F366917

General Info

Members Datasets Scaffolds Average Seq Length
256 228 186 574

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2622736605|2623498040
Length 649
Sequence EDNPWDYTVSSSERRGRRTLGAGLPVSTSTTPVPGRNENFAVDVAPGQTPVDAPCGDPHPAIAEPPPPVADEKGRLDKVVFGISAALALAFVAWGFLAPSNLGSASGSALTWIESNLGWLFVLLASAFVVFVLWLAVSRYGRIPLGRDDEAPEFRTVSWVAMMFSAGMGIGLMFYGVSEPLSHYVSPPPRTVGAETPEAVQTAMATTLFHWTLHPWAIYAVVGLAIAYGTFRRGRRQLISSAFAPLFGERRTEGPAGKLIDVLAIFATLFGSAASLGLGALQIGSGMEILGWAGDVGNGVLVAIIAVLTAAFVASAVSGVAKGIQWLSNINMVLAVVLAVFVFVVGPTVFILNLLPTAIGSYFADLAEMAARTEAVGGDATAAWLRGWTVFYWAWWISWTPFVGVFIARISRGRTIRQFVSGVLLVPSVVTLVWFVIFGGAGIAAQRDGVDVAGQATAEGQLFGVLGQFPLATVMTVVVMALVAIFFVSGADAASIVMGSLSEGGTLAPSRRTVVFWGAVMGAVAAVMLLVGGDEALTGLQNLTIIAALPFALVMVGLAVALAKDVRSDPMMLRHTVAAEAVEQAVVEGITRHGDDFVLVVEPAPDTAGNGVGDTGAARTPVAAVRRRTENRGRGVADVGSPVPGDRSD

Samples

Sample ID Description Type Environment
1 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
2 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
3 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
4 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
5 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
6 2582580736 Prauserella sp. Am3 Isolate Unclassified
7 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
8 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
9 2643221548 Streptomyces sp. Root55 Isolate Unclassified
10 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
11 2643221615 Nocardioides sp. Root224 Isolate Unclassified
12 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
13 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
14 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
15 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
16 2643221692 Nocardia sp. Root136 Isolate Unclassified
17 2643221711 Terrabacter sp. Root85 Isolate Unclassified
18 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
19 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
20 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
21 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
22 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
23 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
24 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
25 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
26 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
27 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
28 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
29 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
30 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
31 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
32 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
33 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
34 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
35 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
36 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
37 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
38 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
39 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
40 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
41 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
42 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
43 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
44 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
45 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
46 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
47 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
48 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
49 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
50 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
51 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
52 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
53 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
54 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
55 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
56 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
57 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
58 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
59 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
60 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
61 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
62 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
63 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
64 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
65 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
66 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
67 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
68 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
69 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
70 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
71 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
72 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
73 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
74 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
75 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
76 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
80 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
81 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
87 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
88 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
102 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
127 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
133 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
134 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
135 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
136 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
137 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
138 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
139 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
140 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
141 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
142 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
143 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
146 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
149 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
150 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
151 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
152 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
153 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
154 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
155 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
156 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
157 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
158 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
159 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
160 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
161 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
162 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
163 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
164 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
165 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
166 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
167 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
168 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
169 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
170 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
171 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
172 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
173 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
174 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
175 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
176 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
179 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
180 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
181 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
182 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
183 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
184 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
185 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
186 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
187 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
188 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
189 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
190 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
191 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
201 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
202 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
203 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
204 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
205 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
206 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
207 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
208 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
209 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
210 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
211 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
212 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
213 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
214 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
215 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
216 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
217 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
218 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
219 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
220 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
221 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
222 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
223 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
224 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
225 8052494512 Pseudomonas putida LD6 Isolate Unclassified
226 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
227 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
228 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 72.27
Metatranscriptomes 0.39
Isolates 27.34

Biome Distribution

Category Percentage (%)
Aerial Root 0.78
Bulb 0
Endosphere 1.95
Nodule 1.17
Rhizoplane 6.25
Rhizosphere 64.84
Stem 0
Stem Tuber 0
Unclassified 25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10005425 3300001979 Bacteria 5392
2 JGI24739J22299_10017975 3300001989 Bacteria 2545
3 JGI24737J22298_10005747 3300001990 Bacteria 4271
4 Ga0070658_10107445 3300005327 Bacteria 2309
5 Ga0070683_100078003 3300005329 Bacteria 3098
6 Ga0068869_100045688 3300005334 Bacteria 3154
7 Ga0070669_100005157 3300005353 Bacteria 9450
8 Ga0070669_100040084 3300005353 Bacteria 3404
9 Ga0070671_100013297 3300005355 Bacteria 6635
10 Ga0070667_100000783 3300005367 Bacteria 29903
11 Ga0070710_10000837 3300005437 Bacteria 14799
12 Ga0070700_100038075 3300005441 Bacteria 2929
13 Ga0070663_100047214 3300005455 Bacteria 3050
14 Ga0070678_100088873 3300005456 Bacteria 2363
15 Ga0068853_100007478 3300005539 Bacteria 8744
16 Ga0070665_100002386 3300005548 Bacteria 20715
17 Ga0068857_100114496 3300005577 Bacteria 2425
18 Ga0070702_100025527 3300005615 Bacteria 3167
19 Ga0068864_100052953 3300005618 Bacteria 3499
20 Ga0068860_100001047 3300005843 Bacteria 30488
21 Ga0068860_100012560 3300005843 Bacteria 8338
22 Ga0068862_100000077 3300005844 Bacteria 116781
23 Ga0081455_10011730 3300005937 Bacteria 8785
24 Ga0081538_10000222 3300005981 Bacteria 64190
25 Ga0081538_10001492 3300005981 Bacteria 24021
26 Ga0075365_10007869 3300006038 Bacteria 6006
27 Ga0075428_100037773 3300006844 Bacteria 5314
28 Ga0075430_100006237 3300006846 Bacteria 10058
29 Ga0075431_100148398 3300006847 Bacteria 2415
30 Ga0075429_100047952 3300006880 Bacteria 3715
31 Ga0099823_1000229 3300006944 Bacteria 32040
32 Ga0105251_10028875 3300009011 Bacteria 2799
33 Ga0105244_10000229 3300009036 Bacteria 57809
34 Ga0105244_10000829 3300009036 Bacteria 26149
35 Ga0111539_10034968 3300009094 Bacteria 6086
36 Ga0105247_10000060 3300009101 Bacteria 127879
37 Ga0114129_10078435 3300009147 Bacteria 4594
38 Ga0105243_10040751 3300009148 Bacteria 3629
39 Ga0105248_10001151 3300009177 Bacteria 29522
40 Ga0105249_10000042 3300009553 Bacteria 195242
41 Ga0157373_10057093 3300013100 Bacteria 2769
42 Ga0157371_10000800 3300013102 Bacteria 36092
43 Ga0157371_10005693 3300013102 Bacteria 10448
44 Ga0157370_10065016 3300013104 Bacteria 3452
45 Ga0157369_10008578 3300013105 Bacteria 11721
46 Ga0157372_10010390 3300013307 Bacteria 9896
47 Ga0157372_10140228 3300013307 Bacteria 2785
48 Ga0209676_1000647 3300025292 Bacteria 49978
49 Ga0207426_1002261 3300025302 Bacteria 12740
50 Ga0207696_1000006 3300025711 Bacteria 616498
51 Ga0207696_1004739 3300025711 Bacteria 5791
52 Ga0207655_1000143 3300025728 Bacteria 137102
53 Ga0207655_1000396 3300025728 Bacteria 60636
54 Ga0207713_1016383 3300025735 Bacteria 3762
55 Ga0207692_10000869 3300025898 Bacteria 10879
56 Ga0207710_10000010 3300025900 Bacteria 482087
57 Ga0207688_10005908 3300025901 Bacteria 6664
58 Ga0207647_10013143 3300025904 Bacteria 5751
59 Ga0207645_10023173 3300025907 Bacteria 4036
60 Ga0207681_10003301 3300025923 Bacteria 10102
61 Ga0207687_10043267 3300025927 Bacteria 3103
62 Ga0207644_10025686 3300025931 Bacteria 4051
63 Ga0207706_10012337 3300025933 Bacteria 7784
64 Ga0207669_10022380 3300025937 Bacteria 3357
65 Ga0207711_10031560 3300025941 Bacteria 4473
66 Ga0207712_10000010 3300025961 Bacteria 455972
67 Ga0207668_10017606 3300025972 Bacteria 4480
68 Ga0207658_10000685 3300025986 Bacteria 29494
69 Ga0207703_10116906 3300026035 Bacteria 2284
70 Ga0207639_10007184 3300026041 Bacteria 7587
71 Ga0207678_10012516 3300026067 Bacteria 7451
72 Ga0207708_10033059 3300026075 Bacteria 3928
73 Ga0207641_10073230 3300026088 Bacteria 2952
74 Ga0207675_100005611 3300026118 Bacteria 12016
75 Ga0207698_10056415 3300026142 Bacteria 3033
76 Ga0209389_1000042 3300027296 Bacteria 123281
77 Ga0209371_1000032 3300027312 Bacteria 392355
78 Ga0207428_10029915 3300027907 Bacteria 4505
79 Ga0268266_10024002 3300028379 Bacteria 5189
80 Ga0268265_10000014 3300028380 Bacteria 330186
81 Ga0268264_10000137 3300028381 Bacteria 176081
82 Ga0268256_1000050 3300030500 Bacteria 300675
83 Ga0268256_1014214 3300030500 Bacteria 2375
84 Ga0316176_1142941 3300030732 Bacteria 4777
85 Ga0314311_1029953 3300030733 Bacteria 6914
86 Ga0307513_10056489 3300031456 Bacteria 4190
87 Ga0307508_10015377 3300031616 Bacteria 6970
88 Ga0307514_10041489 3300031649 Bacteria 3624
89 Ga0307405_10048552 3300031731 Bacteria 2618
90 Ga0307413_10022150 3300031824 Bacteria 3418
91 Ga0307413_10063414 3300031824 Bacteria 2291
92 Ga0307410_10107470 3300031852 Bacteria 2012
93 Ga0307407_10047701 3300031903 Bacteria 2433
94 Ga0307407_10057836 3300031903 Bacteria 2251
95 Ga0307412_10028609 3300031911 Bacteria 3489
96 Ga0307409_100009194 3300031995 Bacteria 6057
97 Ga0307416_100103479 3300032002 Bacteria 2486
98 Ga0307416_100171906 3300032002 Bacteria 2018
99 Ga0307414_10039051 3300032004 Bacteria 3194
100 Ga0307415_100018600 3300032126 Bacteria 4200
101 Ga0395900_0143560 3300037418 Bacteria 2443
102 Ga0395905_0071555 3300037471 Bacteria 3251
103 Ga0395901_0050557 3300038443 Bacteria 4318
104 Ga0451791_1102364 3300041451 Bacteria 6076
105 Ga0451793_0004878 3300041452 Bacteria 6351
106 Ga0451797_0543108 3300041453 Bacteria 6729
107 Ga0439432_005343 3300042006 Bacteria 4635
108 Ga0439457_009830 3300042014 Bacteria 2215
109 Ga0450902_000510 3300042137 Bacteria 4853
110 Ga0450903_000873 3300042138 Bacteria 5810
111 Ga0450906_000569 3300042145 Bacteria 7812
112 Ga0439464_0000706 3300042439 Bacteria 7229
113 Ga0466972_0001775 3300044658 Bacteria 10568
114 Ga0466965_0049574 3300044683 Bacteria 2082
115 Ga0466970_0030253 3300044765 Bacteria 2855
116 Ga0466957_0018176 3300044842 Bacteria 4125
117 Ga0466960_0010242 3300044901 Bacteria 3891
118 Ga0466960_0011327 3300044901 Bacteria 3727
119 Ga0466967_0296039 3300045976 Bacteria 1556
120 Ga0495650_0015127 3300046471 Bacteria 3973
121 Ga0495620_0000049 3300046515 Bacteria 106184
122 Ga0495632_0000292 3300046519 Bacteria 48501
123 Ga0495643_0001028 3300046522 Bacteria 28446
124 Ga0495643_0001308 3300046522 Bacteria 23656
125 Ga0495648_0000201 3300046524 Bacteria 69119
126 Ga0495661_0081697 3300046665 Bacteria 1862
127 Ga0495589_0015345 3300046794 Bacteria 3944
128 Ga0495589_0037685 3300046794 Bacteria 2421
129 Ga0495676_0043320 3300047321 Bacteria 3685
130 Ga0496100_0057901 3300048903 Bacteria 2540
131 Ga0496102_0001138 3300048905 Bacteria 24366
132 Ga0496102_0027565 3300048905 Bacteria 5073
133 Ga0496102_0064036 3300048905 Bacteria 3367
134 Ga0496105_0042088 3300048908 Bacteria 3765
135 Ga0496108_0001337 3300048911 Bacteria 19385
136 Ga0496108_0041361 3300048911 Bacteria 3848
137 Ga0496109_0011203 3300048912 Bacteria 7695
138 Ga0496109_0111556 3300048912 Bacteria 2543
139 Ga0496110_0022244 3300048913 Bacteria 5380
140 Ga0496111_0132988 3300048914 Bacteria 1842
141 Ga0496114_0007849 3300048917 Bacteria 8442
142 Ga0496114_0111227 3300048917 Bacteria 2347
143 Ga0496116_0018691 3300048919 Bacteria 5328
144 Ga0496116_0047151 3300048919 Bacteria 2902
145 Ga0496117_0000304 3300048920 Bacteria 85823
146 Ga0496117_0002394 3300048920 Bacteria 23847
147 Ga0496117_0002828 3300048920 Bacteria 21120
148 Ga0496117_0004664 3300048920 Bacteria 14906
149 Ga0496118_0001314 3300048921 Bacteria 37831
150 Ga0496118_0002980 3300048921 Bacteria 21892
151 Ga0496118_0005932 3300048921 Bacteria 13657
152 Ga0496119_0000189 3300048922 Bacteria 87262
153 Ga0496120_0003895 3300048923 Bacteria 13064
154 Ga0496121_0004434 3300048924 Bacteria 18880
155 Ga0496122_0000636 3300048925 Bacteria 71408
156 Ga0496123_0000375 3300048926 Bacteria 83909
157 Ga0496123_0014774 3300048926 Bacteria 6446
158 Ga0496124_0005950 3300048927 Bacteria 13482
159 Ga0496125_0002286 3300048928 Bacteria 25351
160 Ga0501325_000344 3300049541 Bacteria 2097
161 Ga0501034_0000334 3300049571 Bacteria 82414
162 Ga0501036_0023470 3300049572 Bacteria 5196
163 Ga0501038_0027746 3300049574 Bacteria 5033
164 Ga0501040_0002156 3300049576 Bacteria 12705
165 Ga0501041_0018466 3300049577 Bacteria 4154
166 Ga0501042_0044123 3300049578 Bacteria 3176
167 Ga0501046_0022213 3300049580 Bacteria 5228
168 Ga0501048_0044790 3300049582 Bacteria 3161
169 Ga0501070_0123598 3300049586 Bacteria 2139
170 Ga0501072_0123061 3300049588 Bacteria 2066
171 Ga0501075_0001661 3300049591 Bacteria 14602
172 Ga0501076_0020756 3300049592 Bacteria 5030
173 Ga0501079_0091033 3300049741 Bacteria 2363
174 Ga0501081_0009718 3300049743 Bacteria 6272
175 Ga0501045_0004595 3300049824 Bacteria 9531
176 nmdc:mga05p37_3013_c1 3300050507 Bacteria 19548
177 nmdc:mga09592_8263_c1 3300050508 Bacteria 8467
178 nmdc:mga0qj67_53814_c1 3300050509 Bacteria 3187
179 nmdc:mga06r32_68_c1 3300050510 Bacteria 67093
180 nmdc:mga08y16_17166_c1 3300050511 Bacteria 7620
181 nmdc:mga0a205_128123_c1 3300050515 Bacteria 2438
182 Ga0500593_000160 3300053117 Bacteria 26926
183 Ga0500659_0000406 3300053135 Bacteria 27750
184 Ga0501084_0028879 3300054114 Bacteria 4637
185 Ga0501082_0017209 3300060353 Bacteria 6228
186 Ga0530510_0016484 3300061734 Bacteria 5231

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045976 Ga0466967_0296039 Ga0466967_0296039_11_1429 417
2 3300050508 nmdc:mga09592_8263_c1 nmdc:mga09592_8263_c1_7053_8429 421
3 3300030732 Ga0316176_1142941 Ga0316176_11429414 449
4 3300030733 Ga0314311_1029953 Ga0314311_10299537 449
5 3300044901 Ga0466960_0010242 Ga0466960_0010242_235_1872 477
6 3300042014 Ga0439457_009830 Ga0439457_009830_431_2056 479
7 3300047321 Ga0495676_0043320 Ga0495676_0043320_2045_3661 480
8 3300046794 Ga0495589_0015345 Ga0495589_0015345_2303_3919 481
9 3300046794 Ga0495589_0037685 Ga0495589_0037685_116_1798 484
10 3300026088 Ga0207641_10073230 Ga0207641_100732302 486
11 iso_pu_bacteria 2863067949 2863069772 486
12 3300037418 Ga0395900_0143560 Ga0395900_0143560_484_2268 487
13 3300031649 Ga0307514_10041489 Ga0307514_100414893 489
14 3300006038 Ga0075365_10007869 Ga0075365_100078692 490
15 iso_pu_bacteria 2862705112 2862708503 491
16 3300005437 Ga0070710_10000837 Ga0070710_1000083711 492
17 3300025898 Ga0207692_10000869 Ga0207692_100008698 492
18 3300030500 Ga0268256_1014214 Ga0268256_10142142 492
19 3300009011 Ga0105251_10028875 Ga0105251_100288752 494
20 3300013105 Ga0157369_10008578 Ga0157369_1000857810 494
21 3300013307 Ga0157372_10140228 Ga0157372_101402282 494
22 iso_pu_bacteria 8056207758 8056213651 494
23 iso_pu_bacteria 8008485437 8008486787 495
24 3300042145 Ga0450906_000569 Ga0450906_000569_4663_6393 499
25 3300049586 Ga0501070_0123598 Ga0501070_0123598_18_1748 499
26 3300025302 Ga0207426_1002261 Ga0207426_10022618 500
27 3300031616 Ga0307508_10015377 Ga0307508_100153772 500
28 3300048905 Ga0496102_0027565 Ga0496102_0027565_2059_3855 500
29 3300048903 Ga0496100_0057901 Ga0496100_0057901_531_2339 501
30 iso_pu_bacteria 2866552031 2866553507 501
31 3300044658 Ga0466972_0001775 Ga0466972_0001775_4100_5902 502
32 3300044765 Ga0466970_0030253 Ga0466970_0030253_315_2117 502
33 3300044842 Ga0466957_0018176 Ga0466957_0018176_586_2388 502
34 3300048926 Ga0496123_0014774 Ga0496123_0014774_2036_3658 502
35 3300044683 Ga0466965_0049574 Ga0466965_0049574_50_1756 503
36 3300053117 Ga0500593_000160 Ga0500593_000160_22495_24261 508
37 iso_pu_bacteria 8047710418 8047717528 508
38 iso_pu_bacteria 2862290372 2862295030 510
39 3300048917 Ga0496114_0111227 Ga0496114_0111227_541_2325 511
40 3300005355 Ga0070671_100013297 Ga0070671_1000132972 512
41 3300005548 Ga0070665_100002386 Ga0070665_10000238617 512
42 3300005843 Ga0068860_100012560 Ga0068860_1000125602 512
43 3300025931 Ga0207644_10025686 Ga0207644_100256863 512
44 3300028379 Ga0268266_10024002 Ga0268266_100240022 512
45 3300037471 Ga0395905_0071555 Ga0395905_0071555_1344_3179 512
46 3300044901 Ga0466960_0011327 Ga0466960_0011327_815_2479 512
47 3300013102 Ga0157371_10000800 Ga0157371_1000080015 513
48 3300025711 Ga0207696_1004739 Ga0207696_10047392 513
49 3300046522 Ga0495643_0001308 Ga0495643_0001308_13927_15675 513
50 3300031456 Ga0307513_10056489 Ga0307513_100564893 514
51 iso_pu_bacteria 2767802112 2768644948 514
52 3300041451 Ga0451791_1102364 Ga0451791_1102364_3368_5185 515
53 3300041452 Ga0451793_0004878 Ga0451793_0004878_2706_4523 515
54 3300041453 Ga0451797_0543108 Ga0451797_0543108_2186_4003 515
55 iso_pu_bacteria 2870721527 2870728212 515
56 iso_pu_bacteria 2990044586 2990047145 515
57 iso_pu_bacteria 8025524527 8025525923 515
58 iso_pu_bacteria 2990088156 2990089222 516
59 3300005618 Ga0068864_100052953 Ga0068864_1000529532 517
60 iso_pu_bacteria 2643221548 2643762344 517
61 iso_pu_bacteria 2643221682 2644458877 517
62 iso_pu_bacteria 2912757875 2912764064 517
63 iso_pu_bacteria 2966598605 2966599589 517
64 iso_pu_bacteria 8025530807 8025533384 517
65 iso_pu_bacteria 2866612099 2866612428 519
66 3300013100 Ga0157373_10057093 Ga0157373_100570932 520
67 3300013102 Ga0157371_10005693 Ga0157371_1000569310 520
68 3300027312 Ga0209371_1000032 Ga0209371_100003279 520
69 3300030500 Ga0268256_1000050 Ga0268256_10000502 520
70 3300042439 Ga0439464_0000706 Ga0439464_0000706_4497_6236 520
71 3300048914 Ga0496111_0132988 Ga0496111_0132988_10_1803 520
72 iso_pu_bacteria 2816332139 2816506636 520
73 3300013307 Ga0157372_10010390 Ga0157372_100103907 521
74 3300032126 Ga0307415_100018600 Ga0307415_1000186003 521
75 3300042137 Ga0450902_000510 Ga0450902_000510_1632_3566 521
76 3300042138 Ga0450903_000873 Ga0450903_000873_334_2268 521
77 3300048922 Ga0496119_0000189 Ga0496119_0000189_16029_17774 521
78 3300048923 Ga0496120_0003895 Ga0496120_0003895_6631_8376 521
79 3300049541 Ga0501325_000344 Ga0501325_000344_401_2086 521
80 iso_pu_bacteria 2582580736 2583152552 521
81 3300009036 Ga0105244_10000829 Ga0105244_1000082919 522
82 3300013104 Ga0157370_10065016 Ga0157370_100650162 522
83 3300025292 Ga0209676_1000647 Ga0209676_100064738 522
84 3300025728 Ga0207655_1000143 Ga0207655_100014395 522
85 3300048917 Ga0496114_0007849 Ga0496114_0007849_40_1788 522
86 3300048920 Ga0496117_0002394 Ga0496117_0002394_4940_6688 522
87 3300048921 Ga0496118_0002980 Ga0496118_0002980_19487_21235 522
88 3300048925 Ga0496122_0000636 Ga0496122_0000636_21399_23147 522
89 3300048926 Ga0496123_0000375 Ga0496123_0000375_17898_19646 522
90 3300048927 Ga0496124_0005950 Ga0496124_0005950_7060_8808 522
91 iso_pu_bacteria 2585427649 2586063794 522
92 iso_pu_bacteria 2751185734 2753069311 522
93 iso_pu_bacteria 2899359706 2899360098 522
94 iso_pu_bacteria 2915768154 2915772699 522
95 iso_pu_bacteria 3007315729 3007315814 522
96 iso_pu_bacteria 8056060235 8056061002 522
97 3300005539 Ga0068853_100007478 Ga0068853_1000074786 523
98 3300026041 Ga0207639_10007184 Ga0207639_100071843 523
99 iso_pu_bacteria 2808606365 2808874746 523
100 iso_pu_bacteria 8003314358 8003315538 523
101 iso_pu_bacteria 8056207758 8056209161 523
102 3300031731 Ga0307405_10048552 Ga0307405_100485521 524
103 3300031824 Ga0307413_10022150 Ga0307413_100221502 524
104 3300031852 Ga0307410_10107470 Ga0307410_101074701 524
105 3300031903 Ga0307407_10057836 Ga0307407_100578361 524
106 3300031911 Ga0307412_10028609 Ga0307412_100286092 524
107 3300032004 Ga0307414_10039051 Ga0307414_100390512 524
108 3300046471 Ga0495650_0015127 Ga0495650_0015127_2026_3708 524
109 iso_pu_bacteria 2554235231 2555247612 524
110 iso_pu_bacteria 2919155634 2919159048 524
111 iso_pu_bacteria 2939582691 2939588007 524
112 iso_pu_bacteria 3007252601 3007255381 524
113 iso_pu_bacteria 3007803356 3007806691 524
114 iso_pu_bacteria 8052494512 8052497869 524
115 3300005327 Ga0070658_10107445 Ga0070658_101074452 525
116 3300005329 Ga0070683_100078003 Ga0070683_1000780032 525
117 3300005334 Ga0068869_100045688 Ga0068869_1000456882 525
118 3300005353 Ga0070669_100040084 Ga0070669_1000400842 525
119 3300005441 Ga0070700_100038075 Ga0070700_1000380752 525
120 3300005455 Ga0070663_100047214 Ga0070663_1000472142 525
121 3300005456 Ga0070678_100088873 Ga0070678_1000888731 525
122 3300005577 Ga0068857_100114496 Ga0068857_1001144962 525
123 3300005615 Ga0070702_100025527 Ga0070702_1000255271 525
124 3300006844 Ga0075428_100037773 Ga0075428_1000377732 525
125 3300006846 Ga0075430_100006237 Ga0075430_1000062372 525
126 3300006847 Ga0075431_100148398 Ga0075431_1001483982 525
127 3300006880 Ga0075429_100047952 Ga0075429_1000479522 525
128 3300009094 Ga0111539_10034968 Ga0111539_100349687 525
129 3300009147 Ga0114129_10078435 Ga0114129_100784352 525
130 3300025907 Ga0207645_10023173 Ga0207645_100231732 525
131 3300025927 Ga0207687_10043267 Ga0207687_100432671 525
132 3300025933 Ga0207706_10012337 Ga0207706_100123377 525
133 3300025937 Ga0207669_10022380 Ga0207669_100223802 525
134 3300025972 Ga0207668_10017606 Ga0207668_100176064 525
135 3300026067 Ga0207678_10012516 Ga0207678_100125162 525
136 3300026075 Ga0207708_10033059 Ga0207708_100330592 525
137 3300026118 Ga0207675_100005611 Ga0207675_1000056112 525
138 3300026142 Ga0207698_10056415 Ga0207698_100564152 525
139 3300027907 Ga0207428_10029915 Ga0207428_100299152 525
140 3300048911 Ga0496108_0041361 Ga0496108_0041361_335_2038 525
141 3300048912 Ga0496109_0111556 Ga0496109_0111556_113_1816 525
142 3300050507 nmdc:mga05p37_3013_c1 nmdc:mga05p37_3013_c1_14400_16124 525
143 3300050509 nmdc:mga0qj67_53814_c1 nmdc:mga0qj67_53814_c1_1113_2837 525
144 3300050510 nmdc:mga06r32_68_c1 nmdc:mga06r32_68_c1_22796_24520 525
145 3300050511 nmdc:mga08y16_17166_c1 nmdc:mga08y16_17166_c1_4068_5792 525
146 3300050515 nmdc:mga0a205_128123_c1 nmdc:mga0a205_128123_c1_490_2214 525
147 iso_pu_bacteria 2643221615 2644089085 526
148 iso_pu_bacteria 2643221657 2644318930 526
149 iso_pu_bacteria 2643221692 2644512343 526
150 iso_pu_bacteria 8033684223 8033689578 526
151 3300031824 Ga0307413_10063414 Ga0307413_100634142 527
152 iso_pu_bacteria 2510065053 2510283150 527
153 iso_pu_bacteria 2510065055 2510293815 527
154 iso_pu_bacteria 2510065058 2510310570 527
155 iso_pu_bacteria 2643221711 2644608134 527
156 iso_pu_bacteria 2773857672 2774131161 527
157 iso_pu_bacteria 2811994882 2812372909 527
158 iso_pu_bacteria 2818991458 2819664747 527
159 iso_pu_bacteria 2818991462 2819689571 527
160 iso_pu_bacteria 2818991469 2819726881 527
161 iso_pu_bacteria 2917832318 2917836433 527
162 iso_pu_bacteria 2919125081 2919126545 527
163 iso_pu_bacteria 2974298342 2974302770 527
164 iso_pu_bacteria 2984499530 2984499644 527
165 iso_pu_bacteria 2984504281 2984506896 527
166 iso_pu_bacteria 8016728285 8016731050 527
167 3300009036 Ga0105244_10000229 Ga0105244_1000022924 528
168 3300009148 Ga0105243_10040751 Ga0105243_100407512 528
169 3300025711 Ga0207696_1000006 Ga0207696_1000006541 528
170 3300025728 Ga0207655_1000396 Ga0207655_100039631 528
171 3300025735 Ga0207713_1016383 Ga0207713_10163832 528
172 3300042006 Ga0439432_005343 Ga0439432_005343_523_2268 528
173 3300046515 Ga0495620_0000049 Ga0495620_0000049_38920_40671 528
174 3300046519 Ga0495632_0000292 Ga0495632_0000292_9317_11068 528
175 3300046522 Ga0495643_0001028 Ga0495643_0001028_11844_13595 528
176 3300046524 Ga0495648_0000201 Ga0495648_0000201_9503_11254 528
177 3300048919 Ga0496116_0018691 Ga0496116_0018691_518_2269 528
178 3300048920 Ga0496117_0002828 Ga0496117_0002828_13314_15065 528
179 3300048920 Ga0496117_0004664 Ga0496117_0004664_3527_5278 528
180 3300048921 Ga0496118_0005932 Ga0496118_0005932_2744_4495 528
181 3300048928 Ga0496125_0002286 Ga0496125_0002286_2753_4504 528
182 3300049571 Ga0501034_0000334 Ga0501034_0000334_33928_35673 528
183 iso_pu_bacteria 2558860112 2558913590 528
184 3300049572 Ga0501036_0023470 Ga0501036_0023470_2290_4074 529
185 3300049574 Ga0501038_0027746 Ga0501038_0027746_3079_4863 529
186 3300049576 Ga0501040_0002156 Ga0501040_0002156_8586_10370 529
187 3300049577 Ga0501041_0018466 Ga0501041_0018466_1183_2967 529
188 3300049578 Ga0501042_0044123 Ga0501042_0044123_74_1858 529
189 3300049580 Ga0501046_0022213 Ga0501046_0022213_1956_3740 529
190 3300049582 Ga0501048_0044790 Ga0501048_0044790_1175_2959 529
191 3300049588 Ga0501072_0123061 Ga0501072_0123061_209_1993 529
192 3300049591 Ga0501075_0001661 Ga0501075_0001661_74_1858 529
193 3300049592 Ga0501076_0020756 Ga0501076_0020756_3060_4844 529
194 3300049741 Ga0501079_0091033 Ga0501079_0091033_467_2251 529
195 3300049743 Ga0501081_0009718 Ga0501081_0009718_3318_5102 529
196 3300049824 Ga0501045_0004595 Ga0501045_0004595_1941_3725 529
197 3300054114 Ga0501084_0028879 Ga0501084_0028879_2347_4131 529
198 3300060353 Ga0501082_0017209 Ga0501082_0017209_3066_4850 529
199 3300061734 Ga0530510_0016484 Ga0530510_0016484_1580_3364 529
200 iso_pu_bacteria 2870782633 2870783315 529
201 3300005937 Ga0081455_10011730 Ga0081455_100117309 530
202 3300006944 Ga0099823_1000229 Ga0099823_100022910 530
203 3300027296 Ga0209389_1000042 Ga0209389_100004211 530
204 3300031903 Ga0307407_10047701 Ga0307407_100477011 530
205 3300032002 Ga0307416_100103479 Ga0307416_1001034792 530
206 3300032002 Ga0307416_100171906 Ga0307416_1001719061 530
207 3300053135 Ga0500659_0000406 Ga0500659_0000406_18136_20010 530
208 iso_pu_bacteria 2837268691 2837275747 533
209 iso_pu_bacteria 2915358134 2915361448 534
210 3300005353 Ga0070669_100005157 Ga0070669_1000051572 535
211 3300005367 Ga0070667_100000783 Ga0070667_1000007834 535
212 3300005843 Ga0068860_100001047 Ga0068860_10000104725 535
213 3300005844 Ga0068862_100000077 Ga0068862_100000077114 535
214 3300009101 Ga0105247_10000060 Ga0105247_10000060118 535
215 3300009177 Ga0105248_10001151 Ga0105248_1000115125 535
216 3300009553 Ga0105249_10000042 Ga0105249_10000042179 535
217 3300025900 Ga0207710_10000010 Ga0207710_10000010120 535
218 3300025923 Ga0207681_10003301 Ga0207681_100033012 535
219 3300025941 Ga0207711_10031560 Ga0207711_100315602 535
220 3300025961 Ga0207712_10000010 Ga0207712_10000010273 535
221 3300025986 Ga0207658_10000685 Ga0207658_1000068524 535
222 3300028380 Ga0268265_10000014 Ga0268265_10000014179 535
223 3300028381 Ga0268264_10000137 Ga0268264_1000013724 535
224 3300048905 Ga0496102_0001138 Ga0496102_0001138_20851_22611 535
225 3300048905 Ga0496102_0064036 Ga0496102_0064036_1269_3146 535
226 3300048908 Ga0496105_0042088 Ga0496105_0042088_1104_2981 535
227 3300048911 Ga0496108_0001337 Ga0496108_0001337_12432_14309 535
228 3300048912 Ga0496109_0011203 Ga0496109_0011203_3535_5412 535
229 3300048913 Ga0496110_0022244 Ga0496110_0022244_2399_4276 535
230 3300048919 Ga0496116_0047151 Ga0496116_0047151_394_2154 535
231 3300048920 Ga0496117_0000304 Ga0496117_0000304_25997_27757 535
232 3300048921 Ga0496118_0001314 Ga0496118_0001314_10075_11835 535
233 3300048924 Ga0496121_0004434 Ga0496121_0004434_20_1780 535
234 iso_pu_bacteria 2643221567 2643853322 535
235 iso_pu_bacteria 2643221624 2644137282 535
236 iso_pu_bacteria 2643221687 2644490208 535
237 iso_pu_bacteria 2842134933 2842137114 535
238 iso_pu_bacteria 2919446982 2919447045 535
239 iso_pu_bacteria 2929212328 2929214236 535
240 3300005981 Ga0081538_10000222 Ga0081538_1000022227 536
241 3300025901 Ga0207688_10005908 Ga0207688_100059085 536
242 3300026035 Ga0207703_10116906 Ga0207703_101169062 536
243 3300031995 Ga0307409_100009194 Ga0307409_1000091943 536
244 3300046665 Ga0495661_0081697 Ga0495661_0081697_17_1837 536
245 iso_pu_bacteria 2773857762 2774392173 536
246 iso_pu_bacteria 2811994878 2812351890 536
247 iso_pu_bacteria 8054472261 8054472793 536
248 3300005981 Ga0081538_10001492 Ga0081538_100014929 537
249 3300038443 Ga0395901_0050557 Ga0395901_0050557_1154_2983 537
250 iso_pu_bacteria 3001889506 3001891742 537
251 iso_pu_bacteria 2816332119 2816425704 541
252 iso_pu_bacteria 2622736605 2623498040 543
253 3300001979 JGI24740J21852_10005425 JGI24740J21852_100054254 548
254 3300001989 JGI24739J22299_10017975 JGI24739J22299_100179752 548
255 3300001990 JGI24737J22298_10005747 JGI24737J22298_100057474 548
256 3300025904 Ga0207647_10013143 Ga0207647_100131431 548

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02028

BCCT

BCCT, betaine/carnitine/choline family transporter

80

569

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4llh-assembly1.cif.gz_B substrate bound outward-open state of the symporter betp 0.8987 39 500
4ain-assembly1.cif.gz_B crystal structure of betp with asymmetric protomers. 0.8886 33 505
4llh-assembly1.cif.gz_A substrate bound outward-open state of the symporter betp 0.8744 34 523
4c7r-assembly1.cif.gz_C inward facing conformation of the trimeric betaine transporter betp in complex with lipids 0.8697 33 511
4ain-assembly1.cif.gz_A crystal structure of betp with asymmetric protomers. 0.8673 34 522
ID Description Score Start End Superfamily
af_P0ABC9_17_503_1.20.1730.10 Mainly Alpha;Up-down Bundle;Sodium/glucose cotransporter;Sodium/glucose cotransporter 0.8653 40 498 1.20.1730.10
af_P9WPR7_23_511_1.20.1730.10 Mainly Alpha;Up-down Bundle;Sodium/glucose cotransporter;Sodium/glucose cotransporter 0.8642 40 500 1.20.1730.10
af_Q2FW63_9_491_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8613 40 497 1.20.1740.10
af_Q2FV06_78_495_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8374 112 492 1.20.1740.10
af_Q2FW63_9_491_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8169 40 497 1.20.1740.10
ID Description Score Start End GO Terms
AF-J3ADR2-F1-model_v4 BCCT family transporter domain protein 0.9653 29 240 GO:0005886
GO:0022857
AF-A0A530QN99-F1-model_v4 Glycine/betaine ABC transporter permease 0.9627 46 207 GO:0005886
GO:0022857
AF-A0A7W4QUB5-F1-model_v4 deleted 0.9469 28 233
AF-A0A533IV14-F1-model_v4 deleted 0.9389 29 434
AF-A0A847BYV8-F1-model_v4 BCCT family transporter 0.9353 37 441 GO:0005886
GO:0022857

Feature Viewer

pLDDT pTM Quality
74.27 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map