F366791

General Info

Members Datasets Scaffolds Average Seq Length
256 200 246 79

Family's Representative Sequence

Representative Sequence 3300047446|Ga0495679_121432|Ga0495679_121432_351_629
Length 92
Sequence MYVECCLVLDLKEKMMRTTLAIDDDVLAAAKGLASLQRKSIGEVISALARQALQPQAPSHTTRNGVPLLQLQTGTMPVTLDMVNKLRDELPG

Samples

Sample ID Description Type Environment
1 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
2 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
3 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
4 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
5 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
6 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
7 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
8 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
9 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
10 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
11 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
17 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
18 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
32 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
33 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
34 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
43 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
44 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
45 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
46 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
47 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
48 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
50 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
51 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
52 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
53 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
55 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
71 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
72 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
73 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
74 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
75 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
76 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
77 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
78 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
79 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
80 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
81 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
82 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
83 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
84 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
85 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
86 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
87 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
88 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
91 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
92 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
93 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
94 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
95 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
96 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
97 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
98 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
99 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
100 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
101 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
102 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
103 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
104 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
105 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
106 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
107 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
108 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
109 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
110 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
111 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
112 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
113 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
114 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
115 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
116 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
117 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
118 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
119 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
120 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
121 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
122 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
123 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
124 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
125 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
126 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
127 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
128 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
129 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
130 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
131 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
132 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
133 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
134 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
135 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
136 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
137 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
138 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
139 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
140 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
141 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
142 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
143 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
144 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
145 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
146 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
147 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
148 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
149 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
150 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
151 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
152 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
153 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
154 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
155 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
156 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
157 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
158 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
159 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
160 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
161 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
162 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
163 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
164 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
165 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
166 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
167 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
168 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
169 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
170 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
171 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
172 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
173 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
183 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
184 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
185 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
186 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
187 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
188 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
189 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
190 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
191 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
192 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
193 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
194 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
195 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
196 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
197 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
198 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
199 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
200 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.09
Metatranscriptomes 0
Isolates 3.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.94
Nodule 0.39
Rhizoplane 1.95
Rhizosphere 71.88
Stem 0
Stem Tuber 0
Unclassified 14.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000097 3300002704 Bacteria 48934
2 JGI25156J39149_1000174 3300002705 Bacteria 47087
3 JGI25154J39366_1000011 3300002738 Bacteria 296007
4 JGI25157J39369_1000218 3300002741 Bacteria 47085
5 rootH2_10026872 3300003320 Bacteria 12345
6 rootH2_10036254 3300003320 Bacteria 1645
7 rootL2_10022849 3300003322 Bacteria 2126
8 rootL2_10334472 3300003322 Bacteria 1186
9 rootH1_10011962 3300003323 Bacteria 2744
10 rootH1_10012019 3300003323 Bacteria 1594
11 rootH1_10157728 3300003323 Bacteria 6466
12 Ga0055526_1038190 3300003771 Bacteria 1242
13 Ga0055526_1044507 3300003771 Bacteria 1071
14 Ga0055524_1008175 3300003775 Bacteria 4369
15 Ga0055528_1002524 3300003790 Bacteria 9745
16 JGI25405J52794_10003006 3300003911 Bacteria 2934
17 Ga0070683_100035726 3300005329 Bacteria 4543
18 Ga0070683_102294965 3300005329 Unclassified 518
19 Ga0068869_100640524 3300005334 Bacteria 901
20 Ga0070660_100004334 3300005339 Bacteria 9801
21 Ga0070659_100008404 3300005366 Bacteria 7541
22 Ga0070663_100274236 3300005455 Bacteria 1342
23 Ga0070684_100002135 3300005535 Bacteria 14601
24 Ga0068853_100000124 3300005539 Bacteria 51590
25 Ga0068855_100095653 3300005563 Bacteria 3423
26 Ga0068854_100000037 3300005578 Bacteria 100242
27 Ga0068860_100468762 3300005843 Bacteria 1254
28 Ga0081455_10000325 3300005937 Bacteria 62388
29 Ga0075364_10036283 3300006051 Bacteria 3187
30 Ga0075366_10027892 3300006195 Bacteria 3313
31 Ga0075366_10256602 3300006195 Bacteria 1067
32 Ga0075370_10003976 3300006353 Bacteria 7103
33 Ga0099794_10477603 3300007265 Unclassified 655
34 Ga0105244_10011202 3300009036 Bacteria 5395
35 Ga0105240_10010327 3300009093 Bacteria 13136
36 Ga0105243_10021197 3300009148 Bacteria 4932
37 Ga0105243_10240657 3300009148 Bacteria 1610
38 Ga0105248_10069034 3300009177 Bacteria 3968
39 Ga0157370_10118598 3300013104 Bacteria 2471
40 Ga0157369_10105555 3300013105 Bacteria 2999
41 Ga0157369_10901926 3300013105 Unclassified 906
42 Ga0163162_11484645 3300013306 Bacteria 772
43 Ga0157372_11811327 3300013307 Bacteria 702
44 Ga0157380_12311698 3300014326 Unclassified 602
45 Ga0213872_10232524 3300021361 Unclassified 781
46 Ga0213876_10000379 3300021384 Bacteria 37697
47 Ga0213876_10353206 3300021384 Unclassified 782
48 Ga0213871_10120481 3300021441 Bacteria 782
49 Ga0228598_1090304 3300024227 Unclassified 616
50 Ga0209435_100012 3300025206 Bacteria 401621
51 Ga0209672_112229 3300025228 Bacteria 1072
52 Ga0209437_117236 3300025233 Bacteria 952
53 Ga0209646_1000026 3300025246 Bacteria 401621
54 Ga0209026_1000014 3300025250 Bacteria 401621
55 Ga0209759_1000012 3300025256 Bacteria 401621
56 Ga0209673_1000048 3300025273 Bacteria 287976
57 Ga0209025_1015261 3300025294 Bacteria 4647
58 Ga0209564_1022364 3300025295 Bacteria 2237
59 Ga0209256_1000852 3300025299 Bacteria 38024
60 Ga0209051_1077460 3300025303 Bacteria 973
61 Ga0207695_10016788 3300025913 Bacteria 8548
62 Ga0207657_10004156 3300025919 Bacteria 15346
63 Ga0207690_10000848 3300025932 Bacteria 19595
64 Ga0207709_10118013 3300025935 Bacteria 1786
65 Ga0207711_10013951 3300025941 Bacteria 6673
66 Ga0207689_10130057 3300025942 Bacteria 2072
67 Ga0207661_10020120 3300025944 Bacteria 4984
68 Ga0207667_10025439 3300025949 Bacteria 6477
69 Ga0207640_10000002 3300025981 Bacteria 524211
70 Ga0207639_10000071 3300026041 Bacteria 94980
71 Ga0207678_10121766 3300026067 Bacteria 2226
72 Ga0207702_11109638 3300026078 Bacteria 785
73 Ga0265319_1181596 3300028563 Unclassified 648
74 Ga0307515_10594943 3300028794 Bacteria 716
75 Ga0265338_10004683 3300028800 Bacteria 18349
76 Ga0265338_10055221 3300028800 Bacteria 3534
77 Ga0265338_10579224 3300028800 Bacteria 783
78 Ga0265324_10014675 3300029957 Bacteria 2893
79 Ga0307512_10245044 3300030522 Unclassified 901
80 Ga0265330_10075788 3300031235 Unclassified 1452
81 Ga0265320_10391492 3300031240 Unclassified 614
82 Ga0265325_10030918 3300031241 Bacteria 2869
83 Ga0265325_10066929 3300031241 Bacteria 1810
84 Ga0265325_10201378 3300031241 Unclassified 918
85 Ga0265325_10213954 3300031241 Unclassified 884
86 Ga0265340_10006158 3300031247 Bacteria 6616
87 Ga0265340_10012438 3300031247 Bacteria 4495
88 Ga0265340_10023224 3300031247 Unclassified 3164
89 Ga0265339_10001357 3300031249 Bacteria 18292
90 Ga0265339_10005230 3300031249 Bacteria 8676
91 Ga0265339_10042670 3300031249 Bacteria 2511
92 Ga0265316_10052037 3300031344 Bacteria 3214
93 Ga0265316_10155363 3300031344 Bacteria 1712
94 Ga0265316_10738678 3300031344 Bacteria 692
95 Ga0307513_10012711 3300031456 Bacteria 10366
96 Ga0307408_100000006 3300031548 Bacteria 472824
97 Ga0307408_100195017 3300031548 Bacteria 1635
98 Ga0265313_10086109 3300031595 Unclassified 1418
99 Ga0265314_10007222 3300031711 Bacteria 9661
100 Ga0265342_10085166 3300031712 Bacteria 1820
101 Ga0265342_10156621 3300031712 Bacteria 1261
102 Ga0265342_10247946 3300031712 Bacteria 951
103 Ga0307516_10937711 3300031730 Unclassified 534
104 Ga0307406_10119514 3300031901 Bacteria 1829
105 Ga0307409_100094343 3300031995 Bacteria 2462
106 Ga0307416_100189046 3300032002 Bacteria 1940
107 Ga0307416_102804902 3300032002 Bacteria 583
108 Ga0307414_10678302 3300032004 Bacteria 931
109 Ga0307415_101141439 3300032126 Unclassified 731
110 Ga0307415_101192156 3300032126 Bacteria 717
111 Ga0373923_0056543 3300035111 Bacteria 1657
112 Ga0373956_0154220 3300035119 Bacteria 1081
113 Ga0373933_0153831 3300035724 Bacteria 1458
114 Ga0373937_0014561 3300036401 Bacteria 6946
115 Ga0395898_1183253 3300037466 Unclassified 696
116 Ga0436365_0149599 3300039437 Unclassified 635
117 Ga0436365_0374292 3300039437 Unclassified 4763
118 Ga0436365_1196036 3300039437 Bacteria 119165
119 Ga0436360_0694982 3300039438 Unclassified 572
120 Ga0436360_0760003 3300039438 Unclassified 688
121 Ga0436360_1107297 3300039438 Bacteria 952
122 Ga0436361_0576499 3300039447 Bacteria 34396
123 Ga0436361_0914104 3300039447 Bacteria 1350
124 Ga0436363_0562101 3300039450 Bacteria 2080
125 Ga0436362_0454685 3300039453 Unclassified 955
126 Ga0436362_1035803 3300039453 Bacteria 623
127 Ga0451791_1449762 3300041451 Unclassified 536
128 Ga0451793_0694510 3300041452 Unclassified 541
129 Ga0451797_0972861 3300041453 Bacteria 656
130 Ga0451807_0699959 3300041486 Bacteria 844
131 Ga0451837_0752537 3300041494 Unclassified 716
132 Ga0451841_0794685 3300041498 Bacteria 541
133 Ga0451845_0219858 3300041501 Bacteria 1039
134 Ga0451855_0632016 3300041511 Bacteria 859
135 Ga0439445_0148832 3300042004 Unclassified 681
136 Ga0451577_0163611 3300042876 Bacteria 2004
137 Ga0466966_0128404 3300044684 Bacteria 1553
138 Ga0466966_0245408 3300044684 Unclassified 1079
139 Ga0466961_0109024 3300044693 Bacteria 1743
140 Ga0466963_0155491 3300044694 Bacteria 1589
141 Ga0466963_1118663 3300044694 Unclassified 554
142 Ga0466964_0360734 3300044706 Unclassified 749
143 Ga0466968_0277890 3300044735 Bacteria 801
144 Ga0466970_0017790 3300044765 Bacteria 3674
145 Ga0466970_0240936 3300044765 Bacteria 1012
146 Ga0466957_0030529 3300044842 Bacteria 3218
147 Ga0466957_1371941 3300044842 Bacteria 514
148 Ga0466959_0076806 3300045049 Bacteria 2411
149 Ga0466958_0024165 3300045836 Bacteria 3575
150 Ga0466967_0370621 3300045976 Bacteria 1389
151 Ga0495617_001021 3300046452 Bacteria 12889
152 Ga0495627_062228 3300046453 Bacteria 1102
153 Ga0495603_0718432 3300046455 Unclassified 571
154 Ga0495590_0039861 3300046457 Bacteria 1639
155 Ga0495638_0001462 3300046460 Bacteria 21338
156 Ga0495580_0759249 3300046472 Unclassified 631
157 Ga0495580_0929281 3300046472 Unclassified 558
158 Ga0495605_0001012 3300046474 Bacteria 18963
159 Ga0495585_0001589 3300046492 Bacteria 17576
160 Ga0495594_0254669 3300046499 Bacteria 1000
161 Ga0495607_0002387 3300046501 Bacteria 15311
162 Ga0495607_0087051 3300046501 Bacteria 1701
163 Ga0495583_0000004 3300046506 Bacteria 655287
164 Ga0495583_0063424 3300046506 Bacteria 1642
165 Ga0495583_0107782 3300046506 Bacteria 1183
166 Ga0495610_0065375 3300046512 Bacteria 1716
167 Ga0495616_0001765 3300046513 Bacteria 14725
168 Ga0495616_0444527 3300046513 Unclassified 526
169 Ga0495620_0215262 3300046515 Unclassified 736
170 Ga0495620_0397090 3300046515 Bacteria 522
171 Ga0495643_0238991 3300046522 Bacteria 853
172 Ga0495644_0000214 3300046523 Bacteria 27373
173 Ga0495648_0000930 3300046524 Bacteria 30420
174 Ga0495663_0127048 3300046525 Bacteria 857
175 Ga0495609_0000823 3300046538 Bacteria 23077
176 Ga0495609_0061380 3300046538 Bacteria 1660
177 Ga0495622_0157475 3300046557 Bacteria 1025
178 Ga0495622_0268940 3300046557 Unclassified 747
179 Ga0495633_0065820 3300046558 Bacteria 1693
180 Ga0495656_0001595 3300046615 Bacteria 7424
181 Ga0495668_0463709 3300046616 Bacteria 697
182 Ga0495611_0000898 3300046648 Bacteria 16183
183 Ga0495625_0004876 3300046660 Bacteria 12506
184 Ga0495625_0142933 3300046660 Bacteria 1613
185 Ga0495659_0000229 3300046664 Bacteria 23719
186 Ga0495661_0053574 3300046665 Bacteria 2425
187 Ga0495661_0083644 3300046665 Bacteria 1834
188 Ga0495588_0354009 3300046674 Unclassified 771
189 Ga0495670_0000406 3300046691 Bacteria 20593
190 Ga0495670_0100129 3300046691 Bacteria 1492
191 Ga0495671_0001257 3300046692 Bacteria 17333
192 Ga0495671_0652891 3300046692 Unclassified 500
193 Ga0495649_0062899 3300046694 Bacteria 1995
194 Ga0495589_0131389 3300046794 Bacteria 1202
195 Ga0495589_0132494 3300046794 Bacteria 1196
196 Ga0495636_0000226 3300047318 Bacteria 22221
197 Ga0495674_1210107 3300047319 Bacteria 570
198 Ga0495672_0001516 3300047320 Bacteria 22758
199 Ga0495683_0001256 3300047323 Bacteria 17198
200 Ga0495687_004877 3300047443 Bacteria 8803
201 Ga0495687_066107 3300047443 Bacteria 1469
202 Ga0495677_0000505 3300047445 Bacteria 16492
203 Ga0495679_121432 3300047446 Bacteria 714
204 Ga0495685_000239 3300047447 Bacteria 18916
205 Ga0495673_0007980 3300047469 Bacteria 6003
206 Ga0495681_0047730 3300047470 Bacteria 2035
207 Ga0495684_0788450 3300047471 Bacteria 622
208 Ga0495686_0019401 3300047472 Bacteria 4543
209 Ga0496108_1620009 3300048911 Bacteria 535
210 Ga0496118_0084181 3300048921 Bacteria 2220
211 Ga0496119_0000818 3300048922 Bacteria 41562
212 Ga0496121_0029824 3300048924 Bacteria 5028
213 Ga0496125_0000085 3300048928 Bacteria 218570
214 Ga0495678_001770 3300049459 Bacteria 15987
215 Ga0495682_0000197 3300049460 Bacteria 48575
216 Ga0495682_0006829 3300049460 Bacteria 4595
217 Ga0495682_0071767 3300049460 Unclassified 1246
218 Ga0501031_0351863 3300049568 Bacteria 954
219 Ga0501032_0935893 3300049569 Unclassified 545
220 Ga0501033_0149162 3300049570 Bacteria 1688
221 Ga0501034_0217235 3300049571 Bacteria 1865
222 Ga0501034_1076695 3300049571 Bacteria 685
223 Ga0501037_0045341 3300049573 Bacteria 3228
224 Ga0501037_0977894 3300049573 Unclassified 552
225 Ga0501038_0357062 3300049574 Bacteria 1137
226 Ga0501043_0624519 3300049579 Unclassified 794
227 Ga0501047_0072155 3300049581 Bacteria 3323
228 Ga0501048_0066136 3300049582 Bacteria 2556
229 Ga0501068_0580061 3300049584 Bacteria 730
230 Ga0501249_187670 3300049679 Unclassified 537
231 Ga0501080_0216232 3300049742 Bacteria 1755
232 Ga0501044_0244022 3300049823 Bacteria 1739
233 Ga0501044_1481067 3300049823 Bacteria 544
234 nmdc:mga03n38_427229_c1 3300050490 Unclassified 733
235 nmdc:mga00v17_5511_c1 3300050491 Bacteria 6668
236 nmdc:mga0k408_346488_c1 3300050493 Bacteria 886
237 nmdc:mga0k408_708414_c1 3300050493 Unclassified 590
238 nmdc:mga07m45_13305_c1 3300050496 Bacteria 4364
239 Ga0500651_0459080 3300053093 Bacteria 707
240 Ga0500595_013998 3300053119 Bacteria 3056
241 Ga0500561_0128038 3300053137 Bacteria 779
242 Ga0500568_0037988 3300053139 Bacteria 1951
243 Ga0500573_0283996 3300053140 Bacteria 836
244 Ga0500600_0381304 3300053149 Bacteria 567
245 Ga0500622_0028331 3300053156 Bacteria 2948
246 Ga0500634_0253759 3300053161 Unclassified 729

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041498 Ga0451841_0794685 Ga0451841_0794685_181_393 64
2 iso_pu_bacteria 2585427608 2585897921 71
3 iso_pu_bacteria 2818991448 2819612817 71
4 iso_pu_bacteria 2847417321 2847423005 71
5 iso_pu_bacteria 2928108538 2928114261 71
6 iso_pu_bacteria 2996336353 2996337514 71
7 3300021361 Ga0213872_10232524 Ga0213872_102325242 73
8 3300030522 Ga0307512_10245044 Ga0307512_102450442 73
9 3300039447 Ga0436361_0914104 Ga0436361_0914104_531_770 73
10 3300050490 nmdc:mga03n38_427229_c1 nmdc:mga03n38_427229_c1_162_389 73
11 iso_pu_bacteria 2511231027 2511391265 73
12 iso_pu_bacteria 2842871566 2842875742 73
13 3300003320 rootH2_10026872 rootH2_100268722 74
14 3300003771 Ga0055526_1038190 Ga0055526_10381901 74
15 3300003771 Ga0055526_1044507 Ga0055526_10445073 74
16 3300003775 Ga0055524_1008175 Ga0055524_10081754 74
17 3300003790 Ga0055528_1002524 Ga0055528_10025244 74
18 3300005329 Ga0070683_100035726 Ga0070683_1000357262 74
19 3300005329 Ga0070683_102294965 Ga0070683_1022949651 74
20 3300005339 Ga0070660_100004334 Ga0070660_10000433410 74
21 3300005366 Ga0070659_100008404 Ga0070659_1000084043 74
22 3300005455 Ga0070663_100274236 Ga0070663_1002742363 74
23 3300005535 Ga0070684_100002135 Ga0070684_1000021357 74
24 3300005539 Ga0068853_100000124 Ga0068853_10000012441 74
25 3300005563 Ga0068855_100095653 Ga0068855_1000956533 74
26 3300005578 Ga0068854_100000037 Ga0068854_1000000374 74
27 3300009036 Ga0105244_10011202 Ga0105244_100112023 74
28 3300009093 Ga0105240_10010327 Ga0105240_100103272 74
29 3300009148 Ga0105243_10021197 Ga0105243_100211975 74
30 3300009148 Ga0105243_10240657 Ga0105243_102406573 74
31 3300009177 Ga0105248_10069034 Ga0105248_100690342 74
32 3300013104 Ga0157370_10118598 Ga0157370_101185983 74
33 3300013105 Ga0157369_10105555 Ga0157369_101055553 74
34 3300013105 Ga0157369_10901926 Ga0157369_109019262 74
35 3300013307 Ga0157372_11811327 Ga0157372_118113272 74
36 3300021384 Ga0213876_10000379 Ga0213876_1000037919 74
37 3300021384 Ga0213876_10353206 Ga0213876_103532062 74
38 3300021441 Ga0213871_10120481 Ga0213871_101204812 74
39 3300024227 Ga0228598_1090304 Ga0228598_10903042 74
40 3300025233 Ga0209437_117236 Ga0209437_1172362 74
41 3300025273 Ga0209673_1000048 Ga0209673_1000048161 74
42 3300025294 Ga0209025_1015261 Ga0209025_10152614 74
43 3300025295 Ga0209564_1022364 Ga0209564_10223641 74
44 3300025299 Ga0209256_1000852 Ga0209256_100085224 74
45 3300025303 Ga0209051_1077460 Ga0209051_10774603 74
46 3300025913 Ga0207695_10016788 Ga0207695_100167881 74
47 3300025919 Ga0207657_10004156 Ga0207657_1000415614 74
48 3300025932 Ga0207690_10000848 Ga0207690_1000084816 74
49 3300025935 Ga0207709_10118013 Ga0207709_101180133 74
50 3300025941 Ga0207711_10013951 Ga0207711_100139516 74
51 3300025944 Ga0207661_10020120 Ga0207661_100201205 74
52 3300025949 Ga0207667_10025439 Ga0207667_100254392 74
53 3300025981 Ga0207640_10000002 Ga0207640_100000024 74
54 3300026041 Ga0207639_10000071 Ga0207639_1000007186 74
55 3300026067 Ga0207678_10121766 Ga0207678_101217661 74
56 3300028563 Ga0265319_1181596 Ga0265319_11815961 74
57 3300028800 Ga0265338_10004683 Ga0265338_100046838 74
58 3300028800 Ga0265338_10055221 Ga0265338_100552214 74
59 3300028800 Ga0265338_10579224 Ga0265338_105792242 74
60 3300029957 Ga0265324_10014675 Ga0265324_100146753 74
61 3300031235 Ga0265330_10075788 Ga0265330_100757881 74
62 3300031240 Ga0265320_10391492 Ga0265320_103914921 74
63 3300031241 Ga0265325_10030918 Ga0265325_100309182 74
64 3300031241 Ga0265325_10066929 Ga0265325_100669292 74
65 3300031241 Ga0265325_10201378 Ga0265325_102013781 74
66 3300031241 Ga0265325_10213954 Ga0265325_102139541 74
67 3300031247 Ga0265340_10006158 Ga0265340_100061584 74
68 3300031247 Ga0265340_10012438 Ga0265340_100124385 74
69 3300031247 Ga0265340_10023224 Ga0265340_100232242 74
70 3300031249 Ga0265339_10001357 Ga0265339_100013577 74
71 3300031249 Ga0265339_10005230 Ga0265339_100052302 74
72 3300031249 Ga0265339_10042670 Ga0265339_100426702 74
73 3300031344 Ga0265316_10052037 Ga0265316_100520372 74
74 3300031344 Ga0265316_10155363 Ga0265316_101553632 74
75 3300031344 Ga0265316_10738678 Ga0265316_107386782 74
76 3300031595 Ga0265313_10086109 Ga0265313_100861093 74
77 3300031711 Ga0265314_10007222 Ga0265314_100072222 74
78 3300031712 Ga0265342_10085166 Ga0265342_100851662 74
79 3300031712 Ga0265342_10156621 Ga0265342_101566212 74
80 3300031712 Ga0265342_10247946 Ga0265342_102479461 74
81 3300035111 Ga0373923_0056543 Ga0373923_0056543_765_995 74
82 3300035119 Ga0373956_0154220 Ga0373956_0154220_506_736 74
83 3300035724 Ga0373933_0153831 Ga0373933_0153831_261_491 74
84 3300036401 Ga0373937_0014561 Ga0373937_0014561_42_272 74
85 3300037466 Ga0395898_1183253 Ga0395898_1183253_388_642 74
86 3300039437 Ga0436365_0149599 Ga0436365_0149599_357_587 74
87 3300039437 Ga0436365_0374292 Ga0436365_0374292_836_1081 74
88 3300039437 Ga0436365_1196036 Ga0436365_1196036_31771_32001 74
89 3300039438 Ga0436360_0760003 Ga0436360_0760003_294_524 74
90 3300039438 Ga0436360_1107297 Ga0436360_1107297_263_493 74
91 3300039447 Ga0436361_0576499 Ga0436361_0576499_16292_16522 74
92 3300039450 Ga0436363_0562101 Ga0436363_0562101_1762_1992 74
93 3300039453 Ga0436362_0454685 Ga0436362_0454685_679_924 74
94 3300039453 Ga0436362_1035803 Ga0436362_1035803_362_592 74
95 3300041452 Ga0451793_0694510 Ga0451793_0694510_136_381 74
96 3300044684 Ga0466966_0245408 Ga0466966_0245408_290_520 74
97 3300044693 Ga0466961_0109024 Ga0466961_0109024_320_550 74
98 3300044694 Ga0466963_1118663 Ga0466963_1118663_28_258 74
99 3300044765 Ga0466970_0240936 Ga0466970_0240936_669_899 74
100 3300044842 Ga0466957_1371941 Ga0466957_1371941_40_270 74
101 3300045049 Ga0466959_0076806 Ga0466959_0076806_1527_1787 74
102 3300046452 Ga0495617_001021 Ga0495617_001021_3682_3939 74
103 3300046457 Ga0495590_0039861 Ga0495590_0039861_790_1047 74
104 3300046460 Ga0495638_0001462 Ga0495638_0001462_6626_6883 74
105 3300046472 Ga0495580_0759249 Ga0495580_0759249_357_587 74
106 3300046474 Ga0495605_0001012 Ga0495605_0001012_6117_6374 74
107 3300046492 Ga0495585_0001589 Ga0495585_0001589_14361_14618 74
108 3300046499 Ga0495594_0254669 Ga0495594_0254669_185_415 74
109 3300046501 Ga0495607_0002387 Ga0495607_0002387_8991_9248 74
110 3300046506 Ga0495583_0000004 Ga0495583_0000004_253313_253570 74
111 3300046506 Ga0495583_0063424 Ga0495583_0063424_532_765 74
112 3300046513 Ga0495616_0001765 Ga0495616_0001765_11080_11337 74
113 3300046523 Ga0495644_0000214 Ga0495644_0000214_18004_18261 74
114 3300046524 Ga0495648_0000930 Ga0495648_0000930_14366_14623 74
115 3300046538 Ga0495609_0000823 Ga0495609_0000823_13762_14019 74
116 3300046615 Ga0495656_0001595 Ga0495656_0001595_3417_3674 74
117 3300046648 Ga0495611_0000898 Ga0495611_0000898_8328_8585 74
118 3300046660 Ga0495625_0004876 Ga0495625_0004876_12213_12470 74
119 3300046664 Ga0495659_0000229 Ga0495659_0000229_17772_18029 74
120 3300046665 Ga0495661_0053574 Ga0495661_0053574_1177_1434 74
121 3300046691 Ga0495670_0000406 Ga0495670_0000406_13990_14247 74
122 3300046692 Ga0495671_0001257 Ga0495671_0001257_4186_4443 74
123 3300046692 Ga0495671_0652891 Ga0495671_0652891_243_476 74
124 3300046694 Ga0495649_0062899 Ga0495649_0062899_258_491 74
125 3300046794 Ga0495589_0132494 Ga0495589_0132494_112_369 74
126 3300047318 Ga0495636_0000226 Ga0495636_0000226_8841_9098 74
127 3300047320 Ga0495672_0001516 Ga0495672_0001516_13858_14115 74
128 3300047323 Ga0495683_0001256 Ga0495683_0001256_12610_12867 74
129 3300047443 Ga0495687_004877 Ga0495687_004877_1075_1332 74
130 3300047445 Ga0495677_0000505 Ga0495677_0000505_6098_6355 74
131 3300047446 Ga0495679_121432 Ga0495679_121432_351_629 74
132 3300047447 Ga0495685_000239 Ga0495685_000239_5549_5806 74
133 3300047469 Ga0495673_0007980 Ga0495673_0007980_457_714 74
134 3300047471 Ga0495684_0788450 Ga0495684_0788450_158_388 74
135 3300047472 Ga0495686_0019401 Ga0495686_0019401_3617_3871 74
136 3300049459 Ga0495678_001770 Ga0495678_001770_6308_6565 74
137 3300049460 Ga0495682_0000197 Ga0495682_0000197_26808_27065 74
138 3300049460 Ga0495682_0006829 Ga0495682_0006829_1178_1438 74
139 3300049460 Ga0495682_0071767 Ga0495682_0071767_978_1235 74
140 3300049568 Ga0501031_0351863 Ga0501031_0351863_369_611 74
141 3300049569 Ga0501032_0935893 Ga0501032_0935893_16_258 74
142 3300049571 Ga0501034_0217235 Ga0501034_0217235_1092_1334 74
143 3300049571 Ga0501034_1076695 Ga0501034_1076695_405_638 74
144 3300049573 Ga0501037_0045341 Ga0501037_0045341_670_903 74
145 3300049574 Ga0501038_0357062 Ga0501038_0357062_709_942 74
146 3300049579 Ga0501043_0624519 Ga0501043_0624519_467_709 74
147 3300049581 Ga0501047_0072155 Ga0501047_0072155_712_954 74
148 3300049582 Ga0501048_0066136 Ga0501048_0066136_1403_1636 74
149 3300049584 Ga0501068_0580061 Ga0501068_0580061_322_555 74
150 3300049679 Ga0501249_187670 Ga0501249_187670_124_387 74
151 3300049742 Ga0501080_0216232 Ga0501080_0216232_269_502 74
152 3300049823 Ga0501044_0244022 Ga0501044_0244022_754_987 74
153 3300053119 Ga0500595_013998 Ga0500595_013998_1680_1913 74
154 3300053140 Ga0500573_0283996 Ga0500573_0283996_50_283 74
155 3300002704 JGI25155J39150_1000097 JGI25155J39150_100009747 75
156 3300002705 JGI25156J39149_1000174 JGI25156J39149_10001746 75
157 3300002738 JGI25154J39366_1000011 JGI25154J39366_100001147 75
158 3300002741 JGI25157J39369_1000218 JGI25157J39369_10002186 75
159 3300003320 rootH2_10036254 rootH2_100362541 75
160 3300003322 rootL2_10022849 rootL2_100228492 75
161 3300003322 rootL2_10334472 rootL2_103344722 75
162 3300003323 rootH1_10011962 rootH1_100119621 75
163 3300003323 rootH1_10012019 rootH1_100120193 75
164 3300003323 rootH1_10157728 rootH1_101577281 75
165 3300003911 JGI25405J52794_10003006 JGI25405J52794_100030062 75
166 3300005334 Ga0068869_100640524 Ga0068869_1006405242 75
167 3300005843 Ga0068860_100468762 Ga0068860_1004687623 75
168 3300005937 Ga0081455_10000325 Ga0081455_1000032541 75
169 3300006051 Ga0075364_10036283 Ga0075364_100362833 75
170 3300006195 Ga0075366_10027892 Ga0075366_100278925 75
171 3300006195 Ga0075366_10256602 Ga0075366_102566023 75
172 3300006353 Ga0075370_10003976 Ga0075370_100039766 75
173 3300007265 Ga0099794_10477603 Ga0099794_104776032 75
174 3300013306 Ga0163162_11484645 Ga0163162_114846452 75
175 3300014326 Ga0157380_12311698 Ga0157380_123116981 75
176 3300025206 Ga0209435_100012 Ga0209435_10001246 75
177 3300025228 Ga0209672_112229 Ga0209672_1122293 75
178 3300025246 Ga0209646_1000026 Ga0209646_100002646 75
179 3300025250 Ga0209026_1000014 Ga0209026_100001446 75
180 3300025256 Ga0209759_1000012 Ga0209759_100001246 75
181 3300025942 Ga0207689_10130057 Ga0207689_101300573 75
182 3300026078 Ga0207702_11109638 Ga0207702_111096381 75
183 3300028794 Ga0307515_10594943 Ga0307515_105949432 75
184 3300031456 Ga0307513_10012711 Ga0307513_100127114 75
185 3300031548 Ga0307408_100000006 Ga0307408_100000006112 75
186 3300031548 Ga0307408_100195017 Ga0307408_1001950172 75
187 3300031730 Ga0307516_10937711 Ga0307516_109377111 75
188 3300031901 Ga0307406_10119514 Ga0307406_101195142 75
189 3300031995 Ga0307409_100094343 Ga0307409_1000943433 75
190 3300032002 Ga0307416_100189046 Ga0307416_1001890463 75
191 3300032002 Ga0307416_102804902 Ga0307416_1028049022 75
192 3300032004 Ga0307414_10678302 Ga0307414_106783022 75
193 3300032126 Ga0307415_101141439 Ga0307415_1011414392 75
194 3300032126 Ga0307415_101192156 Ga0307415_1011921562 75
195 3300039438 Ga0436360_0694982 Ga0436360_0694982_26_262 75
196 3300041451 Ga0451791_1449762 Ga0451791_1449762_133_360 75
197 3300041453 Ga0451797_0972861 Ga0451797_0972861_12_245 75
198 3300041486 Ga0451807_0699959 Ga0451807_0699959_438_701 75
199 3300041494 Ga0451837_0752537 Ga0451837_0752537_92_325 75
200 3300041501 Ga0451845_0219858 Ga0451845_0219858_238_483 75
201 3300041511 Ga0451855_0632016 Ga0451855_0632016_453_698 75
202 3300042004 Ga0439445_0148832 Ga0439445_0148832_407_664 75
203 3300042876 Ga0451577_0163611 Ga0451577_0163611_1244_1513 75
204 3300044684 Ga0466966_0128404 Ga0466966_0128404_1294_1542 75
205 3300044694 Ga0466963_0155491 Ga0466963_0155491_1310_1558 75
206 3300044706 Ga0466964_0360734 Ga0466964_0360734_440_688 75
207 3300044735 Ga0466968_0277890 Ga0466968_0277890_428_676 75
208 3300044765 Ga0466970_0017790 Ga0466970_0017790_2180_2428 75
209 3300044842 Ga0466957_0030529 Ga0466957_0030529_1216_1464 75
210 3300045836 Ga0466958_0024165 Ga0466958_0024165_2190_2438 75
211 3300045976 Ga0466967_0370621 Ga0466967_0370621_432_680 75
212 3300046453 Ga0495627_062228 Ga0495627_062228_194_421 75
213 3300046455 Ga0495603_0718432 Ga0495603_0718432_207_446 75
214 3300046472 Ga0495580_0929281 Ga0495580_0929281_79_318 75
215 3300046501 Ga0495607_0087051 Ga0495607_0087051_620_847 75
216 3300046506 Ga0495583_0107782 Ga0495583_0107782_224_451 75
217 3300046512 Ga0495610_0065375 Ga0495610_0065375_1029_1280 75
218 3300046513 Ga0495616_0444527 Ga0495616_0444527_203_442 75
219 3300046515 Ga0495620_0215262 Ga0495620_0215262_80_319 75
220 3300046515 Ga0495620_0397090 Ga0495620_0397090_80_307 75
221 3300046522 Ga0495643_0238991 Ga0495643_0238991_108_335 75
222 3300046525 Ga0495663_0127048 Ga0495663_0127048_460_687 75
223 3300046538 Ga0495609_0061380 Ga0495609_0061380_388_615 75
224 3300046557 Ga0495622_0157475 Ga0495622_0157475_78_305 75
225 3300046557 Ga0495622_0268940 Ga0495622_0268940_357_596 75
226 3300046558 Ga0495633_0065820 Ga0495633_0065820_1427_1666 75
227 3300046616 Ga0495668_0463709 Ga0495668_0463709_166_399 75
228 3300046660 Ga0495625_0142933 Ga0495625_0142933_332_559 75
229 3300046665 Ga0495661_0083644 Ga0495661_0083644_797_1024 75
230 3300046674 Ga0495588_0354009 Ga0495588_0354009_268_507 75
231 3300046691 Ga0495670_0100129 Ga0495670_0100129_36_275 75
232 3300046794 Ga0495589_0131389 Ga0495589_0131389_812_1051 75
233 3300047319 Ga0495674_1210107 Ga0495674_1210107_249_488 75
234 3300047443 Ga0495687_066107 Ga0495687_066107_1122_1349 75
235 3300047470 Ga0495681_0047730 Ga0495681_0047730_970_1197 75
236 3300048911 Ga0496108_1620009 Ga0496108_1620009_254_502 75
237 3300048921 Ga0496118_0084181 Ga0496118_0084181_1692_1940 75
238 3300048922 Ga0496119_0000818 Ga0496119_0000818_15973_16203 75
239 3300048924 Ga0496121_0029824 Ga0496121_0029824_1264_1497 75
240 3300048928 Ga0496125_0000085 Ga0496125_0000085_125642_125872 75
241 3300049570 Ga0501033_0149162 Ga0501033_0149162_649_927 75
242 3300049573 Ga0501037_0977894 Ga0501037_0977894_134_367 75
243 3300049823 Ga0501044_1481067 Ga0501044_1481067_140_388 75
244 3300050491 nmdc:mga00v17_5511_c1 nmdc:mga00v17_5511_c1_6264_6494 75
245 3300050493 nmdc:mga0k408_346488_c1 nmdc:mga0k408_346488_c1_434_706 75
246 3300050493 nmdc:mga0k408_708414_c1 nmdc:mga0k408_708414_c1_19_252 75
247 3300050496 nmdc:mga07m45_13305_c1 nmdc:mga07m45_13305_c1_2501_2773 75
248 3300053093 Ga0500651_0459080 Ga0500651_0459080_310_543 75
249 3300053137 Ga0500561_0128038 Ga0500561_0128038_223_450 75
250 3300053139 Ga0500568_0037988 Ga0500568_0037988_1507_1740 75
251 3300053149 Ga0500600_0381304 Ga0500600_0381304_127_354 75
252 3300053156 Ga0500622_0028331 Ga0500622_0028331_2192_2425 75
253 3300053161 Ga0500634_0253759 Ga0500634_0253759_362_589 75
254 iso_pu_bacteria 8005484373 8005485127 75
255 iso_pu_bacteria 8005645114 8005645290 75
256 iso_pu_bacteria 8005682033 8005683210 75

Feature Viewer

pLDDT pTM Quality
82.85 0.48 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map