacteria 72431
6 JGI25157J39369_1000103 3300002741 Bacteria 72221
7 JGI25159J45721_1000246 3300002987 Bacteria 25617
8 JGI25159J45721_1023333 3300002987 Bacteria 1124
9 JGI25151J46595_10003461 3300003187 Bacteria 8711
10 JGI25151J46595_10047649 3300003187 Bacteria 1489
11 JGI25160J50197_1000451 3300003354 Bacteria 25633
12 JGI25161J50226_1000077 3300003374 Bacteria 83588
13 Ga0055526_1015582 3300003771 Bacteria 3044
14 Ga0055526_1021290 3300003771 Bacteria 2262
15 Ga0055537_1000872 3300003773 Bacteria 14428
16 Ga0055524_1000344 3300003775 Bacteria 42440
17 Ga0055534_1001218 3300003784 Bacteria 10791
18 Ga0055528_1000729 3300003790 Bacteria 23225
19 Ga0055530_10000853 3300003791 Bacteria 25164
20 Ga0055530_10023756 3300003791 Bacteria 1754
21 Ga0055540_1000139 3300003792 Bacteria 72664
22 Ga0055540_1005099 3300003792 Bacteria 5664
23 Ga0055531_10001011 3300003794 Bacteria 22322
24 Ga0055531_10001428 3300003794 Bacteria 17641
25 Ga0055543_1002213 3300004625 Bacteria 6640
26 Ga0065165_1032134 3300005262 Bacteria 1649
27 Ga0065712_10074751 3300005290 Bacteria 4017
28 Ga0065715_10125655 3300005293 Bacteria 2125
29 Ga0070690_100621272 3300005330 Bacteria 822
30 Ga0070666_10418855 3300005335 Bacteria 964
31 Ga0070660_100910441 3300005339 Bacteria 742
32 Ga0070689_101331409 3300005340 Bacteria 647
33 Ga0070668_100464256 3300005347 Bacteria 1091
34 Ga0070671_100803063 3300005355 Bacteria 819
35 Ga0070659_100189048 3300005366 Bacteria 1692
36 Ga0070667_100220124 3300005367 Bacteria 1690
37 Ga0070709_10174650 3300005434 Bacteria 1504
38 Ga0070713_100077968 3300005436 Bacteria 2819
39 Ga0070662_100024597 3300005457 Bacteria 4151
40 Ga0068867_102134257 3300005459 Bacteria 531
41 Ga0070707_100691281 3300005468 Bacteria 983
42 Ga0070698_100333283 3300005471 Bacteria 1449
43 Ga0070665_100536311 3300005548 Bacteria 1182
44 Ga0070665_101192046 3300005548 Bacteria 772
45 Ga0070704_100133103 3300005549 Bacteria 1930
46 Ga0068854_100900164 3300005578 Bacteria 778
47 Ga0068854_101276747 3300005578 Bacteria 660
48 Ga0068852_100392273 3300005616 Bacteria 1364
49 Ga0068859_100914047 3300005617 Bacteria 962
50 Ga0068859_100985410 3300005617 Bacteria 925
51 Ga0068859_101923231 3300005617 Bacteria 653
52 Ga0068862_100126678 3300005844 Bacteria 2255
53 Ga0068862_100550882 3300005844 Bacteria 1101
54 Ga0075364_10444275 3300006051 Bacteria 886
55 Ga0075432_10061782 3300006058 Bacteria 1335
56 Ga0075366_10425718 3300006195 Bacteria 818
57 Ga0075431_100010649 3300006847 Bacteria 9243
58 Ga0075431_100256447 3300006847 Bacteria 1776
59 Ga0075434_100304445 3300006871 Bacteria 1614
60 Ga0097620_100913824 3300006931 Bacteria 962
61 Ga0097620_100985282 3300006931 Bacteria 925
62 Ga0097620_101924147 3300006931 Bacteria 653
63 Ga0079104_1029942 3300006946 Bacteria 1366
64 Ga0075435_100199990 3300007076 Bacteria 1693
65 Ga0105247_11561544 3300009101 Bacteria 540
66 Ga0114129_10476432 3300009147 Bacteria 1634
67 Ga0105243_10197736 3300009148 Bacteria 1761
68 Ga0105249_10977088 3300009553 Bacteria 915
69 Ga0105249_11081600 3300009553 Bacteria 872
70 Ga0157378_10388803 3300013297 Bacteria 1372
71 Ga0197907_10558889 3300020069 Bacteria 2372
72 Ga0206355_1190750 3300020076 Bacteria 2369
73 Ga0206350_11158194 3300020080 Bacteria 2380
74 Ga0206354_11128637 3300020081 Bacteria 1271
75 Ga0206353_11553818 3300020082 Bacteria 730
76 Ga0224712_10015766 3300022467 Bacteria 2466
77 Ga0209435_100047 3300025206 Bacteria 92749
78 Ga0207425_1008311 3300025245 Bacteria 2665
79 Ga0207425_1015815 3300025245 Bacteria 1685
80 Ga0207425_1057495 3300025245 Bacteria 693
81 Ga0209646_1000038 3300025246 Bacteria 353982
82 Ga0209026_1000180 3300025250 Bacteria 94396
83 Ga0209759_1000205 3300025256 Bacteria 92894
84 Ga0209129_1027855 3300025258 Bacteria 964
85 Ga0209565_1000016 3300025263 Bacteria 477707
86 Ga0209565_1007248 3300025263 Bacteria 3011
87 Ga0209673_1000495 3300025273 Bacteria 65000
88 Ga0209130_1000040 3300025284 Bacteria 262926
89 Ga0209130_1000354 3300025284 Bacteria 52516
90 Ga0209675_1000122 3300025291 Bacteria 106769
91 Ga0209675_1047196 3300025291 Bacteria 906
92 Ga0209676_1000395 3300025292 Bacteria 79555
93 Ga0209676_1007866 3300025292 Bacteria 4897
94 Ga0209676_1065839 3300025292 Bacteria 881
95 Ga0209025_1008715 3300025294 Bacteria 7233
96 Ga0209025_1020298 3300025294 Bacteria 3643
97 Ga0209025_1029250 3300025294 Bacteria 2673
98 Ga0209025_1100568 3300025294 Bacteria 916
99 Ga0209025_1121473 3300025294 Bacteria 779
100 Ga0209564_1001246 3300025295 Bacteria 28344
101 Ga0209564_1001744 3300025295 Bacteria 20355
102 Ga0209758_1007698 3300025297 Bacteria 7238
103 Ga0209050_1000084 3300025298 Bacteria 263245
104 Ga0209050_1005630 3300025298 Bacteria 7768
105 Ga0209050_1033887 3300025298 Bacteria 1540
106 Ga0209256_1000313 3300025299 Bacteria 84424
107 Ga0209256_1054753 3300025299 Bacteria 949
108 Ga0207426_1000359 3300025302 Bacteria 82359
109 Ga0207426_1001223 3300025302 Bacteria 22633
110 Ga0209051_1000058 3300025303 Bacteria 263137
111 Ga0209051_1000454 3300025303 Bacteria 54312
112 Ga0209257_1000022 3300025304 Bacteria 765258
113 Ga0209257_1000092 3300025304 Bacteria 263137
114 Ga0207699_10171532 3300025906 Unclassified 1452
115 Ga0207660_11234936 3300025917 Bacteria 608
116 Ga0207646_11235764 3300025922 Bacteria 654
117 Ga0207700_10385853 3300025928 Bacteria 1226
118 Ga0207644_10585779 3300025931 Bacteria 925
119 Ga0207690_10482845 3300025932 Bacteria 1000
120 Ga0207706_10000439 3300025933 Bacteria 44418
121 Ga0207668_10132364 3300025972 Bacteria 1906
122 Ga0207640_11841406 3300025981 Bacteria 547
123 Ga0207658_10237913 3300025986 Bacteria 1541
124 Ga0207639_10324730 3300026041 Bacteria 1367
125 Ga0207648_11784161 3300026089 Bacteria 577
126 Ga0207674_10898953 3300026116 Bacteria 854
127 Ga0268266_10915251 3300028379 Bacteria 848
128 Ga0268265_10157134 3300028380 Bacteria 1926
129 Ga0268265_10932536 3300028380 Bacteria 854
130 Ga0265332_10000005 3300031238 Bacteria 377525
131 Ga0307513_10000070 3300031456 Bacteria 139895
132 Ga0307513_10000072 3300031456 Bacteria 138840
133 Ga0307513_10286135 3300031456 Bacteria 1423
134 Ga0307408_100016984 3300031548 Bacteria 4866
135 Ga0307516_10008280 3300031730 Bacteria 11794
136 Ga0307516_10094859 3300031730 Bacteria 2807
137 Ga0307516_10136100 3300031730 Bacteria 2231
138 Ga0307405_10148526 3300031731 Bacteria 1645
139 Ga0307410_10367053 3300031852 Bacteria 1155
140 Ga0307410_10831803 3300031852 Bacteria 787
141 Ga0307406_10367753 3300031901 Bacteria 1129
142 Ga0307412_10977562 3300031911 Bacteria 747
143 Ga0307416_100924198 3300032002 Bacteria 973
144 Ga0373940_0054469 3300035088 Bacteria 1131
145 Ga0373951_0157188 3300035091 Bacteria 641
146 Ga0439436_0044231 3300041404 Bacteria 1269
147 Ga0451789_0728777 3300041443 Bacteria 708
148 Ga0451791_0238609 3300041451 Bacteria 599
149 Ga0451797_1393286 3300041453 Bacteria 697
150 Ga0451807_0018555 3300041486 Bacteria 1064
151 Ga0439433_0044838 3300041999 Bacteria 1034
152 Ga0439449_0000171 3300042007 Bacteria 22436
153 Ga0439449_0082645 3300042007 Bacteria 1185
154 Ga0439451_120773 3300042009 Bacteria 533
155 Ga0439462_0005486 3300042015 Bacteria 3127
156 Ga0450912_017246 3300042116 Bacteria 674
157 Ga0439460_0214996 3300042461 Bacteria 658
158 Ga0451577_0005030 3300042876 Bacteria 13670
159 Ga0451577_0479063 3300042876 Bacteria 1130
160 Ga0451577_0526423 3300042876 Bacteria 1073
161 Ga0451577_0729372 3300042876 Bacteria 897
162 Ga0451577_0775641 3300042876 Bacteria 867
163 Ga0466969_0000080 3300044656 Bacteria 51012
164 Ga0466969_0218506 3300044656 Bacteria 867
165 Ga0466972_0000388 3300044658 Bacteria 23520
166 Ga0466972_0632850 3300044658 Bacteria 506
167 Ga0453683_0003217 3300044673 Bacteria 12148
168 Ga0453683_0004154 3300044673 Bacteria 10369
169 Ga0466965_0009264 3300044683 Bacteria 4576
170 Ga0466966_0005303 3300044684 Bacteria 8477
171 Ga0466966_0009016 3300044684 Bacteria 6611
172 Ga0466961_0009757 3300044693 Bacteria 6110
173 Ga0466964_0249366 3300044706 Bacteria 875
174 Ga0453684_0006276 3300044712 Bacteria 22752
175 Ga0453684_0035398 3300044712 Bacteria 6901
176 Ga0453684_1536820 3300044712 Bacteria 685
177 Ga0466971_0065850 3300044719 Bacteria 1641
178 Ga0466970_0216257 3300044765 Bacteria 1069
179 Ga0466959_0067296 3300045049 Bacteria 2597
180 Ga0451576_0003410 3300045051 Bacteria 21876
181 Ga0451576_0007650 3300045051 Bacteria 12845
182 Ga0451576_0291281 3300045051 Bacteria 1707
183 Ga0451576_0589453 3300045051 Bacteria 1168
184 Ga0451576_2046172 3300045051 Bacteria 589
185 Ga0495603_0158729 3300046455 Bacteria 1312
186 Ga0495598_0438483 3300046537 Bacteria 515
187 Ga0495615_0215294 3300048090 Bacteria 598
188 Ga0496102_0583782 3300048905 Bacteria 1040
189 Ga0496102_1116279 3300048905 Bacteria 708
190 Ga0496110_0167164 3300048913 Bacteria 1995
191 Ga0501300_082071 3300049523 Bacteria 532
192 Ga0501032_0783243 3300049569 Bacteria 603
193 Ga0501033_0072603 3300049570 Bacteria 2527
194 Ga0501033_0099107 3300049570 Bacteria 2127
195 Ga0501034_0061539 3300049571 Bacteria 3769
196 Ga0501034_0136970 3300049571 Bacteria 2429
197 Ga0501036_0073662 3300049572 Bacteria 2887
198 Ga0501036_0718855 3300049572 Bacteria 825
199 Ga0501037_0270574 3300049573 Bacteria 1186
200 Ga0501039_1464702 3300049575 Bacteria 525
201 Ga0501043_0056940 3300049579 Bacteria 3070
202 Ga0501043_0702435 3300049579 Bacteria 739
203 Ga0501047_0112972 3300049581 Bacteria 2598
204 Ga0501047_0210718 3300049581 Bacteria 1802
205 Ga0501047_0418947 3300049581 Bacteria 1171
206 Ga0501047_0879229 3300049581 Bacteria 710
207 Ga0501048_0623029 3300049582 Bacteria 775
208 Ga0501067_0545579 3300049583 Bacteria 649
209 Ga0501068_0609243 3300049584 Bacteria 712
210 Ga0501071_0144997 3300049587 Bacteria 1770
211 Ga0501072_0134879 3300049588 Bacteria 1968
212 Ga0501073_0054217 3300049589 Bacteria 2807
213 Ga0501075_0062159 3300049591 Bacteria 2815
214 Ga0501076_0078703 3300049592 Bacteria 2646
215 Ga0501076_0871750 3300049592 Bacteria 742
216 Ga0501077_0160977 3300049593 Bacteria 1425
217 Ga0501077_0215978 3300049593 Bacteria 1219
218 Ga0501225_0260566 3300049705 Bacteria 574
219 Ga0501079_0422677 3300049741 Bacteria 1046
220 Ga0501079_1652287 3300049741 Bacteria 504
221 Ga0501080_0090780 3300049742 Bacteria 2837
222 Ga0501080_0996391 3300049742 Bacteria 727
223 Ga0501083_0592903 3300049744 Bacteria 721
224 Ga0501035_0441649 3300049822 Bacteria 1077
225 Ga0501044_0016456 3300049823 Bacteria 7938
226 Ga0501044_0197083 3300049823 Bacteria 1973
227 Ga0501044_0853357 3300049823 Bacteria 787
228 Ga0501044_1197992 3300049823 Bacteria 627
229 Ga0501045_0374416 3300049824 Bacteria 1060
230 Ga0501045_0510463 3300049824 Bacteria 893
231 nmdc:mga03683_441271_c1 3300050489 Bacteria 625
232 nmdc:mga00v17_404919_c1 3300050491 Bacteria 886
233 nmdc:mga0yw44_355671_c1 3300050492 Bacteria 986
234 nmdc:mga0k408_366045_c1 3300050493 Bacteria 859
235 nmdc:mga05p37_2183134_c1 3300050507 Bacteria 515
236 nmdc:mga09592_308839_c1 3300050508 Bacteria 1371
237 nmdc:mga06r32_69874_c1 3300050510 Bacteria 3395
238 Ga0500644_0042511 3300053088 Bacteria 1515
239 Ga0500566_0063961 3300053094 Bacteria 2077
240 Ga0500593_000627 3300053117 Bacteria 13548
241 Ga0500604_0295265 3300053151 Bacteria 562
242 Ga0500645_001312 3300053730 Bacteria 12902
243 Ga0500645_095877 3300053730 Bacteria 839
244 Ga0500645_101314 3300053730 Bacteria 812
245 Ga0501084_0192463 3300054114 Bacteria 1721
246 Ga0500661_002137 3300055283 Bacteria 3728
247 Ga0590074_010784 3300059423 Bacteria 1529
248 Ga0590077_014197 3300059426 Bacteria 1658
249 Ga0501082_0132866 3300060353 Bacteria 2159
250 Ga0466962_0029884 3300061719 Bacteria 2609
251 Ga0530510_0104015 3300061734 Bacteria 2077
252 Ga0530510_1252020 3300061734 Bacteria 569
253 2511244441 2511231002 Bacteria 5042903
254 2834580796 2834578030 Bacteria 3530182
255 2919708410 2919704043 Bacteria 5560311
256 2996314726 2996310559 Bacteria 6357320
257 Ga0075365_10220801
258 MRS1b_contig_3250830
259 JGI25155J39150_1000059
260 JGI25156J39149_1000081
261 JGI25154J39366_1000109
262 JGI25157J39369_1000103
263 JGI25159J45721_1000246
264 JGI25159J45721_1023333
265 JGI25151J46595_10003461
266 JGI25151J46595_10047649
267 JGI25160J50197_1000451
268 JGI25161J50226_1000077
269 Ga0055526_1015582
270 Ga0055526_1021290
271 Ga0055537_1000872
272 Ga0055524_1000344
273 Ga0055534_1001218
274 Ga0055528_1000729
275 Ga0055530_10000853
276 Ga0055530_10023756
277 Ga0055540_1000139
278 Ga0055540_1005099
279 Ga0055531_10001011
280 Ga0055531_10001428
281 Ga0055543_1002213
282 Ga0065165_1032134
283 Ga0065712_10074751
284 Ga0065715_10125655
285 Ga0070690_100621272
286 Ga0070666_10418855
287 Ga0070660_100910441
288 Ga0070689_101331409
289 Ga0070668_100464256
290 Ga0070671_100803063
291 Ga0070659_100189048
292 Ga0070667_100220124
293 Ga0070709_10174650
294 Ga0070713_100077968
295 Ga0070662_100024597
296 Ga0068867_102134257
297 Ga0070707_100691281
298 Ga0070698_100333283
299 Ga0070665_100536311
300 Ga0070665_101192046
301 Ga0070704_100133103
302 Ga0068854_100900164
303 Ga0068854_101276747
304 Ga0068852_100392273
305 Ga0068859_100914047
306 Ga0068859_100985410
307 Ga0068859_101923231
308 Ga0068862_100126678
309 Ga0068862_100550882
310 Ga0075364_10444275
311 Ga0075432_10061782
312 Ga0075366_10425718
313 Ga0075431_100010649
314 Ga0075431_100256447
315 Ga0075434_100304445
316 Ga0097620_100913824
317 Ga0097620_100985282
318 Ga0097620_101924147
319 Ga0079104_1029942
320 Ga0075435_100199990
321 Ga0105247_11561544
322 Ga0114129_10476432
323 Ga0105243_10197736
324 Ga0105249_10977088
325 Ga0105249_11081600
326 Ga0157378_10388803
327 Ga0197907_10558889
328 Ga0206355_1190750
329 Ga0206350_11158194
330 Ga0206354_11128637
331 Ga0206353_11553818
332 Ga0224712_10015766
333 Ga0209435_100047
334 Ga0207425_1008311
335 Ga0207425_1015815
336 Ga0207425_1057495
337 Ga0209646_1000038
338 Ga0209026_1000180
339 Ga0209759_1000205
340 Ga0209129_1027855
341 Ga0209565_1000016
342 Ga0209565_1007248
343 Ga0209673_1000495
344 Ga0209130_1000040
345 Ga0209130_1000354
346 Ga0209675_1000122
347 Ga0209675_1047196
348 Ga0209676_1000395
349 Ga0209676_1007866
350 Ga0209676_1065839
351 Ga0209025_1008715
352 Ga0209025_1020298
353 Ga0209025_1029250
354 Ga0209025_1100568
355 Ga0209025_1121473
356 Ga0209564_1001246
357 Ga0209564_1001744
358 Ga0209758_1007698
359 Ga0209050_1000084
360 Ga0209050_1005630
361 Ga0209050_1033887
362 Ga0209256_1000313
363 Ga0209256_1054753
364 Ga0207426_1000359
365 Ga0207426_1001223
366 Ga0209051_1000058
367 Ga0209051_1000454
368 Ga0209257_1000022
369 Ga0209257_1000092
370 Ga0207699_10171532
371 Ga0207660_11234936
372 Ga0207646_11235764
373 Ga0207700_10385853
374 Ga0207644_10585779
375 Ga0207690_10482845
376 Ga0207706_10000439
377 Ga0207668_10132364
378 Ga0207640_11841406
379 Ga0207658_10237913
380 Ga0207639_10324730
381 Ga0207648_11784161
382 Ga0207674_10898953
383 Ga0268266_10915251
384 Ga0268265_10157134
385 Ga0268265_10932536
386 Ga0265332_10000005
387 Ga0307513_10000070
388 Ga0307513_10000072
389 Ga0307513_10286135
390 Ga0307408_100016984
391 Ga0307516_10008280
392 Ga0307516_10094859
393 Ga0307516_10136100
394 Ga0307405_10148526
395 Ga0307410_10367053
396 Ga0307410_10831803
397 Ga0307406_10367753
398 Ga0307412_10977562
399 Ga0307416_100924198
400 Ga0373940_0054469
401 Ga0373951_0157188
402 Ga0439436_0044231
403 Ga0451789_0728777
404 Ga0451791_0238609
405 Ga0451797_1393286
406 Ga0451807_0018555
407 Ga0439433_0044838
408 Ga0439449_0000171
409 Ga0439449_0082645
410 Ga0439451_120773
411 Ga0439462_0005486
412 Ga0450912_017246
413 Ga0439460_0214996
414 Ga0451577_0005030
415 Ga0451577_0479063
416 Ga0451577_0526423
417 Ga0451577_0729372
418 Ga0451577_0775641
419 Ga0466969_0000080
420 Ga0466969_0218506
421 Ga0466972_0000388
422 Ga0466972_0632850
423 Ga0453683_0003217
424 Ga0453683_0004154
425 Ga0466965_0009264
426 Ga0466966_0005303
427 Ga0466966_0009016
428 Ga0466961_0009757
429 Ga0466964_0249366
430 Ga0453684_0006276
431 Ga0453684_0035398
432 Ga0453684_1536820
433 Ga0466971_0065850
434 Ga0466970_0216257
435 Ga0466959_0067296
436 Ga0451576_0003410
437 Ga0451576_0007650
438 Ga0451576_0291281
439 Ga0451576_0589453
440 Ga0451576_2046172
441 Ga0495603_0158729
442 Ga0495598_0438483
443 Ga0495615_0215294
444 Ga0496102_0583782
445 Ga0496102_1116279
446 Ga0496110_0167164
447 Ga0501300_082071
448 Ga0501032_0783243
449 Ga0501033_0072603
450 Ga0501033_0099107
451 Ga0501034_0061539
452 Ga0501034_0136970
453 Ga0501036_0073662
454 Ga0501036_0718855
455 Ga0501037_0270574
456 Ga0501039_1464702
457 Ga0501043_0056940
458 Ga0501043_0702435
459 Ga0501047_0112972
460 Ga0501047_0210718
461 Ga0501047_0418947
462 Ga0501047_0879229
463 Ga0501048_0623029
464 Ga0501067_0545579
465 Ga0501068_0609243
466 Ga0501071_0144997
467 Ga0501072_0134879
468 Ga0501073_0054217
469 Ga0501075_0062159
470 Ga0501076_0078703
471 Ga0501076_0871750
472 Ga0501077_0160977
473 Ga0501077_0215978
474 Ga0501225_0260566
475 Ga0501079_0422677
476 Ga0501079_1652287
477 Ga0501080_0090780
478 Ga0501080_0996391
479 Ga0501083_0592903
480 Ga0501035_0441649
481 Ga0501044_0016456
482 Ga0501044_0197083
483 Ga0501044_0853357
484 Ga0501044_1197992
485 Ga0501045_0374416
486 Ga0501045_0510463
487 nmdc:mga03683_441271_c1
488 nmdc:mga00v17_404919_c1
489 nmdc:mga0yw44_355671_c1
490 nmdc:mga0k408_366045_c1
491 nmdc:mga05p37_2183134_c1
492 nmdc:mga09592_308839_c1
493 nmdc:mga06r32_69874_c1
494 Ga0500644_0042511
495 Ga0500566_0063961
496 Ga0500593_000627
497 Ga0500604_0295265
498 Ga0500645_001312
499 Ga0500645_095877
500 Ga0500645_101314
501 Ga0501084_0192463
502 Ga0500661_002137
503 Ga0590074_010784
504 Ga0590077_014197
505 Ga0501082_0132866
506 Ga0466962_0029884
507 Ga0530510_0104015
508 Ga0530510_1252020
509 2511244441
510 2834580796
511 2919708410
512 2996314726

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00581

Rhodanese

Rhodanese-like domain

22

123

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hhg-assembly1.cif.gz_A structure of protein of unknown function rpa3614, possible tyrosine phosphatase, from rhodopseudomonas palustris cga009 0.9663 1 128
2hhg-assembly1.cif.gz_A structure of protein of unknown function rpa3614, possible tyrosine phosphatase, from rhodopseudomonas palustris cga009 0.9309 1 128
3gk5-assembly1.cif.gz_A crystal structure of rhodanese-related protein (tvg0868615) from thermoplasma volcanium, northeast structural genomics consortium target tvr109a 0.9121 21 128
5ve4-assembly2.cif.gz_B crystal structure of persulfide dioxygenase-rhodanese fusion protein with rhodanese domain inactivating mutation (c314s) from burkholderia phytofirmans 0.9061 22 128
3foj-assembly1.cif.gz_A crystal structure of ssp1007 from staphylococcus saprophyticus subsp. saprophyticus. northeast structural genomics target syr101a. 0.8852 21 120
ID Description Score Start End Superfamily
2hhgA00 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.941 1 128 3.40.250.10
2hhgA00 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.9339 1 128 3.40.250.10
3gk5A00 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.9121 21 128 3.40.250.10
af_O53414_1_124_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.9031 6 124 3.40.250.10
3ntaA03 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.8958 19 123 3.40.250.10
ID Description Score Start End GO Terms
AF-A0A0Q8REZ1-F1-model_v4 Rhodanese 0.9873 5 133 GO:0004792
AF-A0A0R2U0F8-F1-model_v4 Rhodanese 0.9846 5 117 GO:0004792
AF-A0A1I7EFH7-F1-model_v4 Rhodanese-related sulfurtransferase 0.9814 32 133 GO:0004792
AF-A0A4Q7FZ23-F1-model_v4 Rhodanese 0.9783 1 133 GO:0004792
AF-A0A2E6ME15-F1-model_v4 deleted 0.9764 4 131

Map