F366457

General Info

Members Datasets Scaffolds Average Seq Length
256 166 512 341

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10008369|Ga0105242_100083696
Length 366
Sequence MRHRSPNQTNPARRVLALACALAALVALAWAAPASAGLLEPPGKKVWFGVSDTGDPAQFGEFSTAVEKHPAVIESFRTWGTDFPDSIRRWQTARARPMIHITTADNNDGHEILTPRAIANGEGDGYLIRLNHVFAEKEMRAYVRPLGEPNRCLNVYASYDCGGAPRDAAHKPRWYKLAFRRIYVIVHGGGKAKEINKRLAEAGLPPLTETIGGLPKAPVAIVWSPLPAGSPTTPQNRPKNYWPGSDWVDWAGTDFYASYPEWSALSGLYNRYAGKKPFALTEWGVENGDDPSFVSQLFAWVQKHPRCKMLVYYQDFGSTSSYRIQNYSASLAILKARLHSGLFPSFAPAAPQLPPPPQGGIGTPGP

Samples

Sample ID Description Type Environment
1 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
33 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
48 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
49 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
79 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
80 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
81 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
82 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
83 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
84 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
85 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
86 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
87 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
88 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
89 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
90 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
91 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
92 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
93 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
94 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
95 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
96 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
97 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
98 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
99 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
100 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
101 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
102 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
103 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
104 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
105 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
106 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
107 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
108 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
109 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
110 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
111 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
112 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
113 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
114 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
115 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
116 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
117 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
118 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
119 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
120 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
121 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
122 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
123 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
124 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
125 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
126 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
127 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
128 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
129 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
130 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
131 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
132 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
133 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
134 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
135 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
136 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
137 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
138 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
139 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
140 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
141 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
142 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
143 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
144 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
145 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
146 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
147 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
148 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
149 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
152 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
153 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
154 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
156 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
157 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
158 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
159 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
160 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
161 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
162 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
163 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
164 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
165 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
166 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.17
Nodule 0
Rhizoplane 13.67
Rhizosphere 84.77
Stem 0
Stem Tuber 0
Unclassified 4.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105242_10008369 3300009176 Bacteria 7947
2 JGI24740J21852_10000270 3300001979 Bacteria 21884
3 JGI24034J26672_10002388 3300002239 Bacteria 2577
4 Ga0070683_100002570 3300005329 Bacteria 14510
5 Ga0070683_100017732 3300005329 Bacteria 6291
6 Ga0070677_10000007 3300005333 Bacteria 74721
7 Ga0070682_100000038 3300005337 Bacteria 145670
8 Ga0070689_100063623 3300005340 Bacteria 2870
9 Ga0070691_10008676 3300005341 Unclassified 4652
10 Ga0070674_100000001 3300005356 Bacteria 277173
11 Ga0070674_100000026 3300005356 Bacteria 77168
12 Ga0070673_100003392 3300005364 Bacteria 9911
13 Ga0070659_100023363 3300005366 Bacteria 4730
14 Ga0070667_100269677 3300005367 Bacteria 1526
15 Ga0070713_100000061 3300005436 Bacteria 68662
16 Ga0070711_100019826 3300005439 Bacteria 4322
17 Ga0070662_100000079 3300005457 Bacteria 53583
18 Ga0070681_10107938 3300005458 Bacteria 2724
19 Ga0068867_100004538 3300005459 Bacteria 9762
20 Ga0070679_100000077 3300005530 Bacteria 74222
21 Ga0070684_100021024 3300005535 Bacteria 5422
22 Ga0068853_100003821 3300005539 Bacteria 11534
23 Ga0070686_100165915 3300005544 Unclassified 1558
24 Ga0070693_100020071 3300005547 Bacteria 3517
25 Ga0070665_100000306 3300005548 Bacteria 76666
26 Ga0068854_100036046 3300005578 Bacteria 3466
27 Ga0068856_100005967 3300005614 Bacteria 11989
28 Ga0068864_100000201 3300005618 Bacteria 54044
29 Ga0068866_10000006 3300005718 Bacteria 176129
30 Ga0068866_10000055 3300005718 Bacteria 44369
31 Ga0068863_100000039 3300005841 Bacteria 161450
32 Ga0068863_100029881 3300005841 Bacteria 5205
33 Ga0068858_100000178 3300005842 Bacteria 67760
34 Ga0068858_100000765 3300005842 Bacteria 33705
35 Ga0068860_100048480 3300005843 Bacteria 4049
36 Ga0081455_10029923 3300005937 Bacteria 4957
37 Ga0081540_1000044 3300005983 Bacteria 134269
38 Ga0070715_10000003 3300006163 Bacteria 345282
39 Ga0075430_100097149 3300006846 Bacteria 2461
40 Ga0075433_10000032 3300006852 Bacteria 55399
41 Ga0075433_10002113 3300006852 Bacteria 15055
42 Ga0105245_10000049 3300009098 Bacteria 128277
43 Ga0105245_10000508 3300009098 Bacteria 35724
44 Ga0105243_10020563 3300009148 Bacteria 5004
45 Ga0105242_10000403 3300009176 Bacteria 34337
46 Ga0105238_10000014 3300009551 Bacteria 241954
47 Ga0105249_10000039 3300009553 Bacteria 196325
48 Ga0105239_10187983 3300010375 Bacteria 2312
49 Ga0157370_10031721 3300013104 Bacteria 5166
50 Ga0157374_10001271 3300013296 Bacteria 21520
51 Ga0157374_10064641 3300013296 Bacteria 3434
52 Ga0157378_10044037 3300013297 Bacteria 3962
53 Ga0157375_10000942 3300013308 Bacteria 25237
54 Ga0157375_10025758 3300013308 Bacteria 5472
55 Ga0163163_10237723 3300014325 Bacteria 1871
56 Ga0157380_10001261 3300014326 Bacteria 16429
57 Ga0157376_10061226 3300014969 Bacteria 3164
58 Ga0163161_10000013 3300017792 Bacteria 258747
59 Ga0163161_10013649 3300017792 Bacteria 5656
60 Ga0207682_10000007 3300025893 Bacteria 88967
61 Ga0207642_10000001 3300025899 Bacteria 714030
62 Ga0207642_10000003 3300025899 Bacteria 650651
63 Ga0207642_10000004 3300025899 Bacteria 407822
64 Ga0207642_10000531 3300025899 Bacteria 11653
65 Ga0207710_10000217 3300025900 Bacteria 50880
66 Ga0207685_10000003 3300025905 Bacteria 344527
67 Ga0207707_10084450 3300025912 Bacteria 2773
68 Ga0207695_10245277 3300025913 Bacteria 1691
69 Ga0207663_10005837 3300025916 Bacteria 6241
70 Ga0207652_10000138 3300025921 Bacteria 77564
71 Ga0207694_10000008 3300025924 Bacteria 484902
72 Ga0207687_10000012 3300025927 Bacteria 370729
73 Ga0207687_10001866 3300025927 Bacteria 14507
74 Ga0207700_10000016 3300025928 Bacteria 202434
75 Ga0207706_10000302 3300025933 Bacteria 53541
76 Ga0207686_10000029 3300025934 Bacteria 160239
77 Ga0207686_10006417 3300025934 Bacteria 6331
78 Ga0207709_10015729 3300025935 Bacteria 4198
79 Ga0207670_10094536 3300025936 Bacteria 2121
80 Ga0207669_10000002 3300025937 Bacteria 377651
81 Ga0207669_10001401 3300025937 Bacteria 10252
82 Ga0207661_10000772 3300025944 Bacteria 20769
83 Ga0207661_10004459 3300025944 Bacteria 9836
84 Ga0207651_10001092 3300025960 Bacteria 12041
85 Ga0207712_10000003 3300025961 Bacteria 615314
86 Ga0207640_10029177 3300025981 Bacteria 3383
87 Ga0207658_10143613 3300025986 Bacteria 1935
88 Ga0207703_10000381 3300026035 Bacteria 47426
89 Ga0207703_10000520 3300026035 Bacteria 39535
90 Ga0207639_10000838 3300026041 Bacteria 20868
91 Ga0207702_10008438 3300026078 Bacteria 8692
92 Ga0207702_10487812 3300026078 Bacteria 1200
93 Ga0207641_10000065 3300026088 Bacteria 156066
94 Ga0207641_10001058 3300026088 Bacteria 27805
95 Ga0207641_10125059 3300026088 Bacteria 2301
96 Ga0207648_10009853 3300026089 Bacteria 9113
97 Ga0207676_10000026 3300026095 Bacteria 248593
98 Ga0268266_10000023 3300028379 Bacteria 501899
99 Ga0268264_10003844 3300028381 Bacteria 12882
100 Ga0265337_1000074 3300028556 Bacteria 46897
101 Ga0265326_10000035 3300028558 Bacteria 89561
102 Ga0265322_10000009 3300028654 Bacteria 170768
103 Ga0265336_10007579 3300028666 Bacteria 3857
104 Ga0265324_10000168 3300029957 Bacteria 50622
105 Ga0265328_10002915 3300031239 Bacteria 7633
106 Ga0265320_10000024 3300031240 Bacteria 170768
107 Ga0265329_10002105 3300031242 Bacteria 9248
108 Ga0265331_10038482 3300031250 Bacteria 2338
109 Ga0265327_10000227 3300031251 Bacteria 114777
110 Ga0265314_10001556 3300031711 Bacteria 25291
111 Ga0373955_0039303 3300035172 Bacteria 2525
112 Ga0373933_0266078 3300035724 Bacteria 1106
113 Ga0373937_0008398 3300036401 Bacteria 8974
114 Ga0373937_0155067 3300036401 Bacteria 2146
115 Ga0466963_0000002 3300044694 Bacteria 108477
116 Ga0466963_0047042 3300044694 Unclassified 2847
117 Ga0466957_0013389 3300044842 Bacteria 4757
118 Ga0495592_0009439 3300046454 Bacteria 7335
119 Ga0495603_0005875 3300046455 Bacteria 7336
120 Ga0495603_0006779 3300046455 Bacteria 6871
121 Ga0495629_0001727 3300046459 Bacteria 17135
122 Ga0495629_0002409 3300046459 Bacteria 14397
123 Ga0495629_0114251 3300046459 Bacteria 1882
124 Ga0495641_0000095 3300046461 Bacteria 60441
125 Ga0495582_0000082 3300046473 Bacteria 48118
126 Ga0495662_0000140 3300046476 Bacteria 27992
127 Ga0495664_0075002 3300046477 Bacteria 2024
128 Ga0495594_0000345 3300046499 Bacteria 23182
129 Ga0495608_0000010 3300046511 Bacteria 258660
130 Ga0495608_0001938 3300046511 Bacteria 14858
131 Ga0495608_0035649 3300046511 Bacteria 3354
132 Ga0495608_0051037 3300046511 Bacteria 2742
133 Ga0495618_0000097 3300046514 Bacteria 63474
134 Ga0495620_0000158 3300046515 Bacteria 54704
135 Ga0495628_0000048 3300046516 Bacteria 96944
136 Ga0495628_0020194 3300046516 Bacteria 5498
137 Ga0495628_0053485 3300046516 Archaea 3186
138 Ga0495628_0167872 3300046516 Bacteria 1665
139 Ga0495630_0000082 3300046517 Bacteria 75280
140 Ga0495630_0001301 3300046517 Bacteria 17211
141 Ga0495630_0250122 3300046517 Bacteria 1354
142 Ga0495644_0000404 3300046523 Bacteria 19389
143 Ga0495640_0065489 3300046533 Bacteria 2453
144 Ga0495586_0000234 3300046535 Bacteria 36813
145 Ga0495621_0007721 3300046539 Bacteria 3195
146 Ga0495645_0002167 3300046543 Bacteria 13338
147 Ga0495622_0000124 3300046557 Bacteria 66518
148 Ga0495633_0034799 3300046558 Bacteria 2421
149 Ga0495667_0000053 3300046559 Bacteria 105370
150 Ga0495667_0013476 3300046559 Bacteria 5534
151 Ga0495667_0108589 3300046559 Bacteria 1793
152 Ga0495668_0043858 3300046616 Bacteria 2486
153 Ga0495634_0000092 3300046642 Bacteria 72088
154 Ga0495634_0000616 3300046642 Bacteria 34537
155 Ga0495634_0099606 3300046642 Unclassified 1879
156 Ga0495635_0000006 3300046663 Bacteria 301820
157 Ga0495635_0013781 3300046663 Bacteria 5655
158 Ga0495657_0000005 3300046675 Bacteria 254860
159 Ga0495657_0006470 3300046675 Bacteria 9163
160 Ga0495657_0029477 3300046675 Bacteria 3849
161 Ga0495599_0014242 3300046678 Bacteria 4923
162 Ga0495647_0000020 3300046681 Bacteria 77355
163 Ga0495658_0000070 3300046683 Bacteria 52450
164 Ga0495658_0000965 3300046683 Bacteria 15281
165 Ga0495669_0000072 3300046684 Bacteria 66900
166 Ga0495669_0001896 3300046684 Bacteria 8575
167 Ga0495613_0000092 3300046689 Bacteria 86976
168 Ga0495624_0000049 3300046690 Bacteria 75485
169 Ga0495624_0137535 3300046690 Bacteria 1497
170 Ga0495670_0017167 3300046691 Bacteria 3561
171 Ga0495649_0001406 3300046694 Bacteria 18177
172 Ga0495600_0000893 3300046809 Bacteria 15969
173 Ga0495600_0057826 3300046809 Unclassified 2533
174 Ga0495600_0099253 3300046809 Unclassified 1898
175 Ga0495600_0195617 3300046809 Unclassified 1299
176 Ga0495604_0054579 3300047317 Bacteria 3083
177 Ga0495604_0058656 3300047317 Bacteria 2955
178 Ga0495674_0000063 3300047319 Bacteria 71737
179 Ga0495676_0000600 3300047321 Bacteria 29800
180 Ga0495676_0023999 3300047321 Bacteria 5285
181 Ga0495676_0034667 3300047321 Bacteria 4232
182 Ga0495680_0000050 3300047322 Bacteria 95945
183 Ga0495680_0000873 3300047322 Bacteria 33510
184 Ga0495680_0007014 3300047322 Bacteria 10388
185 Ga0495680_0007552 3300047322 Bacteria 9943
186 Ga0495680_0039934 3300047322 Bacteria 3740
187 Ga0495680_0044291 3300047322 Unclassified 3519
188 Ga0495675_0000004 3300047444 Bacteria 211049
189 Ga0495675_0121943 3300047444 Bacteria 1623
190 Ga0495675_0188582 3300047444 Unclassified 1260
191 Ga0495679_047564 3300047446 Unclassified 1301
192 Ga0495673_0079872 3300047469 Bacteria 1357
193 Ga0495684_0244164 3300047471 Bacteria 1309
194 Ga0495593_0045841 3300047673 Bacteria 2332
195 Ga0495593_0058289 3300047673 Unclassified 2026
196 Ga0495602_0001683 3300048088 Bacteria 22021
197 Ga0495602_0081606 3300048088 Bacteria 2718
198 Ga0496100_0000004 3300048903 Bacteria 321778
199 Ga0496100_0000032 3300048903 Bacteria 99877
200 Ga0496101_0000007 3300048904 Bacteria 321778
201 Ga0496101_0000012 3300048904 Bacteria 268127
202 Ga0496102_0000132 3300048905 Bacteria 103176
203 Ga0496102_0058999 3300048905 Bacteria 3508
204 Ga0496103_0000077 3300048906 Bacteria 112223
205 Ga0496104_0000002 3300048907 Bacteria 686017
206 Ga0496104_0000003 3300048907 Bacteria 669219
207 Ga0496104_0001440 3300048907 Bacteria 20567
208 Ga0496105_0000001 3300048908 Bacteria 1328178
209 Ga0496105_0000003 3300048908 Bacteria 713251
210 Ga0496105_0000095 3300048908 Bacteria 60866
211 Ga0496106_0000004 3300048909 Bacteria 279896
212 Ga0496106_0000092 3300048909 Bacteria 70312
213 Ga0496107_0000001 3300048910 Bacteria 321778
214 Ga0496107_0000031 3300048910 Bacteria 100522
215 Ga0496107_0186177 3300048910 Bacteria 1542
216 Ga0496108_0000002 3300048911 Bacteria 700890
217 Ga0496108_0000012 3300048911 Bacteria 258433
218 Ga0496108_0000202 3300048911 Bacteria 55115
219 Ga0496108_0112887 3300048911 Bacteria 2325
220 Ga0496109_0000001 3300048912 Bacteria 700852
221 Ga0496109_0000076 3300048912 Bacteria 104273
222 Ga0496109_0000131 3300048912 Bacteria 76860
223 Ga0496110_0000015 3300048913 Bacteria 85373
224 Ga0496110_0064876 3300048913 Bacteria 3228
225 Ga0496111_0000001 3300048914 Bacteria 194837
226 Ga0496112_0000002 3300048915 Bacteria 782039
227 Ga0496112_0079879 3300048915 Bacteria 3235
228 Ga0496112_0162091 3300048915 Bacteria 2203
229 Ga0496114_0000003 3300048917 Bacteria 630981
230 Ga0496114_0061584 3300048917 Bacteria 3139
231 Ga0496115_0000004 3300048918 Bacteria 319734
232 Ga0496115_0000856 3300048918 Bacteria 22091
233 Ga0496120_0001990 3300048923 Bacteria 22246
234 Ga0501042_0034430 3300049578 Bacteria 3592
235 Ga0501072_0134562 3300049588 Bacteria 1971
236 Ga0501075_0000897 3300049591 Bacteria 18804
237 Ga0501081_0127521 3300049743 Bacteria 1816
238 nmdc:mga0a205_1629_c2 3300050515 Bacteria 15476
239 nmdc:mga0a205_1_c2 3300050515 Bacteria 266330
240 Ga0495601_0000296 3300053077 Bacteria 26491
241 Ga0495601_0010708 3300053077 Bacteria 5469
242 Ga0495612_0004421 3300053078 Bacteria 5829
243 Ga0495612_0005841 3300053078 Bacteria 5084
244 Ga0495655_0000009 3300053083 Bacteria 150662
245 Ga0495595_0000005 3300053084 Bacteria 258660
246 Ga0495595_0001535 3300053084 Bacteria 9010
247 Ga0495595_0088722 3300053084 Bacteria 1482
248 Ga0495619_0000060 3300053085 Bacteria 89377
249 Ga0495619_0000126 3300053085 Bacteria 56169
250 Ga0495619_0000896 3300053085 Bacteria 19523
251 Ga0495619_0001321 3300053085 Bacteria 16261
252 Ga0495619_0002266 3300053085 Bacteria 12712
253 Ga0495619_0012944 3300053085 Bacteria 5255
254 Ga0500566_0021779 3300053094 Bacteria 3767
255 Ga0500614_000282 3300053123 Bacteria 13174
256 Ga0500628_000022 3300053129 Bacteria 77990
257 Ga0105242_10008369
258 JGI24740J21852_10000270
259 JGI24034J26672_10002388
260 Ga0070683_100002570
261 Ga0070683_100017732
262 Ga0070677_10000007
263 Ga0070682_100000038
264 Ga0070689_100063623
265 Ga0070691_10008676
266 Ga0070674_100000001
267 Ga0070674_100000026
268 Ga0070673_100003392
269 Ga0070659_100023363
270 Ga0070667_100269677
271 Ga0070713_100000061
272 Ga0070711_100019826
273 Ga0070662_100000079
274 Ga0070681_10107938
275 Ga0068867_100004538
276 Ga0070679_100000077
277 Ga0070684_100021024
278 Ga0068853_100003821
279 Ga0070686_100165915
280 Ga0070693_100020071
281 Ga0070665_100000306
282 Ga0068854_100036046
283 Ga0068856_100005967
284 Ga0068864_100000201
285 Ga0068866_10000006
286 Ga0068866_10000055
287 Ga0068863_100000039
288 Ga0068863_100029881
289 Ga0068858_100000178
290 Ga0068858_100000765
291 Ga0068860_100048480
292 Ga0081455_10029923
293 Ga0081540_1000044
294 Ga0070715_10000003
295 Ga0075430_100097149
296 Ga0075433_10000032
297 Ga0075433_10002113
298 Ga0105245_10000049
299 Ga0105245_10000508
300 Ga0105243_10020563
301 Ga0105242_10000403
302 Ga0105238_10000014
303 Ga0105249_10000039
304 Ga0105239_10187983
305 Ga0157370_10031721
306 Ga0157374_10001271
307 Ga0157374_10064641
308 Ga0157378_10044037
309 Ga0157375_10000942
310 Ga0157375_10025758
311 Ga0163163_10237723
312 Ga0157380_10001261
313 Ga0157376_10061226
314 Ga0163161_10000013
315 Ga0163161_10013649
316 Ga0207682_10000007
317 Ga0207642_10000001
318 Ga0207642_10000003
319 Ga0207642_10000004
320 Ga0207642_10000531
321 Ga0207710_10000217
322 Ga0207685_10000003
323 Ga0207707_10084450
324 Ga0207695_10245277
325 Ga0207663_10005837
326 Ga0207652_10000138
327 Ga0207694_10000008
328 Ga0207687_10000012
329 Ga0207687_10001866
330 Ga0207700_10000016
331 Ga0207706_10000302
332 Ga0207686_10000029
333 Ga0207686_10006417
334 Ga0207709_10015729
335 Ga0207670_10094536
336 Ga0207669_10000002
337 Ga0207669_10001401
338 Ga0207661_10000772
339 Ga0207661_10004459
340 Ga0207651_10001092
341 Ga0207712_10000003
342 Ga0207640_10029177
343 Ga0207658_10143613
344 Ga0207703_10000381
345 Ga0207703_10000520
346 Ga0207639_10000838
347 Ga0207702_10008438
348 Ga0207702_10487812
349 Ga0207641_10000065
350 Ga0207641_10001058
351 Ga0207641_10125059
352 Ga0207648_10009853
353 Ga0207676_10000026
354 Ga0268266_10000023
355 Ga0268264_10003844
356 Ga0265337_1000074
357 Ga0265326_10000035
358 Ga0265322_10000009
359 Ga0265336_10007579
360 Ga0265324_10000168
361 Ga0265328_10002915
362 Ga0265320_10000024
363 Ga0265329_10002105
364 Ga0265331_10038482
365 Ga0265327_10000227
366 Ga0265314_10001556
367 Ga0373955_0039303
368 Ga0373933_0266078
369 Ga0373937_0008398
370 Ga0373937_0155067
371 Ga0466963_0000002
372 Ga0466963_0047042
373 Ga0466957_0013389
374 Ga0495592_0009439
375 Ga0495603_0005875
376 Ga0495603_0006779
377 Ga0495629_0001727
378 Ga0495629_0002409
379 Ga0495629_0114251
380 Ga0495641_0000095
381 Ga0495582_0000082
382 Ga0495662_0000140
383 Ga0495664_0075002
384 Ga0495594_0000345
385 Ga0495608_0000010
386 Ga0495608_0001938
387 Ga0495608_0035649
388 Ga0495608_0051037
389 Ga0495618_0000097
390 Ga0495620_0000158
391 Ga0495628_0000048
392 Ga0495628_0020194
393 Ga0495628_0053485
394 Ga0495628_0167872
395 Ga0495630_0000082
396 Ga0495630_0001301
397 Ga0495630_0250122
398 Ga0495644_0000404
399 Ga0495640_0065489
400 Ga0495586_0000234
401 Ga0495621_0007721
402 Ga0495645_0002167
403 Ga0495622_0000124
404 Ga0495633_0034799
405 Ga0495667_0000053
406 Ga0495667_0013476
407 Ga0495667_0108589
408 Ga0495668_0043858
409 Ga0495634_0000092
410 Ga0495634_0000616
411 Ga0495634_0099606
412 Ga0495635_0000006
413 Ga0495635_0013781
414 Ga0495657_0000005
415 Ga0495657_0006470
416 Ga0495657_0029477
417 Ga0495599_0014242
418 Ga0495647_0000020
419 Ga0495658_0000070
420 Ga0495658_0000965
421 Ga0495669_0000072
422 Ga0495669_0001896
423 Ga0495613_0000092
424 Ga0495624_0000049
425 Ga0495624_0137535
426 Ga0495670_0017167
427 Ga0495649_0001406
428 Ga0495600_0000893
429 Ga0495600_0057826
430 Ga0495600_0099253
431 Ga0495600_0195617
432 Ga0495604_0054579
433 Ga0495604_0058656
434 Ga0495674_0000063
435 Ga0495676_0000600
436 Ga0495676_0023999
437 Ga0495676_0034667
438 Ga0495680_0000050
439 Ga0495680_0000873
440 Ga0495680_0007014
441 Ga0495680_0007552
442 Ga0495680_0039934
443 Ga0495680_0044291
444 Ga0495675_0000004
445 Ga0495675_0121943
446 Ga0495675_0188582
447 Ga0495679_047564
448 Ga0495673_0079872
449 Ga0495684_0244164
450 Ga0495593_0045841
451 Ga0495593_0058289
452 Ga0495602_0001683
453 Ga0495602_0081606
454 Ga0496100_0000004
455 Ga0496100_0000032
456 Ga0496101_0000007
457 Ga0496101_0000012
458 Ga0496102_0000132
459 Ga0496102_0058999
460 Ga0496103_0000077
461 Ga0496104_0000002
462 Ga0496104_0000003
463 Ga0496104_0001440
464 Ga0496105_0000001
465 Ga0496105_0000003
466 Ga0496105_0000095
467 Ga0496106_0000004
468 Ga0496106_0000092
469 Ga0496107_0000001
470 Ga0496107_0000031
471 Ga0496107_0186177
472 Ga0496108_0000002
473 Ga0496108_0000012
474 Ga0496108_0000202
475 Ga0496108_0112887
476 Ga0496109_0000001
477 Ga0496109_0000076
478 Ga0496109_0000131
479 Ga0496110_0000015
480 Ga0496110_0064876
481 Ga0496111_0000001
482 Ga0496112_0000002
483 Ga0496112_0079879
484 Ga0496112_0162091
485 Ga0496114_0000003
486 Ga0496114_0061584
487 Ga0496115_0000004
488 Ga0496115_0000856
489 Ga0496120_0001990
490 Ga0501042_0034430
491 Ga0501072_0134562
492 Ga0501075_0000897
493 Ga0501081_0127521
494 nmdc:mga0a205_1629_c2
495 nmdc:mga0a205_1_c2
496 Ga0495601_0000296
497 Ga0495601_0010708
498 Ga0495612_0004421
499 Ga0495612_0005841
500 Ga0495655_0000009
501 Ga0495595_0000005
502 Ga0495595_0001535
503 Ga0495595_0088722
504 Ga0495619_0000060
505 Ga0495619_0000126
506 Ga0495619_0000896
507 Ga0495619_0001321
508 Ga0495619_0002266
509 Ga0495619_0012944
510 Ga0500566_0021779
511 Ga0500614_000282
512 Ga0500628_000022

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cip-assembly1.cif.gz_A structure of the michaelis complex of a family 26 lichenase 0.8228 25 320
2cip-assembly1.cif.gz_A structure of the michaelis complex of a family 26 lichenase 0.8172 25 320
6zpl-assembly1.cif.gz_C inward-open structure of human glycine transporter 1 in complex with a benzoylisoindoline inhibitor, sybody sb_glyt1#7 and bound na and cl ions. 0.8138 26 318
6zpl-assembly1.cif.gz_C inward-open structure of human glycine transporter 1 in complex with a benzoylisoindoline inhibitor, sybody sb_glyt1#7 and bound na and cl ions. 0.8083 26 318
2vi0-assembly1.cif.gz_A lichenase ctlic26 in complex with a thio-oligosaccharide 0.806 26 320
ID Description Score Start End Superfamily
2cipA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.8228 25 320 3.20.20.80
2cipA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.8172 25 320 3.20.20.80
af_A0A1D6HJ01_191_371_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.7283 36 79 3.30.420.10
af_P47024_614_795_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.6912 37 79 3.30.420.10
3vplA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.6759 17 331 3.20.20.80
ID Description Score Start End GO Terms
AF-A0A1Q3NKA4-F1-model_v4 deleted 0.9618 9 334
AF-A0A538CX27-F1-model_v4 GH26 domain-containing protein 0.9535 39 321 GO:0004553
AF-A0A537YUF4-F1-model_v4 GH26 domain-containing protein 0.951 6 343 GO:0004553
AF-A0A538CX27-F1-model_v4 GH26 domain-containing protein 0.9435 39 321 GO:0004553
AF-A0A537YUC3-F1-model_v4 GH26 domain-containing protein 0.9402 8 338 GO:0004553

Map