F366993

General Info

Members Datasets Scaffolds Average Seq Length
257 142 514 241

Family's Representative Sequence

Representative Sequence 3300003323|rootH1_10185092|rootH1_101850922
Length 259
Sequence MPSPDAESQRMNILEVCVDDAAGLDAAVQGGADRIELCSSLDIGGVTPSAGLMAEAAQLAIPVIALIRPRGGGFSYSAAEERVMLRDIEQAVRQGLAGVAIGALTADSRLDLPMLRRLASRAQGLQLTLHRAFDLVPDQAAALEEAVSLGFHRILTSGGAPKAADGAARLASLVKQGQGRVRILAGSGITTENVQRLMSSTGVHEVHASCRAAVAKPAPELVAFGFAGPSGRATSAAVVRELKRLVCGHPSGHPPALET

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
9 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
10 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
11 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
28 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
29 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
30 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
31 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
32 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
33 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
34 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
35 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
36 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
37 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
39 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
40 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
41 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
43 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
55 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
56 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
57 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
58 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
59 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
60 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
61 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
62 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
63 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
64 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
65 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
66 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
67 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
68 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
69 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
70 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
71 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
72 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
73 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
74 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
75 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
76 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
77 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
78 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
79 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
80 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
81 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
82 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
83 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
84 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
85 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
86 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
87 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
88 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
89 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
90 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
91 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
92 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
93 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
94 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
95 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
96 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
97 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
98 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
99 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
100 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
101 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
102 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
103 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
104 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
105 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
106 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
107 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
108 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
109 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
110 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
111 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
112 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
113 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
114 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
115 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
116 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
117 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
118 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
119 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
120 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
121 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
122 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
123 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
124 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
125 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
126 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
127 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
128 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
129 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
130 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
131 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
132 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
133 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
134 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
135 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
136 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
137 2738541297 Duganella sp. GV083 Isolate Unclassified
138 2738541357 Duganella sp. GV053 Isolate Unclassified
139 2738543003 Duganella sp. GV066 Isolate Unclassified
140 2738543026 Duganella sp. GV089 Isolate Unclassified
141 2738543029 Duganella sp. GV039 Isolate Unclassified
142 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.28
Metatranscriptomes 0
Isolates 2.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.46
Nodule 0
Rhizoplane 5.06
Rhizosphere 62.26
Stem 0
Stem Tuber 0
Unclassified 1.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10185092 3300003323 Bacteria 2784
2 JGI24739J22299_10002478 3300001989 Bacteria 7129
3 JGI24737J22298_10055340 3300001990 Bacteria 1199
4 JGI25152J39213_1000091 3300002773 Bacteria 63165
5 JGI25150J39212_1000068 3300002774 Bacteria 62962
6 JGI25153J46596_10000031 3300003215 Bacteria 196926
7 JGI25153J46596_10004747 3300003215 Bacteria 7239
8 JGI25153J46596_10011048 3300003215 Bacteria 4023
9 JGI25153J46596_10021045 3300003215 Bacteria 2444
10 rootL2_10008238 3300003322 Bacteria 20631
11 rootL2_10081301 3300003322 Bacteria 3151
12 rootL2_10133019 3300003322 Bacteria 1542
13 rootH1_10206821 3300003323 Unclassified 1961
14 rootH1_10273390 3300003323 Bacteria 2026
15 Ga0055525_1000012 3300003759 Bacteria 486564
16 Ga0055525_1000013 3300003759 Bacteria 440870
17 Ga0055542_1000115 3300003762 Bacteria 106506
18 Ga0055529_1000052 3300003763 Bacteria 203029
19 Ga0055529_1000581 3300003763 Bacteria 29446
20 Ga0055537_1000161 3300003773 Bacteria 50226
21 Ga0055524_1000110 3300003775 Bacteria 99255
22 Ga0055524_1000665 3300003775 Bacteria 24147
23 Ga0055530_10000074 3300003791 Bacteria 85116
24 Ga0055531_10000253 3300003794 Bacteria 57396
25 Ga0065165_1002695 3300005262 Bacteria 14279
26 Ga0065165_1018615 3300005262 Bacteria 2507
27 Ga0070676_10039738 3300005328 Bacteria 2722
28 Ga0070666_10230032 3300005335 Bacteria 1309
29 Ga0070661_100028884 3300005344 Bacteria 4002
30 Ga0070668_100060152 3300005347 Bacteria 2941
31 Ga0070674_100003829 3300005356 Bacteria 8511
32 Ga0070667_100080660 3300005367 Bacteria 2783
33 Ga0070663_100192414 3300005455 Bacteria 1588
34 Ga0070678_100120642 3300005456 Bacteria 2067
35 Ga0070662_100031666 3300005457 Bacteria 3713
36 Ga0070665_100000810 3300005548 Bacteria 40895
37 Ga0068856_100055888 3300005614 Bacteria 3895
38 Ga0075369_10072371 3300006186 Bacteria 1519
39 Ga0075366_10026740 3300006195 Bacteria 3381
40 Ga0213872_10000381 3300021361 Bacteria 37204
41 Ga0213872_10000837 3300021361 Bacteria 22321
42 Ga0213872_10009734 3300021361 Unclassified 4597
43 Ga0209674_108326 3300025226 Bacteria 1237
44 Ga0209563_100025 3300025230 Bacteria 596456
45 Ga0209563_100030 3300025230 Bacteria 489259
46 Ga0207425_1000001 3300025245 Bacteria 2525432
47 Ga0209026_1014261 3300025250 Bacteria 1332
48 Ga0209148_1000011 3300025254 Bacteria 1196503
49 Ga0209129_1000003 3300025258 Bacteria 903689
50 Ga0209565_1000030 3300025263 Bacteria 325058
51 Ga0209565_1001520 3300025263 Bacteria 10031
52 Ga0209565_1020514 3300025263 Bacteria 1393
53 Ga0209455_1000006 3300025272 Bacteria 1196503
54 Ga0209455_1000483 3300025272 Bacteria 29472
55 Ga0209673_1000925 3300025273 Bacteria 37051
56 Ga0209564_1040213 3300025295 Bacteria 1273
57 Ga0209758_1000001 3300025297 Bacteria 1981790
58 Ga0209758_1000098 3300025297 Bacteria 230499
59 Ga0209758_1009388 3300025297 Bacteria 6090
60 Ga0209050_1000039 3300025298 Bacteria 410069
61 Ga0209050_1010451 3300025298 Bacteria 4575
62 Ga0209256_1000046 3300025299 Bacteria 325040
63 Ga0209256_1000186 3300025299 Bacteria 119070
64 Ga0209257_1000051 3300025304 Bacteria 434166
65 Ga0209257_1001591 3300025304 Bacteria 26038
66 Ga0207697_10093501 3300025315 Bacteria 1276
67 Ga0207647_10005172 3300025904 Bacteria 9597
68 Ga0207645_10065890 3300025907 Bacteria 2315
69 Ga0207706_10046366 3300025933 Bacteria 3848
70 Ga0207669_10002603 3300025937 Bacteria 7712
71 Ga0207668_10051414 3300025972 Bacteria 2846
72 Ga0207658_10009865 3300025986 Bacteria 6487
73 Ga0207678_10225453 3300026067 Bacteria 1604
74 Ga0207683_10048691 3300026121 Bacteria 3710
75 Ga0268266_10000002 3300028379 Bacteria 3059047
76 Ga0307517_10038973 3300028786 Bacteria 5238
77 Ga0307513_10014719 3300031456 Bacteria 9515
78 Ga0395899_0032535 3300037312 Bacteria 3918
79 Ga0395899_0059959 3300037312 Bacteria 2804
80 Ga0395905_0118018 3300037471 Bacteria 2494
81 Ga0395905_0132218 3300037471 Bacteria 2347
82 Ga0395905_0162763 3300037471 Bacteria 2097
83 Ga0395901_0035949 3300038443 Bacteria 5118
84 Ga0436361_0389628 3300039447 Bacteria 39329
85 Ga0436361_0454529 3300039447 Bacteria 33442
86 Ga0436361_0527259 3300039447 Unclassified 4862
87 Ga0436361_0897983 3300039447 Bacteria 8213
88 Ga0495617_000018 3300046452 Bacteria 248300
89 Ga0495617_001203 3300046452 Bacteria 11652
90 Ga0495591_000033 3300046458 Bacteria 171402
91 Ga0495638_0204125 3300046460 Bacteria 1114
92 Ga0495650_0000067 3300046471 Bacteria 269882
93 Ga0495650_0000158 3300046471 Bacteria 154681
94 Ga0495650_0003843 3300046471 Bacteria 10660
95 Ga0495650_0083243 3300046471 Bacteria 1230
96 Ga0495605_0003823 3300046474 Bacteria 8932
97 Ga0495605_0004034 3300046474 Bacteria 8669
98 Ga0495605_0016557 3300046474 Bacteria 3988
99 Ga0495584_0000801 3300046491 Bacteria 20681
100 Ga0495584_0008097 3300046491 Bacteria 5462
101 Ga0495584_0012031 3300046491 Bacteria 4424
102 Ga0495585_0004469 3300046492 Bacteria 9065
103 Ga0495585_0006219 3300046492 Bacteria 7439
104 Ga0495585_0047212 3300046492 Bacteria 2398
105 Ga0495585_0057236 3300046492 Bacteria 2152
106 Ga0495596_0001821 3300046500 Bacteria 11848
107 Ga0495596_0011591 3300046500 Bacteria 3795
108 Ga0495607_0000521 3300046501 Bacteria 37926
109 Ga0495607_0088573 3300046501 Bacteria 1682
110 Ga0495583_0000851 3300046506 Bacteria 37181
111 Ga0495583_0001096 3300046506 Bacteria 29972
112 Ga0495583_0005197 3300046506 Bacteria 8953
113 Ga0495583_0013788 3300046506 Bacteria 4486
114 Ga0495606_0000397 3300046507 Bacteria 73368
115 Ga0495606_0003998 3300046507 Bacteria 15056
116 Ga0495606_0075034 3300046507 Bacteria 2117
117 Ga0495606_0096159 3300046507 Bacteria 1812
118 Ga0495606_0249554 3300046507 Bacteria 985
119 Ga0495610_0000012 3300046512 Bacteria 517442
120 Ga0495610_0008104 3300046512 Bacteria 6873
121 Ga0495631_0019443 3300046518 Bacteria 3185
122 Ga0495631_0064018 3300046518 Bacteria 1592
123 Ga0495631_0114512 3300046518 Bacteria 1159
124 Ga0495631_0121658 3300046518 Bacteria 1122
125 Ga0495637_0000002 3300046520 Bacteria 629280
126 Ga0495637_0000051 3300046520 Bacteria 100076
127 Ga0495643_0002091 3300046522 Bacteria 16517
128 Ga0495643_0004109 3300046522 Bacteria 10349
129 Ga0495644_0009448 3300046523 Bacteria 3760
130 Ga0495644_0095764 3300046523 Bacteria 1121
131 Ga0495648_0000143 3300046524 Bacteria 85539
132 Ga0495648_0005070 3300046524 Bacteria 11056
133 Ga0495648_0006812 3300046524 Bacteria 9232
134 Ga0495648_0176865 3300046524 Bacteria 1088
135 Ga0495663_0001446 3300046525 Bacteria 7499
136 Ga0495642_0006991 3300046528 Bacteria 4329
137 Ga0495642_0033881 3300046528 Unclassified 2054
138 Ga0495654_0000011 3300046530 Bacteria 363172
139 Ga0495654_0002623 3300046530 Bacteria 11455
140 Ga0495654_0099440 3300046530 Bacteria 1341
141 Ga0495587_0100401 3300046536 Bacteria 1668
142 Ga0495609_0032771 3300046538 Bacteria 2359
143 Ga0495609_0052433 3300046538 Bacteria 1815
144 Ga0495597_0000252 3300046542 Bacteria 48772
145 Ga0495597_0000827 3300046542 Bacteria 24312
146 Ga0495597_0029780 3300046542 Bacteria 2491
147 Ga0495622_0141593 3300046557 Bacteria 1092
148 Ga0495633_0002068 3300046558 Bacteria 14445
149 Ga0495633_0021712 3300046558 Bacteria 3207
150 Ga0495668_0001668 3300046616 Bacteria 20628
151 Ga0495668_0120781 3300046616 Bacteria 1433
152 Ga0495668_0141848 3300046616 Bacteria 1315
153 Ga0495611_0001110 3300046648 Bacteria 14172
154 Ga0495611_0001583 3300046648 Bacteria 11133
155 Ga0495611_0008010 3300046648 Bacteria 4488
156 Ga0495611_0040018 3300046648 Bacteria 2088
157 Ga0495611_0089952 3300046648 Bacteria 1418
158 Ga0495625_0000150 3300046660 Bacteria 106314
159 Ga0495625_0040560 3300046660 Bacteria 3393
160 Ga0495625_0078710 3300046660 Bacteria 2301
161 Ga0495625_0240136 3300046660 Bacteria 1180
162 Ga0495625_0338415 3300046660 Bacteria 954
163 Ga0495661_0000461 3300046665 Bacteria 43183
164 Ga0495661_0010348 3300046665 Bacteria 6366
165 Ga0495661_0090063 3300046665 Bacteria 1747
166 Ga0495623_0007626 3300046679 Bacteria 7030
167 Ga0495669_0000520 3300046684 Bacteria 17474
168 Ga0495669_0030288 3300046684 Bacteria 2375
169 Ga0495669_0077661 3300046684 Bacteria 1520
170 Ga0495670_0000033 3300046691 Bacteria 81716
171 Ga0495670_0016936 3300046691 Bacteria 3582
172 Ga0495670_0370649 3300046691 Bacteria 772
173 Ga0495671_0047493 3300046692 Bacteria 2145
174 Ga0495649_0000024 3300046694 Bacteria 175713
175 Ga0495649_0047965 3300046694 Bacteria 2322
176 Ga0495649_0093168 3300046694 Bacteria 1604
177 Ga0495649_0177282 3300046694 Bacteria 1113
178 Ga0495649_0189435 3300046694 Bacteria 1071
179 Ga0495589_0000151 3300046794 Bacteria 64300
180 Ga0495589_0169050 3300046794 Bacteria 1039
181 Ga0495600_0000094 3300046809 Bacteria 48664
182 Ga0495660_0004725 3300046810 Bacteria 8221
183 Ga0495660_0047434 3300046810 Bacteria 2352
184 Ga0495660_0169222 3300046810 Bacteria 1065
185 Ga0495672_0000056 3300047320 Bacteria 223740
186 Ga0495683_0000017 3300047323 Bacteria 189599
187 Ga0495683_0002547 3300047323 Bacteria 10952
188 Ga0495683_0006317 3300047323 Bacteria 6479
189 Ga0495683_0044885 3300047323 Bacteria 2222
190 Ga0495683_0158412 3300047323 Bacteria 1048
191 Ga0495687_000098 3300047443 Bacteria 132403
192 Ga0495687_000455 3300047443 Bacteria 50452
193 Ga0495677_0004141 3300047445 Bacteria 5598
194 Ga0495679_004892 3300047446 Bacteria 6047
195 Ga0495679_066832 3300047446 Bacteria 1042
196 Ga0495679_066834 3300047446 Bacteria 1042
197 Ga0495673_0000003 3300047469 Bacteria 1491337
198 Ga0495673_0000050 3300047469 Bacteria 262267
199 Ga0495681_0012685 3300047470 Bacteria 4938
200 Ga0495681_0020634 3300047470 Bacteria 3571
201 Ga0495681_0099812 3300047470 Bacteria 1270
202 Ga0495686_0044955 3300047472 Bacteria 2795
203 Ga0495626_0001568 3300048091 Bacteria 17939
204 Ga0495626_0006422 3300048091 Bacteria 6695
205 Ga0495626_0018603 3300048091 Bacteria 3484
206 Ga0496102_0000077 3300048905 Bacteria 142501
207 Ga0496102_0000571 3300048905 Bacteria 39125
208 Ga0496103_0000403 3300048906 Bacteria 38378
209 Ga0496104_0012455 3300048907 Bacteria 7646
210 Ga0496105_0002058 3300048908 Bacteria 14540
211 Ga0496109_0034650 3300048912 Bacteria 4549
212 Ga0496109_0097736 3300048912 Bacteria 2721
213 Ga0496112_0288195 3300048915 Bacteria 1588
214 Ga0496112_0512415 3300048915 Bacteria 1135
215 Ga0496113_0005467 3300048916 Bacteria 7928
216 Ga0496113_0065307 3300048916 Bacteria 2754
217 Ga0496114_0005237 3300048917 Bacteria 10135
218 Ga0496115_0000131 3300048918 Bacteria 68111
219 Ga0496116_0003198 3300048919 Bacteria 16381
220 Ga0496117_0001521 3300048920 Bacteria 33156
221 Ga0496118_0001238 3300048921 Bacteria 39264
222 Ga0496119_0005690 3300048922 Bacteria 11822
223 Ga0496121_0000228 3300048924 Bacteria 120653
224 Ga0496122_0000299 3300048925 Bacteria 109780
225 Ga0496122_0005142 3300048925 Bacteria 15780
226 Ga0496122_0111951 3300048925 Bacteria 1789
227 Ga0496122_0128371 3300048925 Bacteria 1618
228 Ga0496122_0259361 3300048925 Bacteria 966
229 Ga0496123_0000959 3300048926 Bacteria 44656
230 Ga0496123_0042584 3300048926 Bacteria 3131
231 Ga0496123_0066441 3300048926 Bacteria 2284
232 Ga0496124_0000081 3300048927 Bacteria 208413
233 Ga0496124_0273997 3300048927 Bacteria 1234
234 Ga0496125_0000520 3300048928 Bacteria 66776
235 Ga0496125_0001128 3300048928 Bacteria 40779
236 Ga0496126_0001331 3300048929 Bacteria 39237
237 Ga0496126_0010255 3300048929 Bacteria 9846
238 Ga0495678_000048 3300049459 Bacteria 165744
239 Ga0495678_031015 3300049459 Bacteria 2233
240 Ga0495682_0013242 3300049460 Bacteria 3143
241 Ga0495682_0040857 3300049460 Bacteria 1700
242 Ga0501043_0066350 3300049579 Bacteria 2834
243 Ga0500610_0000076 3300053079 Bacteria 30101
244 Ga0500595_000094 3300053119 Bacteria 61463
245 Ga0500618_000052 3300053125 Bacteria 102436
246 Ga0500642_0004750 3300053130 Bacteria 4298
247 Ga0500586_005598 3300053145 Bacteria 3190
248 Ga0500636_0028263 3300053177 Bacteria 3313
249 Ga0500645_000002 3300053730 Bacteria 388892
250 Ga0500596_000084 3300053735 Bacteria 12721
251 2671695517 2671180139 Bacteria 4196045
252 2738828396 2738541297 Bacteria 6549566
253 2739152192 2738541357 Bacteria 6549408
254 2739193787 2738543003 Bacteria 6549560
255 2739320588 2738543026 Bacteria 6549408
256 2739338504 2738543029 Bacteria 6549249
257 2809143405 2808606418 Bacteria 6724496
258 rootH1_10185092
259 JGI24739J22299_10002478
260 JGI24737J22298_10055340
261 JGI25152J39213_1000091
262 JGI25150J39212_1000068
263 JGI25153J46596_10000031
264 JGI25153J46596_10004747
265 JGI25153J46596_10011048
266 JGI25153J46596_10021045
267 rootL2_10008238
268 rootL2_10081301
269 rootL2_10133019
270 rootH1_10206821
271 rootH1_10273390
272 Ga0055525_1000012
273 Ga0055525_1000013
274 Ga0055542_1000115
275 Ga0055529_1000052
276 Ga0055529_1000581
277 Ga0055537_1000161
278 Ga0055524_1000110
279 Ga0055524_1000665
280 Ga0055530_10000074
281 Ga0055531_10000253
282 Ga0065165_1002695
283 Ga0065165_1018615
284 Ga0070676_10039738
285 Ga0070666_10230032
286 Ga0070661_100028884
287 Ga0070668_100060152
288 Ga0070674_100003829
289 Ga0070667_100080660
290 Ga0070663_100192414
291 Ga0070678_100120642
292 Ga0070662_100031666
293 Ga0070665_100000810
294 Ga0068856_100055888
295 Ga0075369_10072371
296 Ga0075366_10026740
297 Ga0213872_10000381
298 Ga0213872_10000837
299 Ga0213872_10009734
300 Ga0209674_108326
301 Ga0209563_100025
302 Ga0209563_100030
303 Ga0207425_1000001
304 Ga0209026_1014261
305 Ga0209148_1000011
306 Ga0209129_1000003
307 Ga0209565_1000030
308 Ga0209565_1001520
309 Ga0209565_1020514
310 Ga0209455_1000006
311 Ga0209455_1000483
312 Ga0209673_1000925
313 Ga0209564_1040213
314 Ga0209758_1000001
315 Ga0209758_1000098
316 Ga0209758_1009388
317 Ga0209050_1000039
318 Ga0209050_1010451
319 Ga0209256_1000046
320 Ga0209256_1000186
321 Ga0209257_1000051
322 Ga0209257_1001591
323 Ga0207697_10093501
324 Ga0207647_10005172
325 Ga0207645_10065890
326 Ga0207706_10046366
327 Ga0207669_10002603
328 Ga0207668_10051414
329 Ga0207658_10009865
330 Ga0207678_10225453
331 Ga0207683_10048691
332 Ga0268266_10000002
333 Ga0307517_10038973
334 Ga0307513_10014719
335 Ga0395899_0032535
336 Ga0395899_0059959
337 Ga0395905_0118018
338 Ga0395905_0132218
339 Ga0395905_0162763
340 Ga0395901_0035949
341 Ga0436361_0389628
342 Ga0436361_0454529
343 Ga0436361_0527259
344 Ga0436361_0897983
345 Ga0495617_000018
346 Ga0495617_001203
347 Ga0495591_000033
348 Ga0495638_0204125
349 Ga0495650_0000067
350 Ga0495650_0000158
351 Ga0495650_0003843
352 Ga0495650_0083243
353 Ga0495605_0003823
354 Ga0495605_0004034
355 Ga0495605_0016557
356 Ga0495584_0000801
357 Ga0495584_0008097
358 Ga0495584_0012031
359 Ga0495585_0004469
360 Ga0495585_0006219
361 Ga0495585_0047212
362 Ga0495585_0057236
363 Ga0495596_0001821
364 Ga0495596_0011591
365 Ga0495607_0000521
366 Ga0495607_0088573
367 Ga0495583_0000851
368 Ga0495583_0001096
369 Ga0495583_0005197
370 Ga0495583_0013788
371 Ga0495606_0000397
372 Ga0495606_0003998
373 Ga0495606_0075034
374 Ga0495606_0096159
375 Ga0495606_0249554
376 Ga0495610_0000012
377 Ga0495610_0008104
378 Ga0495631_0019443
379 Ga0495631_0064018
380 Ga0495631_0114512
381 Ga0495631_0121658
382 Ga0495637_0000002
383 Ga0495637_0000051
384 Ga0495643_0002091
385 Ga0495643_0004109
386 Ga0495644_0009448
387 Ga0495644_0095764
388 Ga0495648_0000143
389 Ga0495648_0005070
390 Ga0495648_0006812
391 Ga0495648_0176865
392 Ga0495663_0001446
393 Ga0495642_0006991
394 Ga0495642_0033881
395 Ga0495654_0000011
396 Ga0495654_0002623
397 Ga0495654_0099440
398 Ga0495587_0100401
399 Ga0495609_0032771
400 Ga0495609_0052433
401 Ga0495597_0000252
402 Ga0495597_0000827
403 Ga0495597_0029780
404 Ga0495622_0141593
405 Ga0495633_0002068
406 Ga0495633_0021712
407 Ga0495668_0001668
408 Ga0495668_0120781
409 Ga0495668_0141848
410 Ga0495611_0001110
411 Ga0495611_0001583
412 Ga0495611_0008010
413 Ga0495611_0040018
414 Ga0495611_0089952
415 Ga0495625_0000150
416 Ga0495625_0040560
417 Ga0495625_0078710
418 Ga0495625_0240136
419 Ga0495625_0338415
420 Ga0495661_0000461
421 Ga0495661_0010348
422 Ga0495661_0090063
423 Ga0495623_0007626
424 Ga0495669_0000520
425 Ga0495669_0030288
426 Ga0495669_0077661
427 Ga0495670_0000033
428 Ga0495670_0016936
429 Ga0495670_0370649
430 Ga0495671_0047493
431 Ga0495649_0000024
432 Ga0495649_0047965
433 Ga0495649_0093168
434 Ga0495649_0177282
435 Ga0495649_0189435
436 Ga0495589_0000151
437 Ga0495589_0169050
438 Ga0495600_0000094
439 Ga0495660_0004725
440 Ga0495660_0047434
441 Ga0495660_0169222
442 Ga0495672_0000056
443 Ga0495683_0000017
444 Ga0495683_0002547
445 Ga0495683_0006317
446 Ga0495683_0044885
447 Ga0495683_0158412
448 Ga0495687_000098
449 Ga0495687_000455
450 Ga0495677_0004141
451 Ga0495679_004892
452 Ga0495679_066832
453 Ga0495679_066834
454 Ga0495673_0000003
455 Ga0495673_0000050
456 Ga0495681_0012685
457 Ga0495681_0020634
458 Ga0495681_0099812
459 Ga0495686_0044955
460 Ga0495626_0001568
461 Ga0495626_0006422
462 Ga0495626_0018603
463 Ga0496102_0000077
464 Ga0496102_0000571
465 Ga0496103_0000403
466 Ga0496104_0012455
467 Ga0496105_0002058
468 Ga0496109_0034650
469 Ga0496109_0097736
470 Ga0496112_0288195
471 Ga0496112_0512415
472 Ga0496113_0005467
473 Ga0496113_0065307
474 Ga0496114_0005237
475 Ga0496115_0000131
476 Ga0496116_0003198
477 Ga0496117_0001521
478 Ga0496118_0001238
479 Ga0496119_0005690
480 Ga0496121_0000228
481 Ga0496122_0000299
482 Ga0496122_0005142
483 Ga0496122_0111951
484 Ga0496122_0128371
485 Ga0496122_0259361
486 Ga0496123_0000959
487 Ga0496123_0042584
488 Ga0496123_0066441
489 Ga0496124_0000081
490 Ga0496124_0273997
491 Ga0496125_0000520
492 Ga0496125_0001128
493 Ga0496126_0001331
494 Ga0496126_0010255
495 Ga0495678_000048
496 Ga0495678_031015
497 Ga0495682_0013242
498 Ga0495682_0040857
499 Ga0501043_0066350
500 Ga0500610_0000076
501 Ga0500595_000094
502 Ga0500618_000052
503 Ga0500642_0004750
504 Ga0500586_005598
505 Ga0500636_0028263
506 Ga0500645_000002
507 Ga0500596_000084
508 2671695517
509 2738828396
510 2739152192
511 2739193787
512 2739320588
513 2739338504
514 2809143405

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03932

CutC

CutC family

12

212

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2bdq-assembly1.cif.gz_B crystal structure of the putative copper homeostasis protein cutc from streptococcus agalactiae, northeast strucural genomics target sar15. 0.9447 3 195
3iwp-assembly5.cif.gz_D crystal structure of human copper homeostasis protein cutc 0.9349 3 234
3iwp-assembly4.cif.gz_B crystal structure of human copper homeostasis protein cutc 0.9332 1 233
3iwp-assembly4.cif.gz_A crystal structure of human copper homeostasis protein cutc 0.9266 1 235
1x8c-assembly1.cif.gz_A crystal structure of the semet-derivative copper homeostasis protein (cutcm) with calcium binding from shigella flexneri 2a str. 301 0.925 3 237
ID Description Score Start End Superfamily
af_P34630_10_248_3.20.20.380 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Copper homeostasis (CutC) domain 0.9539 4 232 3.20.20.380
af_Q4E0C3_1_211_3.20.20.380 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Copper homeostasis (CutC) domain 0.9451 3 195 3.20.20.380
af_Q9D8X1_24_272_3.20.20.380 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Copper homeostasis (CutC) domain 0.9313 3 234 3.20.20.380
af_P67826_1_248_3.20.20.380 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Copper homeostasis (CutC) domain 0.9228 3 237 3.20.20.380
2bdqB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Copper homeostasis (CutC) domain 0.9206 4 195 3.20.20.380
ID Description Score Start End GO Terms
AF-A0A0C9N6G7-F1-model_v4 PF03932 family protein CutC 0.9879 1 233 GO:0005507
GO:0005737
AF-A0A847X024-F1-model_v4 Copper homeostasis protein cutC homolog 0.9828 3 195 GO:0005507
AF-A0A351VCH7-F1-model_v4 Copper homeostasis protein cutC homolog 0.9826 2 185 GO:0005507
AF-A0A3D3SLZ3-F1-model_v4 deleted 0.9815 4 122
AF-A0A355FNW3-F1-model_v4 Copper homeostasis protein cutC homolog 0.981 1 181 GO:0005507

Map