F366592

General Info

Members Datasets Scaffolds Average Seq Length
256 168 194 243

Family's Representative Sequence

Representative Sequence 3300028653|Ga0265323_10025498|Ga0265323_100254982
Length 279
Sequence MARHFPQKWGLRRGVNPAPCFFRAMMTIERKPPLGKKVQLMATCLCDAFYDDAAVATVQVLEHLGLTVEFPEAQICCGQPAFNAGDWAASRRVARHMVSTFKGELPVIVPSSSCAAMVFHGSLLAFEHEPDLPAVEQLAQRTWELADFIVHGLGVTAWPGRFEAAIAFHRSCHTRGSNSAEAAATLMRSISGLNLVEFGEAEQCCGFGGTFSVSFPHISEAMGRLKLQHLRAAQPQIVVGVDTSCLMHLGGLAEKDGQPIKHLHVAQVLRDALKNGGLL

Samples

Sample ID Description Type Environment
1 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
2 2554235283 Bacillus safensis VK Isolate Rhizosphere
3 2643221729 Bacillus sp. Root11 Isolate Unclassified
4 2643221730 Bacillus sp. Root131 Isolate Unclassified
5 2643221731 Bacillus sp. Root147 Isolate Unclassified
6 2643221732 Bacillus sp. Root239 Isolate Unclassified
7 2643221735 Bacillus sp. Root920 Isolate Unclassified
8 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
9 2684622632 Bacillus cereus 905 Isolate Unclassified
10 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
11 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
12 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
13 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
14 2738541358 Bacillus sp. OV752 Isolate Unclassified
15 2738543006 Bacillus sp. OK077 Isolate Unclassified
16 2786546548 Spartobacteria bacterium LR76 Isolate Unclassified
17 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
18 2811994870 Bacillus sp. JB4 Isolate Unclassified
19 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
20 2818991441 Niallia circulans 3243 Isolate Rhizosphere
21 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
22 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
23 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
24 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
25 2842682962 Bacillus sp. R-72492 Isolate Unclassified
26 2842882022 Bacillus sp. R-71893 Isolate Unclassified
27 2849139964 Bacillus sp. R-71875 Isolate Unclassified
28 2857581216 Bacillus sp. R-71922 Isolate Unclassified
29 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
30 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
31 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
32 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
33 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
34 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
35 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
36 2919720352 Priestia megaterium 4340 Isolate Unclassified
37 2919726948 Bacillus pumilus 4489 Isolate Unclassified
38 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
39 2929004312 Priestia megaterium 1104 Isolate Unclassified
40 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
41 2938917290 Bacillus sp. CR71 Isolate Unclassified
42 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
43 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
44 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
45 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
46 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
47 2965761152 Bacillus sp. COPE52 Isolate Unclassified
48 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
49 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
50 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
51 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
52 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
53 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
54 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
55 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
56 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
57 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
58 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
59 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
60 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
61 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
62 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
63 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
64 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
65 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
66 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
73 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
74 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
85 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
87 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
88 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
97 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
98 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
99 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
100 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
101 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
102 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
103 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
104 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
105 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
106 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
107 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
108 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
109 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
110 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
111 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
112 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
113 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
114 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
115 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
116 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
117 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
118 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
119 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
120 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
121 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
122 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
123 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
124 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
125 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
126 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
127 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
128 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
129 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
130 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
131 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
132 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
133 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
134 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
135 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
136 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
137 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
138 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
139 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
140 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
141 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
142 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
143 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
144 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
145 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
146 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
147 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
148 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
149 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
150 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
151 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
152 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
153 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
154 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
157 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
158 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
159 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
160 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
161 8022792930 Bacillus sp. Xin Isolate Rhizosphere
162 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
163 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
164 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
165 8023438354 Bacillus sp. BH2 Isolate Unclassified
166 8023444577 Bacillus sp. BH32 Isolate Unclassified
167 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere
168 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 75
Metatranscriptomes 0.78
Isolates 24.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.33
Nodule 0
Rhizoplane 6.64
Rhizosphere 60.16
Stem 0
Stem Tuber 0
Unclassified 21.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24033J26618_1000177 3300002155 Bacteria 7807
2 JGI25159J45721_1014124 3300002987 Bacteria 1817
3 JGI25159J45721_1020174 3300002987 Bacteria 1292
4 JGI25151J46595_10000012 3300003187 Bacteria 254028
5 JGI25151J46595_10001358 3300003187 Bacteria 16946
6 JGI25151J46595_10001910 3300003187 Bacteria 13231
7 JGI25151J46595_10030395 3300003187 Bacteria 2125
8 JGI25151J46595_10037543 3300003187 Bacteria 1815
9 rootH1_10011350 3300003316 Bacteria 16310
10 rootH2_10068500 3300003320 Bacteria 8125
11 rootH2_10254517 3300003320 Bacteria 1219
12 rootL2_10019319 3300003322 Bacteria 26434
13 rootH1_10195542 3300003323 Bacteria 4088
14 rootH1_10250351 3300003323 Bacteria 2277
15 Ga0006562J51391_1001573 3300003578 Bacteria 9980
16 Ga0006562J51391_1007014 3300003578 Bacteria 7430
17 Ga0055528_1003493 3300003790 Bacteria 7841
18 Ga0070676_10074383 3300005328 Bacteria 2046
19 Ga0070675_100318852 3300005354 Bacteria 1373
20 Ga0070671_100096937 3300005355 Bacteria 2473
21 Ga0070693_100335420 3300005547 Bacteria 1030
22 Ga0068857_100024488 3300005577 Bacteria 5314
23 Ga0068856_100017654 3300005614 Bacteria 6917
24 Ga0068864_100111698 3300005618 Bacteria 2435
25 Ga0068863_100012774 3300005841 Bacteria 8097
26 Ga0070717_10000029 3300006028 Bacteria 143008
27 Ga0105251_10021771 3300009011 Bacteria 3340
28 Ga0105251_10165360 3300009011 Bacteria 997
29 Ga0105244_10008527 3300009036 Bacteria 6394
30 Ga0105244_10017966 3300009036 Bacteria 3980
31 Ga0105244_10136649 3300009036 Bacteria 1181
32 Ga0105244_10206764 3300009036 Bacteria 924
33 Ga0105244_10278444 3300009036 Bacteria 776
34 Ga0105250_10001293 3300009092 Bacteria 13737
35 Ga0105250_10096306 3300009092 Bacteria 1206
36 Ga0105250_10134120 3300009092 Bacteria 1023
37 Ga0105245_10070044 3300009098 Bacteria 3181
38 Ga0105243_10038346 3300009148 Bacteria 3732
39 Ga0105246_10009271 3300011119 Bacteria 6061
40 Ga0105246_10021859 3300011119 Bacteria 4122
41 Ga0157374_10015715 3300013296 Bacteria 6646
42 Ga0157374_10221661 3300013296 Bacteria 1856
43 Ga0157378_10004929 3300013297 Bacteria 11698
44 Ga0157375_10014731 3300013308 Bacteria 6988
45 Ga0163163_10005949 3300014325 Bacteria 10613
46 Ga0163163_10496981 3300014325 Bacteria 1282
47 Ga0209147_101694 3300025229 Bacteria 7192
48 Ga0209147_102497 3300025229 Bacteria 4513
49 Ga0209673_1002552 3300025273 Bacteria 12431
50 Ga0209130_1000643 3300025284 Bacteria 32629
51 Ga0209130_1001763 3300025284 Bacteria 12811
52 Ga0209130_1008159 3300025284 Bacteria 3125
53 Ga0209130_1010653 3300025284 Bacteria 2516
54 Ga0209676_1008823 3300025292 Bacteria 4436
55 Ga0209025_1000001 3300025294 Bacteria 1888151
56 Ga0209025_1000457 3300025294 Bacteria 79829
57 Ga0209025_1000722 3300025294 Bacteria 56052
58 Ga0209025_1001182 3300025294 Bacteria 36937
59 Ga0209025_1001731 3300025294 Bacteria 26322
60 Ga0209025_1006419 3300025294 Bacteria 9136
61 Ga0209025_1007033 3300025294 Bacteria 8526
62 Ga0209025_1008151 3300025294 Bacteria 7597
63 Ga0209025_1009163 3300025294 Bacteria 6954
64 Ga0209025_1010222 3300025294 Bacteria 6393
65 Ga0209025_1011636 3300025294 Bacteria 5766
66 Ga0209025_1033617 3300025294 Bacteria 2365
67 Ga0207426_1024946 3300025302 Bacteria 2021
68 Ga0207696_1018279 3300025711 Bacteria 2305
69 Ga0207696_1020313 3300025711 Bacteria 2146
70 Ga0207696_1025042 3300025711 Bacteria 1865
71 Ga0207655_1025556 3300025728 Bacteria 2863
72 Ga0207655_1055131 3300025728 Bacteria 1576
73 Ga0207713_1008696 3300025735 Bacteria 5802
74 Ga0207713_1046602 3300025735 Bacteria 1762
75 Ga0207713_1060850 3300025735 Bacteria 1440
76 Ga0207713_1137979 3300025735 Bacteria 799
77 Ga0207649_10000125 3300025920 Bacteria 64941
78 Ga0207644_10311788 3300025931 Bacteria 1270
79 Ga0207702_10001384 3300026078 Bacteria 24187
80 Ga0207641_10043682 3300026088 Bacteria 3765
81 Ga0209973_1026218 3300027252 Bacteria 802
82 Ga0265337_1001044 3300028556 Bacteria 14322
83 Ga0265319_1000462 3300028563 Bacteria 28799
84 Ga0265319_1002473 3300028563 Bacteria 10080
85 Ga0265319_1014970 3300028563 Bacteria 3024
86 Ga0265319_1034525 3300028563 Bacteria 1739
87 Ga0265334_10007951 3300028573 Bacteria 4531
88 Ga0265318_10000573 3300028577 Bacteria 25932
89 Ga0265318_10001341 3300028577 Bacteria 14703
90 Ga0265318_10009854 3300028577 Bacteria 4186
91 Ga0265318_10057061 3300028577 Bacteria 1459
92 Ga0265323_10000004 3300028653 Bacteria 197761
93 Ga0265323_10005143 3300028653 Bacteria 5573
94 Ga0265323_10008177 3300028653 Bacteria 4326
95 Ga0265323_10015043 3300028653 Bacteria 3047
96 Ga0265323_10016299 3300028653 Bacteria 2904
97 Ga0265323_10025498 3300028653 Bacteria 2236
98 Ga0265322_10000123 3300028654 Bacteria 35716
99 Ga0265322_10004712 3300028654 Bacteria 4051
100 Ga0265338_10000416 3300028800 Bacteria 76329
101 Ga0265338_10003487 3300028800 Bacteria 22101
102 Ga0265324_10002051 3300029957 Bacteria 10698
103 Ga0237817_10021 3300030083 Bacteria 63280
104 Ga0237817_10040 3300030083 Bacteria 44341
105 Ga0265330_10000130 3300031235 Bacteria 60078
106 Ga0265330_10030284 3300031235 Bacteria 2431
107 Ga0265328_10013238 3300031239 Bacteria 3270
108 Ga0265320_10000108 3300031240 Bacteria 71696
109 Ga0265320_10000120 3300031240 Bacteria 68719
110 Ga0265320_10001557 3300031240 Bacteria 16541
111 Ga0265320_10003176 3300031240 Bacteria 11143
112 Ga0265320_10045517 3300031240 Bacteria 2155
113 Ga0265325_10001532 3300031241 Bacteria 16176
114 Ga0265325_10021092 3300031241 Bacteria 3584
115 Ga0265325_10059788 3300031241 Bacteria 1937
116 Ga0265329_10000121 3300031242 Bacteria 36998
117 Ga0265329_10070897 3300031242 Bacteria 1102
118 Ga0265340_10009773 3300031247 Bacteria 5143
119 Ga0265340_10015883 3300031247 Bacteria 3905
120 Ga0265339_10001091 3300031249 Bacteria 20585
121 Ga0265331_10000764 3300031250 Bacteria 26866
122 Ga0265327_10000037 3300031251 Bacteria 293502
123 Ga0265316_10006411 3300031344 Bacteria 11242
124 Ga0265316_10007873 3300031344 Bacteria 9973
125 Ga0265316_10023854 3300031344 Bacteria 5137
126 Ga0265316_10063480 3300031344 Bacteria 2864
127 Ga0265316_10072294 3300031344 Bacteria 2657
128 Ga0265316_10111400 3300031344 Bacteria 2072
129 Ga0265316_10139835 3300031344 Bacteria 1819
130 Ga0265316_10180237 3300031344 Bacteria 1573
131 Ga0265316_10341994 3300031344 Bacteria 1084
132 Ga0307408_100000833 3300031548 Bacteria 24441
133 Ga0265313_10000128 3300031595 Bacteria 76766
134 Ga0265313_10011589 3300031595 Bacteria 5468
135 Ga0265314_10001019 3300031711 Bacteria 32654
136 Ga0265314_10184294 3300031711 Bacteria 1248
137 Ga0265342_10000737 3300031712 Bacteria 33604
138 Ga0265342_10002458 3300031712 Bacteria 15973
139 Ga0265342_10010136 3300031712 Bacteria 6568
140 Ga0265342_10035123 3300031712 Bacteria 3071
141 Ga0265342_10037064 3300031712 Bacteria 2976
142 Ga0265342_10070792 3300031712 Bacteria 2033
143 Ga0265342_10075024 3300031712 Bacteria 1963
144 Ga0265342_10214232 3300031712 Bacteria 1040
145 Ga0307410_10086628 3300031852 Bacteria 2213
146 Ga0307406_10011483 3300031901 Bacteria 5029
147 Ga0307409_100000244 3300031995 Bacteria 21939
148 Ga0316574_0052160 3300035398 Bacteria 2550
149 Ga0316574_0136887 3300035398 Unclassified 1577
150 Ga0451577_0013266 3300042876 Bacteria 7721
151 Ga0466957_0021203 3300044842 Bacteria 3827
152 Ga0451576_0003259 3300045051 Bacteria 22524
153 Ga0466967_0003627 3300045976 Bacteria 10143
154 Ga0466967_0046640 3300045976 Bacteria 3774
155 Ga0495603_0268057 3300046455 Bacteria 982
156 Ga0495607_0110772 3300046501 Bacteria 1456
157 Ga0495630_0071490 3300046517 Bacteria 2611
158 Ga0495622_0021808 3300046557 Bacteria 2983
159 Ga0495589_0134321 3300046794 Bacteria 1187
160 Ga0495660_0125239 3300046810 Bacteria 1295
161 Ga0495676_0335199 3300047321 Bacteria 1014
162 Ga0496100_0002231 3300048903 Bacteria 9785
163 Ga0496101_0012703 3300048904 Bacteria 5627
164 Ga0496102_0513581 3300048905 Bacteria 1120
165 Ga0496103_0003980 3300048906 Bacteria 8972
166 Ga0496104_0004233 3300048907 Bacteria 12461
167 Ga0496104_0138145 3300048907 Bacteria 2342
168 Ga0496105_0002073 3300048908 Bacteria 14504
169 Ga0496106_0000227 3300048909 Bacteria 39343
170 Ga0496107_0000148 3300048910 Bacteria 35455
171 Ga0496108_0001890 3300048911 Bacteria 16782
172 Ga0496109_0001825 3300048912 Bacteria 17687
173 Ga0496110_0000495 3300048913 Bacteria 26775
174 Ga0496111_0004563 3300048914 Bacteria 8770
175 Ga0496112_0003496 3300048915 Bacteria 13016
176 Ga0496112_0014240 3300048915 Bacteria 7370
177 Ga0496113_0013685 3300048916 Bacteria 5508
178 Ga0496113_0389809 3300048916 Bacteria 1118
179 Ga0496116_0032390 3300048919 Bacteria 3725
180 Ga0496116_0217183 3300048919 Bacteria 984
181 Ga0496117_0091193 3300048920 Bacteria 1961
182 Ga0496122_0018018 3300048925 Bacteria 6549
183 Ga0496123_0041003 3300048926 Bacteria 3216
184 Ga0496124_0030829 3300048927 Bacteria 4752
185 Ga0496125_0000837 3300048928 Bacteria 49469
186 Ga0496125_0013453 3300048928 Bacteria 8040
187 Ga0501033_0000002 3300049570 Bacteria 668574
188 Ga0501033_0000122 3300049570 Bacteria 75161
189 Ga0501038_0026618 3300049574 Bacteria 5150
190 Ga0501067_0221233 3300049583 Bacteria 1054
191 Ga0501083_0000715 3300049744 Bacteria 21644
192 Ga0501044_0029845 3300049823 Bacteria 5749
193 Ga0501044_0400647 3300049823 Bacteria 1285
194 Ga0501082_0016155 3300060353 Bacteria 6423

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047321 Ga0495676_0335199 Ga0495676_0335199_16_639 205
2 3300048919 Ga0496116_0217183 Ga0496116_0217183_247_924 223
3 3300046810 Ga0495660_0125239 Ga0495660_0125239_133_813 224
4 3300048920 Ga0496117_0091193 Ga0496117_0091193_1251_1934 225
5 3300005618 Ga0068864_100111698 Ga0068864_1001116982 230
6 3300005841 Ga0068863_100012774 Ga0068863_1000127743 230
7 3300014325 Ga0163163_10005949 Ga0163163_100059497 230
8 3300026088 Ga0207641_10043682 Ga0207641_100436823 230
9 3300048915 Ga0496112_0014240 Ga0496112_0014240_5149_5844 230
10 iso_pu_bacteria 2554235283 2555470304 232
11 iso_pu_bacteria 2643221735 2644740123 232
12 iso_pu_bacteria 2671180330 2672337306 232
13 iso_pu_bacteria 2684623153 2686996940 232
14 iso_pu_bacteria 2687453109 2687498244 232
15 iso_pu_bacteria 2788500588 2791212969 232
16 iso_pu_bacteria 2811994870 2812316127 232
17 iso_pu_bacteria 2816332186 2816862271 232
18 iso_pu_bacteria 2823526263 2823528092 232
19 iso_pu_bacteria 2842682962 2842684814 232
20 iso_pu_bacteria 2849139964 2849141370 232
21 iso_pu_bacteria 2857581216 2857585448 232
22 iso_pu_bacteria 2904606771 2904607301 232
23 iso_pu_bacteria 2919414237 2919414515 232
24 iso_pu_bacteria 2919726948 2919728927 232
25 iso_pu_bacteria 2956897341 2956897890 232
26 iso_pu_bacteria 2990275345 2990276822 232
27 iso_pu_bacteria 3001267043 3001271359 232
28 iso_pu_bacteria 3001892409 3001893226 232
29 iso_pu_bacteria 8022948649 8022951604 232
30 iso_pu_bacteria 2551306519 2553393994 233
31 iso_pu_bacteria 2643221729 2644703797 233
32 iso_pu_bacteria 2643221730 2644708489 233
33 iso_pu_bacteria 2684622632 2685149222 233
34 iso_pu_bacteria 2695420987 2698323957 233
35 iso_pu_bacteria 2718218445 2721504604 233
36 iso_pu_bacteria 2738541358 2739156435 233
37 iso_pu_bacteria 2738543006 2739210047 233
38 iso_pu_bacteria 2818991441 2819570010 233
39 iso_pu_bacteria 2818991443 2819579626 233
40 iso_pu_bacteria 2929233124 2929234492 233
41 iso_pu_bacteria 2938917290 2938918673 233
42 iso_pu_bacteria 2947426588 2947428041 233
43 iso_pu_bacteria 2965761152 2965762523 233
44 iso_pu_bacteria 2979083700 2979084953 233
45 iso_pu_bacteria 8022621104 8022622456 233
46 iso_pu_bacteria 8022792930 8022798337 233
47 iso_pu_bacteria 8023438354 8023442654 233
48 iso_pu_bacteria 8023444577 8023449513 233
49 iso_pu_bacteria 8057582654 8057584041 233
50 3300046517 Ga0495630_0071490 Ga0495630_0071490_1575_2396 234
51 iso_pu_bacteria 2643221731 2644719528 234
52 iso_pu_bacteria 2643221732 2644722031 234
53 iso_pu_bacteria 2818991465 2819708271 234
54 iso_pu_bacteria 2818991468 2819724869 234
55 iso_pu_bacteria 2842882022 2842885485 234
56 iso_pu_bacteria 2904524088 2904527922 234
57 iso_pu_bacteria 2908665501 2908665635 234
58 iso_pu_bacteria 2919093281 2919094259 234
59 iso_pu_bacteria 2919143609 2919148002 234
60 iso_pu_bacteria 2919517244 2919521033 234
61 iso_pu_bacteria 2919720352 2919724245 234
62 iso_pu_bacteria 2928093941 2928097727 234
63 iso_pu_bacteria 2929004312 2929004875 234
64 iso_pu_bacteria 2954773129 2954774402 234
65 iso_pu_bacteria 2960319331 2960322424 234
66 iso_pu_bacteria 2960375949 2960381327 234
67 iso_pu_bacteria 8022893055 8022893871 234
68 iso_pu_bacteria 8022914991 8022915759 234
69 iso_pu_bacteria 3006826541 3006828202 235
70 iso_pu_bacteria 3006969106 3006973647 235
71 3300003578 Ga0006562J51391_1007014 Ga0006562J51391_10070147 236
72 3300013296 Ga0157374_10221661 Ga0157374_102216612 236
73 3300013297 Ga0157378_10004929 Ga0157378_1000492911 236
74 3300013308 Ga0157375_10014731 Ga0157375_100147315 236
75 3300025284 Ga0209130_1008159 Ga0209130_10081593 236
76 3300025294 Ga0209025_1009163 Ga0209025_10091636 236
77 3300027252 Ga0209973_1026218 Ga0209973_10262181 236
78 3300028577 Ga0265318_10057061 Ga0265318_100570611 236
79 3300028653 Ga0265323_10008177 Ga0265323_100081773 236
80 3300028654 Ga0265322_10004712 Ga0265322_100047123 236
81 3300031242 Ga0265329_10070897 Ga0265329_100708971 236
82 3300031344 Ga0265316_10111400 Ga0265316_101114002 236
83 3300031712 Ga0265342_10035123 Ga0265342_100351233 236
84 3300031712 Ga0265342_10070792 Ga0265342_100707922 236
85 3300035398 Ga0316574_0052160 Ga0316574_0052160_828_1541 236
86 3300042876 Ga0451577_0013266 Ga0451577_0013266_2519_3259 236
87 3300048916 Ga0496113_0389809 Ga0496113_0389809_230_946 236
88 3300048928 Ga0496125_0000837 Ga0496125_0000837_23730_24449 236
89 iso_pu_bacteria 8055531788 8055536529 236
90 3300002987 JGI25159J45721_1014124 JGI25159J45721_10141241 237
91 3300002987 JGI25159J45721_1020174 JGI25159J45721_10201741 237
92 3300003187 JGI25151J46595_10001358 JGI25151J46595_100013589 237
93 3300003187 JGI25151J46595_10001910 JGI25151J46595_100019104 237
94 3300003187 JGI25151J46595_10030395 JGI25151J46595_100303952 237
95 3300003187 JGI25151J46595_10037543 JGI25151J46595_100375431 237
96 3300003316 rootH1_10011350 rootH1_1001135019 237
97 3300003320 rootH2_10254517 rootH2_102545171 237
98 3300003322 rootL2_10019319 rootL2_1001931910 237
99 3300003578 Ga0006562J51391_1001573 Ga0006562J51391_10015735 237
100 3300003790 Ga0055528_1003493 Ga0055528_10034932 237
101 3300005328 Ga0070676_10074383 Ga0070676_100743831 237
102 3300005354 Ga0070675_100318852 Ga0070675_1003188522 237
103 3300005547 Ga0070693_100335420 Ga0070693_1003354202 237
104 3300009011 Ga0105251_10021771 Ga0105251_100217712 237
105 3300009011 Ga0105251_10165360 Ga0105251_101653601 237
106 3300009036 Ga0105244_10008527 Ga0105244_100085272 237
107 3300009036 Ga0105244_10017966 Ga0105244_100179662 237
108 3300009036 Ga0105244_10136649 Ga0105244_101366492 237
109 3300009036 Ga0105244_10206764 Ga0105244_102067641 237
110 3300009036 Ga0105244_10278444 Ga0105244_102784441 237
111 3300009092 Ga0105250_10001293 Ga0105250_100012936 237
112 3300009092 Ga0105250_10096306 Ga0105250_100963061 237
113 3300009092 Ga0105250_10134120 Ga0105250_101341201 237
114 3300009098 Ga0105245_10070044 Ga0105245_100700442 237
115 3300009148 Ga0105243_10038346 Ga0105243_100383463 237
116 3300011119 Ga0105246_10009271 Ga0105246_100092713 237
117 3300011119 Ga0105246_10021859 Ga0105246_100218592 237
118 3300013296 Ga0157374_10015715 Ga0157374_100157151 237
119 3300025229 Ga0209147_101694 Ga0209147_1016942 237
120 3300025229 Ga0209147_102497 Ga0209147_1024973 237
121 3300025273 Ga0209673_1002552 Ga0209673_10025527 237
122 3300025284 Ga0209130_1000643 Ga0209130_10006433 237
123 3300025284 Ga0209130_1001763 Ga0209130_100176313 237
124 3300025284 Ga0209130_1010653 Ga0209130_10106532 237
125 3300025294 Ga0209025_1000457 Ga0209025_100045774 237
126 3300025294 Ga0209025_1000722 Ga0209025_100072216 237
127 3300025294 Ga0209025_1001182 Ga0209025_10011827 237
128 3300025294 Ga0209025_1001731 Ga0209025_100173117 237
129 3300025294 Ga0209025_1006419 Ga0209025_10064199 237
130 3300025294 Ga0209025_1007033 Ga0209025_10070334 237
131 3300025294 Ga0209025_1008151 Ga0209025_10081512 237
132 3300025294 Ga0209025_1010222 Ga0209025_10102221 237
133 3300025294 Ga0209025_1011636 Ga0209025_10116365 237
134 3300025302 Ga0207426_1024946 Ga0207426_10249462 237
135 3300025711 Ga0207696_1018279 Ga0207696_10182792 237
136 3300025711 Ga0207696_1020313 Ga0207696_10203132 237
137 3300025711 Ga0207696_1025042 Ga0207696_10250422 237
138 3300025728 Ga0207655_1025556 Ga0207655_10255562 237
139 3300025728 Ga0207655_1055131 Ga0207655_10551312 237
140 3300025735 Ga0207713_1008696 Ga0207713_10086962 237
141 3300025735 Ga0207713_1046602 Ga0207713_10466022 237
142 3300025735 Ga0207713_1060850 Ga0207713_10608502 237
143 3300025735 Ga0207713_1137979 Ga0207713_11379791 237
144 3300030083 Ga0237817_10021 Ga0237817_1002120 237
145 3300030083 Ga0237817_10040 Ga0237817_100407 237
146 3300045976 Ga0466967_0003627 Ga0466967_0003627_2711_3430 237
147 3300046455 Ga0495603_0268057 Ga0495603_0268057_223_945 237
148 3300048903 Ga0496100_0002231 Ga0496100_0002231_5686_6408 237
149 3300048904 Ga0496101_0012703 Ga0496101_0012703_1528_2250 237
150 3300048905 Ga0496102_0513581 Ga0496102_0513581_271_993 237
151 3300048906 Ga0496103_0003980 Ga0496103_0003980_7995_8717 237
152 3300048907 Ga0496104_0004233 Ga0496104_0004233_2971_3693 237
153 3300048908 Ga0496105_0002073 Ga0496105_0002073_8258_8980 237
154 3300048909 Ga0496106_0000227 Ga0496106_0000227_11488_12210 237
155 3300048910 Ga0496107_0000148 Ga0496107_0000148_14434_15156 237
156 3300048911 Ga0496108_0001890 Ga0496108_0001890_9473_10195 237
157 3300048912 Ga0496109_0001825 Ga0496109_0001825_1565_2287 237
158 3300048915 Ga0496112_0003496 Ga0496112_0003496_1728_2450 237
159 3300048916 Ga0496113_0013685 Ga0496113_0013685_256_978 237
160 3300048919 Ga0496116_0032390 Ga0496116_0032390_2901_3623 237
161 3300048925 Ga0496122_0018018 Ga0496122_0018018_5700_6422 237
162 3300048926 Ga0496123_0041003 Ga0496123_0041003_233_955 237
163 3300048927 Ga0496124_0030829 Ga0496124_0030829_18_740 237
164 3300048928 Ga0496125_0013453 Ga0496125_0013453_1179_1901 237
165 3300003187 JGI25151J46595_10000012 JGI25151J46595_1000001289 238
166 3300025294 Ga0209025_1000001 Ga0209025_10000011158 238
167 3300025292 Ga0209676_1008823 Ga0209676_10088234 240
168 3300025294 Ga0209025_1033617 Ga0209025_10336172 240
169 3300048907 Ga0496104_0138145 Ga0496104_0138145_1106_1843 243
170 3300048913 Ga0496110_0000495 Ga0496110_0000495_11251_11988 243
171 3300048914 Ga0496111_0004563 Ga0496111_0004563_4337_5074 243
172 3300049583 Ga0501067_0221233 Ga0501067_0221233_36_794 244
173 3300060353 Ga0501082_0016155 Ga0501082_0016155_2376_3134 244
174 3300028577 Ga0265318_10001341 Ga0265318_1000134111 245
175 3300031241 Ga0265325_10001532 Ga0265325_1000153217 245
176 3300031247 Ga0265340_10015883 Ga0265340_100158833 245
177 3300031344 Ga0265316_10006411 Ga0265316_100064117 245
178 3300046501 Ga0495607_0110772 Ga0495607_0110772_294_1052 246
179 3300046557 Ga0495622_0021808 Ga0495622_0021808_1263_2021 246
180 3300046794 Ga0495589_0134321 Ga0495589_0134321_28_786 246
181 3300028563 Ga0265319_1000462 Ga0265319_10004629 247
182 3300028577 Ga0265318_10000573 Ga0265318_1000057315 247
183 3300031235 Ga0265330_10000130 Ga0265330_100001306 247
184 3300031239 Ga0265328_10013238 Ga0265328_100132382 247
185 3300031240 Ga0265320_10003176 Ga0265320_100031763 247
186 3300031242 Ga0265329_10000121 Ga0265329_1000012127 247
187 3300031249 Ga0265339_10001091 Ga0265339_1000109111 247
188 3300031250 Ga0265331_10000764 Ga0265331_100007646 247
189 3300031344 Ga0265316_10007873 Ga0265316_100078737 247
190 3300031595 Ga0265313_10000128 Ga0265313_1000012822 247
191 3300031711 Ga0265314_10001019 Ga0265314_1000101931 247
192 3300031712 Ga0265342_10000737 Ga0265342_1000073714 247
193 iso_pu_bacteria 2786546548 2787507496 247
194 3300031548 Ga0307408_100000833 Ga0307408_10000083321 248
195 3300031852 Ga0307410_10086628 Ga0307410_100866283 248
196 3300031901 Ga0307406_10011483 Ga0307406_100114836 248
197 3300031995 Ga0307409_100000244 Ga0307409_10000024417 248
198 3300028800 Ga0265338_10003487 Ga0265338_100034876 249
199 3300031241 Ga0265325_10059788 Ga0265325_100597881 250
200 3300035398 Ga0316574_0136887 Ga0316574_0136887_560_1351 250
201 3300002155 JGI24033J26618_1000177 JGI24033J26618_10001778 251
202 3300003320 rootH2_10068500 rootH2_100685004 251
203 3300003323 rootH1_10195542 rootH1_101955422 251
204 3300003323 rootH1_10250351 rootH1_102503512 251
205 3300005355 Ga0070671_100096937 Ga0070671_1000969372 251
206 3300005577 Ga0068857_100024488 Ga0068857_1000244884 251
207 3300005614 Ga0068856_100017654 Ga0068856_1000176545 251
208 3300006028 Ga0070717_10000029 Ga0070717_1000002976 251
209 3300014325 Ga0163163_10496981 Ga0163163_104969812 251
210 3300025920 Ga0207649_10000125 Ga0207649_1000012527 251
211 3300025931 Ga0207644_10311788 Ga0207644_103117882 251
212 3300026078 Ga0207702_10001384 Ga0207702_1000138412 251
213 3300028556 Ga0265337_1001044 Ga0265337_10010448 251
214 3300028563 Ga0265319_1002473 Ga0265319_100247312 251
215 3300028563 Ga0265319_1014970 Ga0265319_10149703 251
216 3300028563 Ga0265319_1034525 Ga0265319_10345252 251
217 3300028573 Ga0265334_10007951 Ga0265334_100079513 251
218 3300028577 Ga0265318_10009854 Ga0265318_100098545 251
219 3300028653 Ga0265323_10000004 Ga0265323_1000000443 251
220 3300028653 Ga0265323_10005143 Ga0265323_100051435 251
221 3300028653 Ga0265323_10015043 Ga0265323_100150432 251
222 3300028653 Ga0265323_10016299 Ga0265323_100162991 251
223 3300028653 Ga0265323_10025498 Ga0265323_100254982 251
224 3300028654 Ga0265322_10000123 Ga0265322_1000012328 251
225 3300028800 Ga0265338_10000416 Ga0265338_1000041662 251
226 3300029957 Ga0265324_10002051 Ga0265324_100020512 251
227 3300031235 Ga0265330_10030284 Ga0265330_100302842 251
228 3300031240 Ga0265320_10000108 Ga0265320_1000010843 251
229 3300031240 Ga0265320_10000120 Ga0265320_1000012065 251
230 3300031240 Ga0265320_10001557 Ga0265320_1000155710 251
231 3300031240 Ga0265320_10045517 Ga0265320_100455172 251
232 3300031241 Ga0265325_10021092 Ga0265325_100210923 251
233 3300031247 Ga0265340_10009773 Ga0265340_100097734 251
234 3300031251 Ga0265327_10000037 Ga0265327_10000037216 251
235 3300031344 Ga0265316_10023854 Ga0265316_100238544 251
236 3300031344 Ga0265316_10063480 Ga0265316_100634802 251
237 3300031344 Ga0265316_10072294 Ga0265316_100722942 251
238 3300031344 Ga0265316_10139835 Ga0265316_101398352 251
239 3300031344 Ga0265316_10180237 Ga0265316_101802372 251
240 3300031344 Ga0265316_10341994 Ga0265316_103419942 251
241 3300031595 Ga0265313_10011589 Ga0265313_100115892 251
242 3300031711 Ga0265314_10184294 Ga0265314_101842942 251
243 3300031712 Ga0265342_10002458 Ga0265342_100024589 251
244 3300031712 Ga0265342_10010136 Ga0265342_100101367 251
245 3300031712 Ga0265342_10037064 Ga0265342_100370641 251
246 3300031712 Ga0265342_10075024 Ga0265342_100750242 251
247 3300031712 Ga0265342_10214232 Ga0265342_102142321 251
248 3300044842 Ga0466957_0021203 Ga0466957_0021203_1977_2732 251
249 3300045051 Ga0451576_0003259 Ga0451576_0003259_2957_3727 251
250 3300045976 Ga0466967_0046640 Ga0466967_0046640_1731_2492 251
251 3300049570 Ga0501033_0000002 Ga0501033_0000002_176938_177744 251
252 3300049570 Ga0501033_0000122 Ga0501033_0000122_58967_59722 251
253 3300049574 Ga0501038_0026618 Ga0501038_0026618_2467_3222 251
254 3300049744 Ga0501083_0000715 Ga0501083_0000715_15099_15932 251
255 3300049823 Ga0501044_0029845 Ga0501044_0029845_219_986 251
256 3300049823 Ga0501044_0400647 Ga0501044_0400647_53_808 251

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02754

CCG

Cysteine-rich domain

38

119

0.95

PF02754

CCG

Cysteine-rich domain

166

250

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5odq-assembly1.cif.gz_B heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus soaked with bromoethanesulfonate. 0.7678 12 251
7bkb-assembly1.cif.gz_B formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (hexameric, composite structure) 0.764 10 251
7bkb-assembly1.cif.gz_B formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (hexameric, composite structure) 0.7374 10 251
5odq-assembly1.cif.gz_B heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus soaked with bromoethanesulfonate. 0.7344 12 251
5ixm-assembly3.cif.gz_F the lps transporter lptde from yersinia pestis, core complex 0.6505 2 44
ID Description Score Start End Superfamily
af_P77252_3_85_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9506 14 89 3.40.30.10
af_P77252_132_217_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9332 142 224 3.40.30.10
af_P52074_170_256_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9042 14 91 3.40.30.10
af_P77252_132_217_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8926 142 224 3.40.30.10
af_P0A996_163_249_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.881 14 89 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A842HC25-F1-model_v4 (Fe-S)-binding protein 0.9908 16 250 GO:0005829
GO:0016491
AF-A0A2T6DZW7-F1-model_v4 (Fe-S)-binding protein 0.9884 16 251 GO:0005829
GO:0016491
AF-R7L4W7-F1-model_v4 Fe-S oxidoreductase 0.9836 7 250 GO:0005829
GO:0016491
AF-A0A2T6DZW7-F1-model_v4 (Fe-S)-binding protein 0.9761 16 251 GO:0005829
GO:0016491
AF-A0A1E5G6E4-F1-model_v4 Fe-S oxidoreductase 0.97 12 248 GO:0005829
GO:0016491

Feature Viewer

pLDDT pTM Quality
92.12 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map