F366406

General Info

Members Datasets Scaffolds Average Seq Length
256 155 256 302

Family's Representative Sequence

Representative Sequence 3300006881|Ga0068865_100144936|Ga0068865_1001449362
Length 328
Sequence MAHMRSDAIASKPVSVKESVMRALKLLLCTAAVVAGLASPAFAAVKVVATTEDLAAIAREVGGDRVEVTALAKGYQDPHFVEPKPSFILAVSRADLLVVVGRELEIGWLPTLITSSRNAKIQPGAAGYLDASLNVKILEIPTGQLTRAMGDVHPQGNPHYWLDPGNGRLIAQAVRDRLTQLDAAGKAVYQQRYDDFDKRLAVAEKRWDAAMAPYKGTKLVTYHRSWPNFMERFGLQVMGYVEPKPGIPPSPSHTLELISDMKAQGVKLIVVEPYFDKKTPAAIAAQIGGTVLELAPSVGGEKTVTDYISLFDYDVKLLQGALKQITGR

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
76 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
77 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
78 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
79 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
80 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
81 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
82 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
83 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
84 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
85 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
87 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
88 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
89 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
90 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
91 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
92 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
93 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
94 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
95 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
96 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
97 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
98 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
99 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
100 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
101 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
102 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
103 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
104 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
105 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
121 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
122 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
123 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
124 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
125 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
126 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
127 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
128 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
129 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
130 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
131 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
132 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
133 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
134 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
135 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
138 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
139 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
140 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
141 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
142 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
143 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
144 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
145 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
146 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
147 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
148 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
149 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
150 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
151 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
152 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
153 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
154 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
155 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.08
Nodule 0
Rhizoplane 0.78
Rhizosphere 93.75
Stem 0
Stem Tuber 0
Unclassified 0.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10004831 3300002459 Bacteria 2743
2 Ga0065712_10006750 3300005290 Bacteria 5079
3 Ga0065712_10093423 3300005290 Unclassified 2293
4 Ga0065712_10101694 3300005290 Bacteria 2027
5 Ga0065712_10111839 3300005290 Bacteria 1806
6 Ga0065715_10030729 3300005293 Bacteria 1317
7 Ga0070676_10128749 3300005328 Bacteria 1598
8 Ga0070677_10005418 3300005333 Bacteria 4204
9 Ga0070682_100155335 3300005337 Unclassified 1574
10 Ga0070689_100004813 3300005340 Bacteria 9159
11 Ga0070689_100067820 3300005340 Unclassified 2782
12 Ga0070675_100274878 3300005354 Bacteria 1479
13 Ga0070671_100177983 3300005355 Bacteria 1800
14 Ga0070674_100006460 3300005356 Bacteria 6843
15 Ga0070673_100012620 3300005364 Bacteria 5807
16 Ga0070673_100373938 3300005364 Bacteria 1269
17 Ga0070688_100030083 3300005365 Unclassified 3256
18 Ga0070688_100063483 3300005365 Bacteria 2341
19 Ga0070667_100000241 3300005367 Bacteria 62038
20 Ga0070713_100171707 3300005436 Bacteria 1943
21 Ga0070701_10021651 3300005438 Unclassified 3071
22 Ga0070705_100349511 3300005440 Bacteria 1077
23 Ga0070694_100026428 3300005444 Archaea 3761
24 Ga0070708_100455368 3300005445 Unclassified 1207
25 Ga0068867_100114960 3300005459 Bacteria 2072
26 Ga0070685_10006281 3300005466 Bacteria 6055
27 Ga0070685_10021925 3300005466 Bacteria 3476
28 Ga0070706_100202126 3300005467 Unclassified 1856
29 Ga0070707_100461550 3300005468 Unclassified 1231
30 Ga0070698_100022903 3300005471 Bacteria 6531
31 Ga0070698_100179623 3300005471 Bacteria 2055
32 Ga0070699_100019639 3300005518 Bacteria 5822
33 Ga0070699_100292270 3300005518 Unclassified 1461
34 Ga0070672_100132599 3300005543 Bacteria 2049
35 Ga0070704_100424169 3300005549 Unclassified 1140
36 Ga0068857_100182150 3300005577 Bacteria 1912
37 Ga0068852_100365075 3300005616 Bacteria 1413
38 Ga0068859_100003521 3300005617 Bacteria 15940
39 Ga0068864_100081703 3300005618 Bacteria 2833
40 Ga0068858_100096405 3300005842 Bacteria 2756
41 Ga0070717_10222368 3300006028 Unclassified 1660
42 Ga0075365_10093531 3300006038 Unclassified 2051
43 Ga0075368_10027665 3300006042 Unclassified 2189
44 Ga0075364_10094604 3300006051 Bacteria 1986
45 Ga0075362_10006828 3300006177 Bacteria 4273
46 Ga0075366_10013405 3300006195 Bacteria 4666
47 Ga0097621_100126155 3300006237 Unclassified 2174
48 Ga0068871_100174198 3300006358 Bacteria 1846
49 Ga0068871_100507009 3300006358 Bacteria 1088
50 Ga0075428_100000056 3300006844 Bacteria 89990
51 Ga0075428_100002102 3300006844 Bacteria 21471
52 Ga0075428_100052025 3300006844 Bacteria 4491
53 Ga0075430_100016386 3300006846 Bacteria 6311
54 Ga0075431_100016804 3300006847 Bacteria 7432
55 Ga0075431_100594318 3300006847 Bacteria 1091
56 Ga0075433_10526426 3300006852 Bacteria 1040
57 Ga0075429_100002201 3300006880 Bacteria 16306
58 Ga0068865_100144936 3300006881 Bacteria 1795
59 Ga0097620_100003521 3300006931 Bacteria 15940
60 Ga0097620_100457158 3300006931 Bacteria 1373
61 Ga0075435_100063540 3300007076 Unclassified 2998
62 Ga0075435_100197237 3300007076 Bacteria 1705
63 Ga0111539_10000002 3300009094 Bacteria 983359
64 Ga0111539_10000159 3300009094 Bacteria 76817
65 Ga0111539_10006554 3300009094 Bacteria 15005
66 Ga0111539_10013592 3300009094 Bacteria 10175
67 Ga0111539_10032609 3300009094 Bacteria 6324
68 Ga0111539_10072391 3300009094 Unclassified 4065
69 Ga0111539_10309568 3300009094 Unclassified 1838
70 Ga0114129_10000023 3300009147 Bacteria 116820
71 Ga0114129_10003099 3300009147 Bacteria 23319
72 Ga0114129_10038400 3300009147 Bacteria 6755
73 Ga0105248_10127167 3300009177 Bacteria 2875
74 Ga0105248_10168184 3300009177 Bacteria 2471
75 Ga0105248_10354977 3300009177 Bacteria 1651
76 Ga0105248_10507020 3300009177 Unclassified 1360
77 Ga0105249_10199037 3300009553 Bacteria 1960
78 Ga0105239_10044363 3300010375 Unclassified 4875
79 Ga0157369_10093991 3300013105 Unclassified 3201
80 Ga0157378_10236384 3300013297 Bacteria 1744
81 Ga0157375_10356227 3300013308 Bacteria 1629
82 Ga0163163_10034484 3300014325 Bacteria 4902
83 Ga0163163_10349391 3300014325 Bacteria 1535
84 Ga0157380_10013473 3300014326 Bacteria 5962
85 Ga0157380_10102235 3300014326 Unclassified 2389
86 Ga0157380_10104388 3300014326 Bacteria 2367
87 Ga0157380_10172139 3300014326 Bacteria 1893
88 Ga0157380_10237468 3300014326 Bacteria 1641
89 Ga0157376_10041955 3300014969 Unclassified 3749
90 Ga0207647_10044524 3300025904 Unclassified 2772
91 Ga0207684_10166274 3300025910 Unclassified 1901
92 Ga0207660_10187423 3300025917 Bacteria 1609
93 Ga0207650_10392511 3300025925 Bacteria 1147
94 Ga0207700_10140008 3300025928 Unclassified 1987
95 Ga0207644_10071543 3300025931 Bacteria 2538
96 Ga0207706_10023354 3300025933 Bacteria 5554
97 Ga0207686_10346802 3300025934 Bacteria 1117
98 Ga0207670_10020624 3300025936 Bacteria 4054
99 Ga0207670_10064805 3300025936 Bacteria 2506
100 Ga0207691_10047586 3300025940 Bacteria 3935
101 Ga0207711_10077003 3300025941 Bacteria 2906
102 Ga0207651_10008569 3300025960 Bacteria 5532
103 Ga0207658_10040571 3300025986 Bacteria 3366
104 Ga0207703_10081433 3300026035 Bacteria 2699
105 Ga0207708_10050720 3300026075 Bacteria 3159
106 Ga0207708_10205990 3300026075 Bacteria 1571
107 Ga0207683_10289889 3300026121 Bacteria 1496
108 Ga0207683_10405897 3300026121 Bacteria 1254
109 Ga0207428_10000004 3300027907 Bacteria 727800
110 Ga0207428_10005911 3300027907 Bacteria 11332
111 Ga0207428_10007840 3300027907 Bacteria 9713
112 Ga0207428_10009089 3300027907 Bacteria 8934
113 Ga0207428_10176126 3300027907 Bacteria 1618
114 Ga0307513_10006796 3300031456 Bacteria 14918
115 Ga0307405_10055817 3300031731 Bacteria 2474
116 Ga0307406_10129874 3300031901 Unclassified 1767
117 Ga0307409_100127580 3300031995 Unclassified 2167
118 Ga0307409_100263142 3300031995 Unclassified 1584
119 Ga0307409_100290118 3300031995 Bacteria 1517
120 Ga0307411_10146849 3300032005 Bacteria 1747
121 Ga0373953_0028851 3300035117 Unclassified 2143
122 Ga0373954_0007706 3300035118 Bacteria 4713
123 Ga0316574_0053913 3300035398 Bacteria 2511
124 Ga0373935_0381897 3300035692 Unclassified 1009
125 Ga0373937_0021200 3300036401 Bacteria 5831
126 Ga0395900_0392469 3300037418 Bacteria 1354
127 Ga0395905_0077940 3300037471 Bacteria 3105
128 Ga0395905_0162273 3300037471 Bacteria 2100
129 Ga0451576_0020829 3300045051 Bacteria 7136
130 Ga0451576_0032553 3300045051 Bacteria 5549
131 Ga0451576_0085500 3300045051 Bacteria 3281
132 Ga0451576_0105260 3300045051 Bacteria 2935
133 Ga0451576_0454131 3300045051 Bacteria 1345
134 Ga0495603_0022932 3300046455 Unclassified 3778
135 Ga0495629_0025888 3300046459 Bacteria 4168
136 Ga0495638_0002027 3300046460 Bacteria 17231
137 Ga0495638_0014080 3300046460 Bacteria 5417
138 Ga0495594_0032346 3300046499 Bacteria 2839
139 Ga0495587_0037946 3300046536 Unclassified 2891
140 Ga0495598_0009962 3300046537 Bacteria 2262
141 Ga0495598_0036787 3300046537 Bacteria 1409
142 Ga0495659_0003868 3300046664 Bacteria 4755
143 Ga0495659_0011395 3300046664 Unclassified 2865
144 Ga0495659_0012217 3300046664 Unclassified 2778
145 Ga0495588_0014854 3300046674 Bacteria 3737
146 Ga0495658_0044749 3300046683 Unclassified 2481
147 Ga0495581_0251262 3300047315 Unclassified 1034
148 Ga0495604_0151088 3300047317 Bacteria 1650
149 Ga0495636_0121109 3300047318 Unclassified 1157
150 Ga0495672_0020847 3300047320 Bacteria 4287
151 Ga0495676_0025407 3300047321 Bacteria 5115
152 Ga0495676_0128650 3300047321 Bacteria 1832
153 Ga0496109_0459576 3300048912 Bacteria 1202
154 Ga0496110_0117700 3300048913 Unclassified 2393
155 Ga0501031_0189139 3300049568 Bacteria 1344
156 Ga0501032_0011110 3300049569 Bacteria 6471
157 Ga0501032_0073954 3300049569 Bacteria 2270
158 Ga0501033_0085734 3300049570 Bacteria 2306
159 Ga0501034_0009076 3300049571 Bacteria 10443
160 Ga0501034_0011593 3300049571 Bacteria 9129
161 Ga0501034_0406107 3300049571 Bacteria 1284
162 Ga0501036_0006748 3300049572 Bacteria 9331
163 Ga0501036_0024759 3300049572 Bacteria 5060
164 Ga0501036_0054156 3300049572 Bacteria 3397
165 Ga0501036_0203406 3300049572 Unclassified 1665
166 Ga0501037_0058034 3300049573 Bacteria 2825
167 Ga0501037_0082117 3300049573 Bacteria 2335
168 Ga0501037_0148974 3300049573 Unclassified 1673
169 Ga0501038_0059314 3300049574 Unclassified 3278
170 Ga0501038_0124921 3300049574 Bacteria 2118
171 Ga0501039_0012530 3300049575 Bacteria 6477
172 Ga0501039_0078953 3300049575 Bacteria 2560
173 Ga0501039_0121580 3300049575 Unclassified 2046
174 Ga0501040_0001124 3300049576 Bacteria 16954
175 Ga0501040_0027184 3300049576 Bacteria 3851
176 Ga0501041_0035160 3300049577 Unclassified 3035
177 Ga0501042_0077088 3300049578 Unclassified 2386
178 Ga0501043_0038175 3300049579 Bacteria 3776
179 Ga0501043_0043343 3300049579 Bacteria 3537
180 Ga0501043_0081547 3300049579 Bacteria 2542
181 Ga0501043_0089863 3300049579 Unclassified 2414
182 Ga0501046_0014569 3300049580 Bacteria 6627
183 Ga0501046_0038165 3300049580 Unclassified 3857
184 Ga0501046_0198087 3300049580 Unclassified 1495
185 Ga0501047_0001543 3300049581 Bacteria 22532
186 Ga0501047_0034093 3300049581 Bacteria 4915
187 Ga0501047_0084912 3300049581 Bacteria 3042
188 Ga0501048_0043344 3300049582 Bacteria 3221
189 Ga0501067_0091535 3300049583 Bacteria 1688
190 Ga0501068_0059843 3300049584 Bacteria 2313
191 Ga0501069_0034577 3300049585 Bacteria 2783
192 Ga0501069_0131091 3300049585 Unclassified 1435
193 Ga0501070_0376939 3300049586 Bacteria 1149
194 Ga0501071_0013499 3300049587 Bacteria 5568
195 Ga0501072_0015318 3300049588 Bacteria 5881
196 Ga0501072_0016316 3300049588 Bacteria 5698
197 Ga0501072_0036701 3300049588 Bacteria 3843
198 Ga0501073_0073625 3300049589 Bacteria 2378
199 Ga0501073_0208195 3300049589 Bacteria 1351
200 Ga0501075_0015822 3300049591 Bacteria 5424
201 Ga0501076_0000974 3300049592 Bacteria 18753
202 Ga0501076_0005785 3300049592 Bacteria 8920
203 Ga0501076_0311825 3300049592 Bacteria 1290
204 Ga0501077_0092601 3300049593 Unclassified 1915
205 Ga0501233_024468 3300049668 Bacteria 1321
206 Ga0501079_0004897 3300049741 Bacteria 9924
207 Ga0501080_0002989 3300049742 Bacteria 14896
208 Ga0501080_0025129 3300049742 Bacteria 5529
209 Ga0501080_0155241 3300049742 Bacteria 2114
210 Ga0501080_0157685 3300049742 Bacteria 2096
211 Ga0501081_0033050 3300049743 Unclassified 3512
212 Ga0501083_0006136 3300049744 Bacteria 8522
213 Ga0501035_0010869 3300049822 Bacteria 8430
214 Ga0501035_0305117 3300049822 Bacteria 1340
215 Ga0501044_0001751 3300049823 Bacteria 25336
216 Ga0501045_0003210 3300049824 Bacteria 11177
217 Ga0501045_0265967 3300049824 Viruses 1277
218 nmdc:mga03683_8633_c1 3300050489 Bacteria 3590
219 nmdc:mga00v17_106015_c1 3300050491 Bacteria 1779
220 nmdc:mga00v17_36870_c1 3300050491 Bacteria 2917
221 nmdc:mga0yw44_31156_c1 3300050492 Bacteria 3098
222 nmdc:mga0k408_20478_c1 3300050493 Bacteria 3706
223 nmdc:mga0k408_56479_c1 3300050493 Unclassified 2278
224 nmdc:mga06z11_6207_c1 3300050494 Bacteria 4844
225 nmdc:mga05p37_300_c1 3300050507 Bacteria 51798
226 nmdc:mga05p37_3248_c1 3300050507 Bacteria 18933
227 nmdc:mga05p37_97045_c1 3300050507 Bacteria 3631
228 nmdc:mga09592_24378_c1 3300050508 Bacteria 5003
229 nmdc:mga09592_296873_c1 3300050508 Bacteria 1401
230 nmdc:mga09592_4121_c1 3300050508 Bacteria 11742
231 nmdc:mga0qj67_7542_c1 3300050509 Bacteria 8038
232 nmdc:mga06r32_13344_c1 3300050510 Bacteria 7441
233 nmdc:mga06r32_444453_c1 3300050510 Bacteria 1276
234 nmdc:mga06r32_80966_c1 3300050510 Unclassified 3161
235 nmdc:mga08y16_12984_c1 3300050511 Bacteria 8765
236 nmdc:mga08y16_1346_c1 3300050511 Bacteria 24536
237 nmdc:mga08y16_18000_c1 3300050511 Bacteria 7441
238 nmdc:mga08y16_232444_c1 3300050511 Unclassified 1907
239 nmdc:mga08y16_2_c1 3300050511 Bacteria 983367
240 nmdc:mga08y16_355666_c1 3300050511 Bacteria 1504
241 nmdc:mga08y16_39815_c1 3300050511 Bacteria 4930
242 nmdc:mga08y16_5113_c1 3300050511 Bacteria 13705
243 nmdc:mga0n895_177166_c1 3300050512 Bacteria 2163
244 nmdc:mga0n895_29527_c1 3300050512 Bacteria 5232
245 nmdc:mga0rr50_131145_c1 3300050513 Bacteria 2007
246 nmdc:mga0rr50_39975_c1 3300050513 Bacteria 3406
247 nmdc:mga0a205_37095_c1 3300050515 Bacteria 4687
248 Ga0495601_0134849 3300053077 Unclassified 1609
249 Ga0500568_0033741 3300053139 Unclassified 2098
250 Ga0501084_0007508 3300054114 Bacteria 8988
251 Ga0501084_0012243 3300054114 Bacteria 7102
252 Ga0501084_0215167 3300054114 Bacteria 1621
253 Ga0501082_0000568 3300060353 Bacteria 32870
254 Ga0501082_0201557 3300060353 Bacteria 1731
255 Ga0530510_0002752 3300061734 Bacteria 12078
256 Ga0530510_0026515 3300061734 Bacteria 4149

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005445 Ga0070708_100455368 Ga0070708_1004553682 258
2 3300005468 Ga0070707_100461550 Ga0070707_1004615502 258
3 3300006237 Ga0097621_100126155 Ga0097621_1001261552 258
4 3300045051 Ga0451576_0105260 Ga0451576_0105260_1970_2893 258
5 3300005467 Ga0070706_100202126 Ga0070706_1002021262 276
6 3300025910 Ga0207684_10166274 Ga0207684_101662742 276
7 3300007076 Ga0075435_100063540 Ga0075435_1000635402 278
8 3300045051 Ga0451576_0020829 Ga0451576_0020829_4929_5852 278
9 3300050512 nmdc:mga0n895_177166_c1 nmdc:mga0n895_177166_c1_815_1738 278
10 3300050513 nmdc:mga0rr50_131145_c1 nmdc:mga0rr50_131145_c1_74_997 278
11 3300005290 Ga0065712_10093423 Ga0065712_100934232 279
12 3300045051 Ga0451576_0032553 Ga0451576_0032553_567_1490 279
13 3300005328 Ga0070676_10128749 Ga0070676_101287491 280
14 3300005616 Ga0068852_100365075 Ga0068852_1003650752 280
15 3300005337 Ga0070682_100155335 Ga0070682_1001553352 281
16 3300005354 Ga0070675_100274878 Ga0070675_1002748782 281
17 3300005355 Ga0070671_100177983 Ga0070671_1001779832 281
18 3300006358 Ga0068871_100507009 Ga0068871_1005070092 281
19 3300009177 Ga0105248_10127167 Ga0105248_101271673 281
20 3300013297 Ga0157378_10236384 Ga0157378_102363841 281
21 3300013308 Ga0157375_10356227 Ga0157375_103562272 281
22 3300014325 Ga0163163_10034484 Ga0163163_100344843 281
23 3300025931 Ga0207644_10071543 Ga0207644_100715432 281
24 3300049580 Ga0501046_0038165 Ga0501046_0038165_330_1247 282
25 3300049572 Ga0501036_0006748 Ga0501036_0006748_1738_2655 283
26 3300049573 Ga0501037_0148974 Ga0501037_0148974_434_1351 283
27 3300049574 Ga0501038_0059314 Ga0501038_0059314_1466_2383 283
28 3300049575 Ga0501039_0012530 Ga0501039_0012530_3318_4235 283
29 3300049576 Ga0501040_0001124 Ga0501040_0001124_554_1471 283
30 3300049577 Ga0501041_0035160 Ga0501041_0035160_1311_2228 283
31 3300049578 Ga0501042_0077088 Ga0501042_0077088_821_1738 283
32 3300049579 Ga0501043_0081547 Ga0501043_0081547_1601_2518 283
33 3300049587 Ga0501071_0013499 Ga0501071_0013499_1505_2422 283
34 3300049588 Ga0501072_0015318 Ga0501072_0015318_4159_5076 283
35 3300049591 Ga0501075_0015822 Ga0501075_0015822_3562_4479 283
36 3300049592 Ga0501076_0000974 Ga0501076_0000974_5457_6374 283
37 3300049593 Ga0501077_0092601 Ga0501077_0092601_192_1109 283
38 3300049741 Ga0501079_0004897 Ga0501079_0004897_5700_6617 283
39 3300049742 Ga0501080_0025129 Ga0501080_0025129_3264_4181 283
40 3300049743 Ga0501081_0033050 Ga0501081_0033050_861_1778 283
41 3300049824 Ga0501045_0003210 Ga0501045_0003210_6990_7907 283
42 3300054114 Ga0501084_0007508 Ga0501084_0007508_4061_4978 283
43 3300060353 Ga0501082_0000568 Ga0501082_0000568_897_1814 283
44 3300061734 Ga0530510_0002752 Ga0530510_0002752_5401_6318 283
45 3300045051 Ga0451576_0085500 Ga0451576_0085500_1709_2632 284
46 3300006844 Ga0075428_100000056 Ga0075428_10000005646 287
47 3300006847 Ga0075431_100594318 Ga0075431_1005943182 287
48 3300009094 Ga0111539_10000002 Ga0111539_10000002266 287
49 3300027907 Ga0207428_10000004 Ga0207428_10000004390 287
50 3300035398 Ga0316574_0053913 Ga0316574_0053913_968_1846 287
51 3300050511 nmdc:mga08y16_2_c1 nmdc:mga08y16_2_c1_657030_657956 287
52 3300014326 Ga0157380_10172139 Ga0157380_101721392 290
53 3300005471 Ga0070698_100179623 Ga0070698_1001796232 292
54 3300037418 Ga0395900_0392469 Ga0395900_0392469_307_1185 292
55 3300037471 Ga0395905_0077940 Ga0395905_0077940_282_1160 292
56 3300035117 Ga0373953_0028851 Ga0373953_0028851_884_1801 293
57 3300035118 Ga0373954_0007706 Ga0373954_0007706_383_1300 293
58 3300036401 Ga0373937_0021200 Ga0373937_0021200_4136_5053 293
59 3300046536 Ga0495587_0037946 Ga0495587_0037946_86_1003 293
60 3300049569 Ga0501032_0073954 Ga0501032_0073954_506_1435 293
61 3300049570 Ga0501033_0085734 Ga0501033_0085734_362_1291 293
62 3300049572 Ga0501036_0054156 Ga0501036_0054156_1099_2028 293
63 3300049573 Ga0501037_0082117 Ga0501037_0082117_368_1297 293
64 3300049574 Ga0501038_0124921 Ga0501038_0124921_211_1140 293
65 3300049583 Ga0501067_0091535 Ga0501067_0091535_52_996 293
66 3300049586 Ga0501070_0376939 Ga0501070_0376939_130_1059 293
67 3300049588 Ga0501072_0016316 Ga0501072_0016316_4101_5045 293
68 3300049589 Ga0501073_0208195 Ga0501073_0208195_407_1336 293
69 3300049742 Ga0501080_0155241 Ga0501080_0155241_734_1663 293
70 3300049744 Ga0501083_0006136 Ga0501083_0006136_4538_5467 293
71 3300049822 Ga0501035_0010869 Ga0501035_0010869_6058_6987 293
72 3300053077 Ga0495601_0134849 Ga0495601_0134849_182_1099 293
73 3300054114 Ga0501084_0215167 Ga0501084_0215167_273_1202 293
74 3300005364 Ga0070673_100373938 Ga0070673_1003739382 294
75 3300006042 Ga0075368_10027665 Ga0075368_100276652 294
76 3300050491 nmdc:mga00v17_106015_c1 nmdc:mga00v17_106015_c1_21_983 294
77 3300050493 nmdc:mga0k408_56479_c1 nmdc:mga0k408_56479_c1_215_1177 294
78 3300014326 Ga0157380_10013473 Ga0157380_100134735 295
79 3300050511 nmdc:mga08y16_12984_c1 nmdc:mga08y16_12984_c1_2867_3754 295
80 3300050511 nmdc:mga08y16_355666_c1 nmdc:mga08y16_355666_c1_221_1108 295
81 3300050511 nmdc:mga08y16_39815_c1 nmdc:mga08y16_39815_c1_694_1581 295
82 3300005340 Ga0070689_100067820 Ga0070689_1000678202 297
83 3300005365 Ga0070688_100063483 Ga0070688_1000634832 297
84 3300005466 Ga0070685_10021925 Ga0070685_100219252 297
85 3300005543 Ga0070672_100132599 Ga0070672_1001325992 297
86 3300013105 Ga0157369_10093991 Ga0157369_100939913 297
87 3300025925 Ga0207650_10392511 Ga0207650_103925112 297
88 3300025940 Ga0207691_10047586 Ga0207691_100475862 297
89 3300026121 Ga0207683_10289889 Ga0207683_102898892 297
90 3300046537 Ga0495598_0009962 Ga0495598_0009962_719_1642 297
91 3300046664 Ga0495659_0003868 Ga0495659_0003868_1658_2581 297
92 3300014969 Ga0157376_10041955 Ga0157376_100419552 298
93 3300037471 Ga0395905_0162273 Ga0395905_0162273_931_1827 298
94 3300005333 Ga0070677_10005418 Ga0070677_100054183 299
95 3300031456 Ga0307513_10006796 Ga0307513_100067968 299
96 3300045051 Ga0451576_0454131 Ga0451576_0454131_199_1101 299
97 3300046460 Ga0495638_0002027 Ga0495638_0002027_3986_4885 299
98 3300005290 Ga0065712_10101694 Ga0065712_101016942 301
99 3300005340 Ga0070689_100004813 Ga0070689_10000481310 302
100 3300005364 Ga0070673_100012620 Ga0070673_1000126206 302
101 3300005466 Ga0070685_10006281 Ga0070685_100062814 302
102 3300005842 Ga0068858_100096405 Ga0068858_1000964052 302
103 3300009094 Ga0111539_10032609 Ga0111539_100326095 302
104 3300009177 Ga0105248_10168184 Ga0105248_101681842 302
105 3300025936 Ga0207670_10020624 Ga0207670_100206243 302
106 3300025941 Ga0207711_10077003 Ga0207711_100770032 302
107 3300025960 Ga0207651_10008569 Ga0207651_100085696 302
108 3300026035 Ga0207703_10081433 Ga0207703_100814332 302
109 3300027907 Ga0207428_10007840 Ga0207428_100078405 302
110 3300031995 Ga0307409_100263142 Ga0307409_1002631422 302
111 3300031995 Ga0307409_100290118 Ga0307409_1002901182 302
112 3300005290 Ga0065712_10111839 Ga0065712_101118392 303
113 3300005293 Ga0065715_10030729 Ga0065715_100307292 303
114 3300005367 Ga0070667_100000241 Ga0070667_10000024151 303
115 3300009553 Ga0105249_10199037 Ga0105249_101990372 303
116 3300035692 Ga0373935_0381897 Ga0373935_0381897_83_994 303
117 3300047321 Ga0495676_0128650 Ga0495676_0128650_167_1090 303
118 3300049576 Ga0501040_0027184 Ga0501040_0027184_2087_3016 303
119 3300049582 Ga0501048_0043344 Ga0501048_0043344_1730_2659 303
120 3300049592 Ga0501076_0005785 Ga0501076_0005785_6053_6982 303
121 3300061734 Ga0530510_0026515 Ga0530510_0026515_3099_4028 303
122 3300014326 Ga0157380_10237468 Ga0157380_102374682 304
123 3300025917 Ga0207660_10187423 Ga0207660_101874232 304
124 3300026075 Ga0207708_10050720 Ga0207708_100507202 304
125 3300026075 Ga0207708_10205990 Ga0207708_102059902 304
126 3300027907 Ga0207428_10176126 Ga0207428_101761262 304
127 3300050507 nmdc:mga05p37_97045_c1 nmdc:mga05p37_97045_c1_1516_2451 304
128 3300050508 nmdc:mga09592_296873_c1 nmdc:mga09592_296873_c1_68_1003 304
129 3300005438 Ga0070701_10021651 Ga0070701_100216512 305
130 3300005440 Ga0070705_100349511 Ga0070705_1003495111 305
131 3300005444 Ga0070694_100026428 Ga0070694_1000264281 305
132 3300005471 Ga0070698_100022903 Ga0070698_1000229031 305
133 3300005518 Ga0070699_100019639 Ga0070699_1000196395 305
134 3300007076 Ga0075435_100197237 Ga0075435_1001972371 305
135 3300009094 Ga0111539_10006554 Ga0111539_1000655411 305
136 3300009147 Ga0114129_10038400 Ga0114129_100384003 305
137 3300025904 Ga0207647_10044524 Ga0207647_100445242 305
138 3300027907 Ga0207428_10009089 Ga0207428_100090897 305
139 3300046455 Ga0495603_0022932 Ga0495603_0022932_1775_2704 305
140 3300046459 Ga0495629_0025888 Ga0495629_0025888_1483_2412 305
141 3300046499 Ga0495594_0032346 Ga0495594_0032346_1745_2674 305
142 3300046537 Ga0495598_0036787 Ga0495598_0036787_121_1050 305
143 3300046664 Ga0495659_0011395 Ga0495659_0011395_105_1028 305
144 3300046664 Ga0495659_0012217 Ga0495659_0012217_1393_2310 305
145 3300046674 Ga0495588_0014854 Ga0495588_0014854_1781_2704 305
146 3300046683 Ga0495658_0044749 Ga0495658_0044749_102_1031 305
147 3300047315 Ga0495581_0251262 Ga0495581_0251262_29_958 305
148 3300047318 Ga0495636_0121109 Ga0495636_0121109_147_1076 305
149 3300047321 Ga0495676_0025407 Ga0495676_0025407_2064_2993 305
150 3300050512 nmdc:mga0n895_29527_c1 nmdc:mga0n895_29527_c1_3732_4655 305
151 3300050513 nmdc:mga0rr50_39975_c1 nmdc:mga0rr50_39975_c1_1357_2280 305
152 3300050515 nmdc:mga0a205_37095_c1 nmdc:mga0a205_37095_c1_1559_2482 305
153 3300006881 Ga0068865_100144936 Ga0068865_1001449362 306
154 3300010375 Ga0105239_10044363 Ga0105239_100443632 306
155 3300025934 Ga0207686_10346802 Ga0207686_103468021 306
156 3300025986 Ga0207658_10040571 Ga0207658_100405712 306
157 3300005436 Ga0070713_100171707 Ga0070713_1001717072 307
158 3300005518 Ga0070699_100292270 Ga0070699_1002922702 307
159 3300005617 Ga0068859_100003521 Ga0068859_1000035214 307
160 3300006028 Ga0070717_10222368 Ga0070717_102223682 307
161 3300006844 Ga0075428_100052025 Ga0075428_1000520252 307
162 3300006931 Ga0097620_100003521 Ga0097620_1000035214 307
163 3300009094 Ga0111539_10072391 Ga0111539_100723912 307
164 3300009147 Ga0114129_10000023 Ga0114129_10000023102 307
165 3300014326 Ga0157380_10104388 Ga0157380_101043882 307
166 3300025928 Ga0207700_10140008 Ga0207700_101400082 307
167 3300046460 Ga0495638_0014080 Ga0495638_0014080_2119_3042 307
168 3300049568 Ga0501031_0189139 Ga0501031_0189139_48_977 307
169 3300049569 Ga0501032_0011110 Ga0501032_0011110_1650_2579 307
170 3300049571 Ga0501034_0009076 Ga0501034_0009076_7670_8599 307
171 3300049571 Ga0501034_0406107 Ga0501034_0406107_270_1199 307
172 3300049572 Ga0501036_0024759 Ga0501036_0024759_2803_3732 307
173 3300049572 Ga0501036_0203406 Ga0501036_0203406_70_999 307
174 3300049573 Ga0501037_0058034 Ga0501037_0058034_1266_2195 307
175 3300049575 Ga0501039_0078953 Ga0501039_0078953_1335_2264 307
176 3300049575 Ga0501039_0121580 Ga0501039_0121580_589_1518 307
177 3300049579 Ga0501043_0038175 Ga0501043_0038175_2805_3734 307
178 3300049579 Ga0501043_0043343 Ga0501043_0043343_972_1901 307
179 3300049579 Ga0501043_0089863 Ga0501043_0089863_24_953 307
180 3300049580 Ga0501046_0014569 Ga0501046_0014569_1637_2566 307
181 3300049580 Ga0501046_0198087 Ga0501046_0198087_547_1476 307
182 3300049581 Ga0501047_0001543 Ga0501047_0001543_4182_5111 307
183 3300049581 Ga0501047_0034093 Ga0501047_0034093_951_1880 307
184 3300049581 Ga0501047_0084912 Ga0501047_0084912_1905_2834 307
185 3300049584 Ga0501068_0059843 Ga0501068_0059843_500_1429 307
186 3300049585 Ga0501069_0034577 Ga0501069_0034577_1230_2159 307
187 3300049585 Ga0501069_0131091 Ga0501069_0131091_471_1400 307
188 3300049588 Ga0501072_0036701 Ga0501072_0036701_1358_2287 307
189 3300049589 Ga0501073_0073625 Ga0501073_0073625_110_1039 307
190 3300049592 Ga0501076_0311825 Ga0501076_0311825_131_1060 307
191 3300049742 Ga0501080_0002989 Ga0501080_0002989_7498_8427 307
192 3300049742 Ga0501080_0157685 Ga0501080_0157685_312_1241 307
193 3300049822 Ga0501035_0305117 Ga0501035_0305117_26_955 307
194 3300049823 Ga0501044_0001751 Ga0501044_0001751_6442_7371 307
195 3300050507 nmdc:mga05p37_300_c1 nmdc:mga05p37_300_c1_4884_5843 307
196 3300050511 nmdc:mga08y16_5113_c1 nmdc:mga08y16_5113_c1_10711_11661 307
197 3300054114 Ga0501084_0012243 Ga0501084_0012243_4758_5687 307
198 3300060353 Ga0501082_0201557 Ga0501082_0201557_771_1700 307
199 3300005356 Ga0070674_100006460 Ga0070674_1000064607 308
200 3300005459 Ga0068867_100114960 Ga0068867_1001149603 308
201 3300006038 Ga0075365_10093531 Ga0075365_100935312 308
202 3300006051 Ga0075364_10094604 Ga0075364_100946042 308
203 3300006177 Ga0075362_10006828 Ga0075362_100068285 308
204 3300006195 Ga0075366_10013405 Ga0075366_100134052 308
205 3300006358 Ga0068871_100174198 Ga0068871_1001741982 308
206 3300006844 Ga0075428_100002102 Ga0075428_10000210214 308
207 3300006846 Ga0075430_100016386 Ga0075430_1000163865 308
208 3300006847 Ga0075431_100016804 Ga0075431_1000168045 308
209 3300006852 Ga0075433_10526426 Ga0075433_105264261 308
210 3300006880 Ga0075429_100002201 Ga0075429_10000220110 308
211 3300006931 Ga0097620_100457158 Ga0097620_1004571582 308
212 3300009094 Ga0111539_10000159 Ga0111539_1000015960 308
213 3300009147 Ga0114129_10003099 Ga0114129_1000309915 308
214 3300009177 Ga0105248_10354977 Ga0105248_103549772 308
215 3300026121 Ga0207683_10405897 Ga0207683_104058972 308
216 3300027907 Ga0207428_10005911 Ga0207428_100059115 308
217 3300031731 Ga0307405_10055817 Ga0307405_100558172 308
218 3300047320 Ga0495672_0020847 Ga0495672_0020847_2501_3433 308
219 3300049571 Ga0501034_0011593 Ga0501034_0011593_2627_3556 308
220 3300049668 Ga0501233_024468 Ga0501233_024468_63_992 308
221 3300049824 Ga0501045_0265967 Ga0501045_0265967_13_939 308
222 3300050489 nmdc:mga03683_8633_c1 nmdc:mga03683_8633_c1_2345_3274 308
223 3300050491 nmdc:mga00v17_36870_c1 nmdc:mga00v17_36870_c1_1391_2320 308
224 3300050492 nmdc:mga0yw44_31156_c1 nmdc:mga0yw44_31156_c1_810_1739 308
225 3300050493 nmdc:mga0k408_20478_c1 nmdc:mga0k408_20478_c1_2515_3444 308
226 3300050494 nmdc:mga06z11_6207_c1 nmdc:mga06z11_6207_c1_1062_1991 308
227 3300050507 nmdc:mga05p37_3248_c1 nmdc:mga05p37_3248_c1_4344_5273 308
228 3300050508 nmdc:mga09592_4121_c1 nmdc:mga09592_4121_c1_6635_7564 308
229 3300050509 nmdc:mga0qj67_7542_c1 nmdc:mga0qj67_7542_c1_4844_5773 308
230 3300050510 nmdc:mga06r32_13344_c1 nmdc:mga06r32_13344_c1_4423_5352 308
231 3300050511 nmdc:mga08y16_1346_c1 nmdc:mga08y16_1346_c1_3579_4508 308
232 3300053139 Ga0500568_0033741 Ga0500568_0033741_621_1553 308
233 3300002459 JGI24751J29686_10004831 JGI24751J29686_100048311 309
234 3300005290 Ga0065712_10006750 Ga0065712_100067505 309
235 3300005365 Ga0070688_100030083 Ga0070688_1000300832 309
236 3300005549 Ga0070704_100424169 Ga0070704_1004241692 309
237 3300005577 Ga0068857_100182150 Ga0068857_1001821502 309
238 3300005618 Ga0068864_100081703 Ga0068864_1000817034 309
239 3300009094 Ga0111539_10013592 Ga0111539_100135925 309
240 3300009094 Ga0111539_10309568 Ga0111539_103095682 309
241 3300009177 Ga0105248_10507020 Ga0105248_105070201 309
242 3300014325 Ga0163163_10349391 Ga0163163_103493912 309
243 3300014326 Ga0157380_10102235 Ga0157380_101022352 309
244 3300025933 Ga0207706_10023354 Ga0207706_100233544 309
245 3300025936 Ga0207670_10064805 Ga0207670_100648053 309
246 3300031901 Ga0307406_10129874 Ga0307406_101298742 309
247 3300031995 Ga0307409_100127580 Ga0307409_1001275802 309
248 3300032005 Ga0307411_10146849 Ga0307411_101468492 309
249 3300047317 Ga0495604_0151088 Ga0495604_0151088_295_1224 309
250 3300048912 Ga0496109_0459576 Ga0496109_0459576_167_1096 309
251 3300048913 Ga0496110_0117700 Ga0496110_0117700_575_1504 309
252 3300050508 nmdc:mga09592_24378_c1 nmdc:mga09592_24378_c1_747_1682 309
253 3300050510 nmdc:mga06r32_444453_c1 nmdc:mga06r32_444453_c1_89_1018 309
254 3300050510 nmdc:mga06r32_80966_c1 nmdc:mga06r32_80966_c1_66_1001 309
255 3300050511 nmdc:mga08y16_18000_c1 nmdc:mga08y16_18000_c1_1828_2757 309
256 3300050511 nmdc:mga08y16_232444_c1 nmdc:mga08y16_232444_c1_210_1145 309

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01297

ZnuA

Zinc-uptake complex component A periplasmic

47

321

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1pq4-assembly1.cif.gz_A crystal structure of znua 0.905 25 302
2ov3-assembly1.cif.gz_A crystal structure of 138-173 znua deletion mutant plus zinc bound 0.9023 25 302
1pq4-assembly1.cif.gz_A crystal structure of znua 0.8916 25 302
2ov3-assembly1.cif.gz_A crystal structure of 138-173 znua deletion mutant plus zinc bound 0.8797 25 302
6ixi-assembly1.cif.gz_A structure of cd-bound periplasmic metal binding protein from candidatus liberibacter asiaticus 0.8785 26 303
ID Description Score Start End Superfamily
4irmC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.9239 27 190 3.40.50.1980
4oxrA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.9077 26 177 3.40.50.1980
4udnA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.9015 27 184 3.40.50.1980
4irmC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.8937 27 190 3.40.50.1980
1pq4A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.8851 25 187 3.40.50.1980
ID Description Score Start End GO Terms
AF-A0A2V9BR50-F1-model_v4 Zinc ABC transporter substrate-binding protein 0.9862 137 305 GO:0030001
GO:0046872
AF-A0A1Q7RQG4-F1-model_v4 Zinc ABC transporter substrate-binding protein 0.986 140 306 GO:0030001
GO:0046872
AF-A0A2V7GIP9-F1-model_v4 Zinc ABC transporter substrate-binding protein 0.9813 153 306 GO:0030001
GO:0046872
AF-A0A2V8HZP4-F1-model_v4 Zinc ABC transporter substrate-binding protein 0.9804 25 305 GO:0007155
GO:0030001
GO:0046872
AF-A0A1Q7SYC9-F1-model_v4 Zinc ABC transporter substrate-binding protein 0.9803 21 305 GO:0007155
GO:0030001
GO:0046872

Feature Viewer

pLDDT pTM Quality
91.21 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map