F367271

General Info

Members Datasets Scaffolds Average Seq Length
257 163 512 795

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_10032432|Ga0105241_100324324
Length 866
Sequence MDKRSGEKSFSVYVALFCHSYRKTCSSPEIHFIRRNMRIVLSTNRKTIIMRRLALLPVACFLAMSVFAQQVTGNIKDQQGKALSGSTVSLLNAKDSSVVKLAASNNNGAYTFNGIKPGTYIVKISHVGYAPVYSDRFEYSGAGDMNVSALQVSKTTGDLKEVVVSSKRPMVEVKADKTILNVEGTINSVGTDALELLRKSPGVMVDKDDNISLSGKNGVQVYIDGRPTPLSGKDLSDYLKSLQSAQIESIEIITNPSAKYDAAGNAGIINIRLKKNKSFGTNGSVNAGYGIGIYPKYNGGLSLNHRNNKVNIFGNYTFNDNINESYMKLHREQLDTLFDQKSTIHMKNVSHGYKGGLDYFLNKYNTVGFIVSGNSTNFNFGNYSRTPISYIPTGVVDRILVADNSSKSKRNNTDFNLNYRFADTSGHELNVDGDYAFYRIKSNQFQPNYYFDPTGNTQTNQFIYDMIAPTNIDMYTGKADYEQNFKKGKLGLGVKSSYVKSGNDFERYNVYSNTKQLDTLRSNGFNYKENINAVYANYNRSFKGFMIQAGLRVENTNSQGRSTGQKLNGAEYVDYDSTFNRHYTDFFPSAAVTYNKNPKNQWSLTYSRRIDRPAYQDLNPFEFKLDEYTYQKGNTGLRPQYTNSIGLTNTYKFKLTSTLNYSHVKDVFTQLVDTADRSKAFITKKNLATQDIVSLNISYPFNYKWYSAFVNVNTYYSRYKANFGGGDRTINLDVVAATFYMQNSFNLGKGWTGELSGWYSTPSIWQGTFKSSQIGSVDGGFQKTLFKGKVNAKASVSDIFKTIKWKGTSDFSGQKTIASGGFDSRVFKINITYRFGNNNVKASRQRKTGVEDESKRVGSQGGGLQQ

Samples

Sample ID Description Type Environment
1 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
76 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
77 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
116 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
117 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
118 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
119 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
120 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
121 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
122 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
123 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
124 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
125 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
126 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
127 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
128 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
129 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
130 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
131 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
132 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
133 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
134 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
135 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
142 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
143 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
144 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
145 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
146 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
147 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
148 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
149 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
150 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
151 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
153 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
154 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
155 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
156 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
157 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
158 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
159 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
160 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
161 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
162 2818991444 Filimonas endophytica 3197 Isolate Unclassified
163 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.22
Metatranscriptomes 0
Isolates 0.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.5
Nodule 0
Rhizoplane 0
Rhizosphere 89.11
Stem 0
Stem Tuber 0
Unclassified 3.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105241_10032432 3300009174 Bacteria 3916
2 JGI25406J46586_10000732 3300003203 Bacteria 15328
3 rootH2_10027557 3300003320 Bacteria 9653
4 rootH2_10027987 3300003320 Unclassified 3093
5 rootH2_10083512 3300003320 Bacteria 9358
6 rootH2_10085969 3300003320 Bacteria 6700
7 rootL2_10059606 3300003322 Bacteria 3668
8 rootH1_10003347 3300003323 Bacteria 19564
9 rootH1_10032948 3300003323 Bacteria 4175
10 JGI25160J50197_1001007 3300003354 Bacteria 14612
11 Ga0070658_10025987 3300005327 Bacteria 4698
12 Ga0070683_100000717 3300005329 Bacteria 24153
13 Ga0070683_100022282 3300005329 Bacteria 5659
14 Ga0070670_100039643 3300005331 Bacteria 4050
15 Ga0070677_10004086 3300005333 Bacteria 4735
16 Ga0068869_100012061 3300005334 Bacteria 5696
17 Ga0070666_10021618 3300005335 Bacteria 4170
18 Ga0070680_100085861 3300005336 Bacteria 2601
19 Ga0070682_100000054 3300005337 Bacteria 112635
20 Ga0068868_100020185 3300005338 Bacteria 5003
21 Ga0070689_100009505 3300005340 Bacteria 6893
22 Ga0070661_100007861 3300005344 Bacteria 7361
23 Ga0070661_100028482 3300005344 Bacteria 4029
24 Ga0070668_100008577 3300005347 Bacteria 7592
25 Ga0070668_100058358 3300005347 Bacteria 2985
26 Ga0070669_100000647 3300005353 Bacteria 25768
27 Ga0070669_100016615 3300005353 Bacteria 5253
28 Ga0070675_100018246 3300005354 Bacteria 5585
29 Ga0070675_100020893 3300005354 Bacteria 5227
30 Ga0070675_100040258 3300005354 Bacteria 3814
31 Ga0070674_100012251 3300005356 Bacteria 5261
32 Ga0070673_100006230 3300005364 Bacteria 7739
33 Ga0070673_100049401 3300005364 Bacteria 3285
34 Ga0070688_100003367 3300005365 Bacteria 8204
35 Ga0070688_100016355 3300005365 Bacteria 4241
36 Ga0070659_100004312 3300005366 Bacteria 10156
37 Ga0070659_100009662 3300005366 Bacteria 7090
38 Ga0070667_100005970 3300005367 Bacteria 10120
39 Ga0070663_100046780 3300005455 Unclassified 3063
40 Ga0070678_100042968 3300005456 Bacteria 3217
41 Ga0068867_100042405 3300005459 Bacteria 3329
42 Ga0070698_100007736 3300005471 Bacteria 11627
43 Ga0070698_100010157 3300005471 Bacteria 10057
44 Ga0070698_100013783 3300005471 Bacteria 8553
45 Ga0070679_100010778 3300005530 Bacteria 8678
46 Ga0070679_100027923 3300005530 Bacteria 5560
47 Ga0070684_100007120 3300005535 Bacteria 8693
48 Ga0068853_100000245 3300005539 Bacteria 38110
49 Ga0068853_100019409 3300005539 Bacteria 5635
50 Ga0070686_100043525 3300005544 Bacteria 2818
51 Ga0070665_100004791 3300005548 Bacteria 14076
52 Ga0068855_100029756 3300005563 Bacteria 6530
53 Ga0070664_100007012 3300005564 Bacteria 9092
54 Ga0070664_100013016 3300005564 Bacteria 6770
55 Ga0068857_100013956 3300005577 Bacteria 6990
56 Ga0068857_100023301 3300005577 Bacteria 5449
57 Ga0068856_100054030 3300005614 Bacteria 3961
58 Ga0068852_100016123 3300005616 Bacteria 5817
59 Ga0068852_100028801 3300005616 Unclassified 4551
60 Ga0068859_100001754 3300005617 Bacteria 22081
61 Ga0068859_100003439 3300005617 Bacteria 16091
62 Ga0068859_100017301 3300005617 Bacteria 7240
63 Ga0068859_100020040 3300005617 Bacteria 6716
64 Ga0068859_100050426 3300005617 Bacteria 4181
65 Ga0068864_100001233 3300005618 Bacteria 21276
66 Ga0068858_100040459 3300005842 Bacteria 4323
67 Ga0068858_100073217 3300005842 Bacteria 3180
68 Ga0068860_100014968 3300005843 Bacteria 7582
69 Ga0068860_100021161 3300005843 Bacteria 6300
70 Ga0068862_100008912 3300005844 Bacteria 8306
71 Ga0068862_100059239 3300005844 Bacteria 3288
72 Ga0081540_1008820 3300005983 Bacteria 7003
73 Ga0081539_10000523 3300005985 Bacteria 79800
74 Ga0081539_10010548 3300005985 Bacteria 7482
75 Ga0075366_10010620 3300006195 Bacteria 5172
76 Ga0097621_100019825 3300006237 Bacteria 5171
77 Ga0068871_100014223 3300006358 Bacteria 5926
78 Ga0068871_100021972 3300006358 Bacteria 4914
79 Ga0075428_100023319 3300006844 Bacteria 6848
80 Ga0075430_100003812 3300006846 Bacteria 12690
81 Ga0075430_100022561 3300006846 Bacteria 5357
82 Ga0075431_100003484 3300006847 Bacteria 15256
83 Ga0075429_100000539 3300006880 Bacteria 28785
84 Ga0075429_100012186 3300006880 Bacteria 7452
85 Ga0097620_100001754 3300006931 Bacteria 22081
86 Ga0097620_100003439 3300006931 Bacteria 16091
87 Ga0097620_100017302 3300006931 Bacteria 7240
88 Ga0097620_100020041 3300006931 Bacteria 6716
89 Ga0097620_100050426 3300006931 Bacteria 4181
90 Ga0105240_10000635 3300009093 Bacteria 64838
91 Ga0105240_10000657 3300009093 Bacteria 63709
92 Ga0105240_10000674 3300009093 Bacteria 62689
93 Ga0111539_10003581 3300009094 Bacteria 20469
94 Ga0111539_10027105 3300009094 Bacteria 6998
95 Ga0105247_10000563 3300009101 Bacteria 30131
96 Ga0114129_10024419 3300009147 Bacteria 8565
97 Ga0105241_10002181 3300009174 Bacteria 14751
98 Ga0105242_10065542 3300009176 Bacteria 2997
99 Ga0105237_10005828 3300009545 Bacteria 13821
100 Ga0105237_10014697 3300009545 Bacteria 8173
101 Ga0105238_10003055 3300009551 Bacteria 16687
102 Ga0105238_10031455 3300009551 Bacteria 5402
103 Ga0105239_10000083 3300010375 Bacteria 132046
104 Ga0105239_10000368 3300010375 Bacteria 66186
105 Ga0105239_10002459 3300010375 Bacteria 23594
106 Ga0105239_10030265 3300010375 Bacteria 5951
107 Ga0157373_10003247 3300013100 Bacteria 12289
108 Ga0157370_10012390 3300013104 Bacteria 8843
109 Ga0157369_10012168 3300013105 Bacteria 9766
110 Ga0157374_10000003 3300013296 Bacteria 854471
111 Ga0157374_10001009 3300013296 Bacteria 24398
112 Ga0157374_10016885 3300013296 Bacteria 6423
113 Ga0157374_10053999 3300013296 Bacteria 3747
114 Ga0157378_10012526 3300013297 Bacteria 7422
115 Ga0157378_10038020 3300013297 Bacteria 4265
116 Ga0163162_10000201 3300013306 Bacteria 55260
117 Ga0163162_10004330 3300013306 Bacteria 13665
118 Ga0163162_10140402 3300013306 Bacteria 2529
119 Ga0157372_10000583 3300013307 Bacteria 39824
120 Ga0157372_10015567 3300013307 Bacteria 8152
121 Ga0157372_10020929 3300013307 Bacteria 7060
122 Ga0157372_10021413 3300013307 Bacteria 6984
123 Ga0157372_10034181 3300013307 Bacteria 5588
124 Ga0157372_10051635 3300013307 Unclassified 4576
125 Ga0157375_10009185 3300013308 Bacteria 8666
126 Ga0157375_10024038 3300013308 Bacteria 5633
127 Ga0157375_10042601 3300013308 Bacteria 4395
128 Ga0163163_10000057 3300014325 Bacteria 124939
129 Ga0163163_10004186 3300014325 Bacteria 12293
130 Ga0157380_10005405 3300014326 Bacteria 8925
131 Ga0157377_10001104 3300014745 Bacteria 11407
132 Ga0157377_10005977 3300014745 Bacteria 5766
133 Ga0157376_10046167 3300014969 Bacteria 3591
134 Ga0157376_10059992 3300014969 Unclassified 3192
135 Ga0213876_10015827 3300021384 Bacteria 3991
136 Ga0207426_1000132 3300025302 Bacteria 209623
137 Ga0207682_10007427 3300025893 Bacteria 4367
138 Ga0207642_10009632 3300025899 Bacteria 3370
139 Ga0207710_10001194 3300025900 Bacteria 13167
140 Ga0207688_10026276 3300025901 Bacteria 3200
141 Ga0207680_10037474 3300025903 Bacteria 2799
142 Ga0207647_10000222 3300025904 Bacteria 46878
143 Ga0207645_10001508 3300025907 Bacteria 19057
144 Ga0207645_10006529 3300025907 Bacteria 8354
145 Ga0207643_10020288 3300025908 Bacteria 3647
146 Ga0207654_10003217 3300025911 Bacteria 8251
147 Ga0207695_10000446 3300025913 Bacteria 90493
148 Ga0207695_10001024 3300025913 Bacteria 49211
149 Ga0207695_10005590 3300025913 Bacteria 16606
150 Ga0207695_10086798 3300025913 Bacteria 3154
151 Ga0207671_10001755 3300025914 Bacteria 24384
152 Ga0207671_10009364 3300025914 Bacteria 8191
153 Ga0207657_10009387 3300025919 Bacteria 9839
154 Ga0207652_10055705 3300025921 Bacteria 3402
155 Ga0207681_10014500 3300025923 Bacteria 4899
156 Ga0207681_10022738 3300025923 Bacteria 4002
157 Ga0207650_10003475 3300025925 Bacteria 10822
158 Ga0207659_10009312 3300025926 Bacteria 6132
159 Ga0207659_10017534 3300025926 Bacteria 4678
160 Ga0207690_10025350 3300025932 Bacteria 3722
161 Ga0207706_10007644 3300025933 Bacteria 9990
162 Ga0207706_10076911 3300025933 Unclassified 2935
163 Ga0207670_10028787 3300025936 Bacteria 3532
164 Ga0207691_10044585 3300025940 Bacteria 4080
165 Ga0207691_10049325 3300025940 Bacteria 3857
166 Ga0207689_10009681 3300025942 Bacteria 8299
167 Ga0207689_10011165 3300025942 Bacteria 7707
168 Ga0207689_10012158 3300025942 Bacteria 7367
169 Ga0207661_10042158 3300025944 Bacteria 3597
170 Ga0207679_10006376 3300025945 Bacteria 7455
171 Ga0207679_10013066 3300025945 Bacteria 5435
172 Ga0207667_10007925 3300025949 Bacteria 12676
173 Ga0207667_10085801 3300025949 Bacteria 3259
174 Ga0207651_10046213 3300025960 Unclassified 2926
175 Ga0207668_10002565 3300025972 Bacteria 10618
176 Ga0207668_10024549 3300025972 Bacteria 3893
177 Ga0207677_10068547 3300026023 Bacteria 2490
178 Ga0207639_10024464 3300026041 Bacteria 4371
179 Ga0207639_10061937 3300026041 Unclassified 2891
180 Ga0207678_10026455 3300026067 Bacteria 5060
181 Ga0207648_10016275 3300026089 Bacteria 6803
182 Ga0207648_10047678 3300026089 Bacteria 3754
183 Ga0207648_10049943 3300026089 Bacteria 3658
184 Ga0207676_10010732 3300026095 Bacteria 6531
185 Ga0207674_10019432 3300026116 Bacteria 7357
186 Ga0207674_10032499 3300026116 Bacteria 5473
187 Ga0207675_100002256 3300026118 Bacteria 19155
188 Ga0207675_100006051 3300026118 Bacteria 11511
189 Ga0207675_100086558 3300026118 Bacteria 2942
190 Ga0207683_10000468 3300026121 Bacteria 37569
191 Ga0207698_10007893 3300026142 Bacteria 6702
192 Ga0207698_10019672 3300026142 Unclassified 4628
193 Ga0207428_10009144 3300027907 Bacteria 8902
194 Ga0268265_10023635 3300028380 Bacteria 4335
195 Ga0268264_10001681 3300028381 Bacteria 20386
196 Ga0268264_10010667 3300028381 Bacteria 7591
197 Ga0268264_10012128 3300028381 Bacteria 7095
198 Ga0307517_10037547 3300028786 Bacteria 5404
199 Ga0307515_10000001 3300028794 Bacteria 4259510
200 Ga0307515_10004411 3300028794 Bacteria 29136
201 Ga0307515_10011733 3300028794 Bacteria 16581
202 Ga0265327_10000099 3300031251 Bacteria 190474
203 Ga0307516_10001823 3300031730 Bacteria 29270
204 Ga0307410_10024792 3300031852 Bacteria 3753
205 Ga0307507_10000071 3300033179 Bacteria 158391
206 Ga0307510_10000042 3300033180 Bacteria 100951
207 Ga0436365_1889064 3300039437 Bacteria 17551
208 Ga0466972_0000016 3300044658 Bacteria 208802
209 Ga0466972_0000123 3300044658 Bacteria 65577
210 Ga0466972_0003885 3300044658 Bacteria 7445
211 Ga0466961_0019460 3300044693 Bacteria 4367
212 Ga0466959_0001524 3300045049 Bacteria 14228
213 Ga0495585_0012658 3300046492 Bacteria 4966
214 Ga0495606_0004646 3300046507 Bacteria 13579
215 Ga0495606_0014474 3300046507 Bacteria 6153
216 Ga0495630_0029876 3300046517 Bacteria 4053
217 Ga0495587_0034469 3300046536 Bacteria 3053
218 Ga0495633_0000015 3300046558 Bacteria 254484
219 Ga0495668_0000041 3300046616 Bacteria 229462
220 Ga0495668_0002730 3300046616 Bacteria 14136
221 Ga0495625_0001528 3300046660 Bacteria 27676
222 Ga0495625_0001551 3300046660 Bacteria 27391
223 Ga0495672_0012478 3300047320 Bacteria 5927
224 Ga0501300_002407 3300049523 Bacteria 2799
225 Ga0501032_0021501 3300049569 Bacteria 4483
226 Ga0501034_0000007 3300049571 Bacteria 357805
227 Ga0501034_0016834 3300049571 Bacteria 7496
228 Ga0501036_0004307 3300049572 Bacteria 11494
229 Ga0501038_0046149 3300049574 Bacteria 3778
230 Ga0501046_0033176 3300049580 Bacteria 4174
231 Ga0501047_0046730 3300049581 Bacteria 4183
232 Ga0501070_0037058 3300049586 Bacteria 4071
233 Ga0501072_0010433 3300049588 Bacteria 7080
234 Ga0501073_0000302 3300049589 Bacteria 32545
235 Ga0501201_000387 3300049651 Bacteria 4052
236 Ga0501222_002053 3300049662 Bacteria 2787
237 Ga0501235_001211 3300049669 Bacteria 5430
238 Ga0501242_000073 3300049674 Bacteria 6442
239 Ga0501252_000172 3300049682 Bacteria 4110
240 Ga0501259_000486 3300049688 Bacteria 6345
241 Ga0501080_0065998 3300049742 Bacteria 3365
242 Ga0501035_0029492 3300049822 Bacteria 5003
243 Ga0501044_0076382 3300049823 Bacteria 3400
244 Ga0501284_00017 3300050005 Bacteria 96362
245 nmdc:mga0k408_462_c1 3300050493 Bacteria 11298
246 nmdc:mga09592_1546_c1 3300050508 Bacteria 18488
247 nmdc:mga0qj67_14639_c1 3300050509 Bacteria 5931
248 nmdc:mga08y16_10001_c1 3300050511 Bacteria 9953
249 nmdc:mga08y16_36495_c1 3300050511 Bacteria 5162
250 Ga0500562_000063 3300053108 Bacteria 52346
251 Ga0500622_0000845 3300053156 Bacteria 26209
252 Ga0500611_000037 3300053727 Bacteria 72513
253 Ga0500611_000083 3300053727 Bacteria 29347
254 Ga0500645_002709 3300053730 Bacteria 7696
255 2819586302 2818991444 Bacteria 6968812
256 2929158735 2929154850 Bacteria 6753285
257 Ga0105241_10032432
258 JGI25406J46586_10000732
259 rootH2_10027557
260 rootH2_10027987
261 rootH2_10083512
262 rootH2_10085969
263 rootL2_10059606
264 rootH1_10003347
265 rootH1_10032948
266 JGI25160J50197_1001007
267 Ga0070658_10025987
268 Ga0070683_100000717
269 Ga0070683_100022282
270 Ga0070670_100039643
271 Ga0070677_10004086
272 Ga0068869_100012061
273 Ga0070666_10021618
274 Ga0070680_100085861
275 Ga0070682_100000054
276 Ga0068868_100020185
277 Ga0070689_100009505
278 Ga0070661_100007861
279 Ga0070661_100028482
280 Ga0070668_100008577
281 Ga0070668_100058358
282 Ga0070669_100000647
283 Ga0070669_100016615
284 Ga0070675_100018246
285 Ga0070675_100020893
286 Ga0070675_100040258
287 Ga0070674_100012251
288 Ga0070673_100006230
289 Ga0070673_100049401
290 Ga0070688_100003367
291 Ga0070688_100016355
292 Ga0070659_100004312
293 Ga0070659_100009662
294 Ga0070667_100005970
295 Ga0070663_100046780
296 Ga0070678_100042968
297 Ga0068867_100042405
298 Ga0070698_100007736
299 Ga0070698_100010157
300 Ga0070698_100013783
301 Ga0070679_100010778
302 Ga0070679_100027923
303 Ga0070684_100007120
304 Ga0068853_100000245
305 Ga0068853_100019409
306 Ga0070686_100043525
307 Ga0070665_100004791
308 Ga0068855_100029756
309 Ga0070664_100007012
310 Ga0070664_100013016
311 Ga0068857_100013956
312 Ga0068857_100023301
313 Ga0068856_100054030
314 Ga0068852_100016123
315 Ga0068852_100028801
316 Ga0068859_100001754
317 Ga0068859_100003439
318 Ga0068859_100017301
319 Ga0068859_100020040
320 Ga0068859_100050426
321 Ga0068864_100001233
322 Ga0068858_100040459
323 Ga0068858_100073217
324 Ga0068860_100014968
325 Ga0068860_100021161
326 Ga0068862_100008912
327 Ga0068862_100059239
328 Ga0081540_1008820
329 Ga0081539_10000523
330 Ga0081539_10010548
331 Ga0075366_10010620
332 Ga0097621_100019825
333 Ga0068871_100014223
334 Ga0068871_100021972
335 Ga0075428_100023319
336 Ga0075430_100003812
337 Ga0075430_100022561
338 Ga0075431_100003484
339 Ga0075429_100000539
340 Ga0075429_100012186
341 Ga0097620_100001754
342 Ga0097620_100003439
343 Ga0097620_100017302
344 Ga0097620_100020041
345 Ga0097620_100050426
346 Ga0105240_10000635
347 Ga0105240_10000657
348 Ga0105240_10000674
349 Ga0111539_10003581
350 Ga0111539_10027105
351 Ga0105247_10000563
352 Ga0114129_10024419
353 Ga0105241_10002181
354 Ga0105242_10065542
355 Ga0105237_10005828
356 Ga0105237_10014697
357 Ga0105238_10003055
358 Ga0105238_10031455
359 Ga0105239_10000083
360 Ga0105239_10000368
361 Ga0105239_10002459
362 Ga0105239_10030265
363 Ga0157373_10003247
364 Ga0157370_10012390
365 Ga0157369_10012168
366 Ga0157374_10000003
367 Ga0157374_10001009
368 Ga0157374_10016885
369 Ga0157374_10053999
370 Ga0157378_10012526
371 Ga0157378_10038020
372 Ga0163162_10000201
373 Ga0163162_10004330
374 Ga0163162_10140402
375 Ga0157372_10000583
376 Ga0157372_10015567
377 Ga0157372_10020929
378 Ga0157372_10021413
379 Ga0157372_10034181
380 Ga0157372_10051635
381 Ga0157375_10009185
382 Ga0157375_10024038
383 Ga0157375_10042601
384 Ga0163163_10000057
385 Ga0163163_10004186
386 Ga0157380_10005405
387 Ga0157377_10001104
388 Ga0157377_10005977
389 Ga0157376_10046167
390 Ga0157376_10059992
391 Ga0213876_10015827
392 Ga0207426_1000132
393 Ga0207682_10007427
394 Ga0207642_10009632
395 Ga0207710_10001194
396 Ga0207688_10026276
397 Ga0207680_10037474
398 Ga0207647_10000222
399 Ga0207645_10001508
400 Ga0207645_10006529
401 Ga0207643_10020288
402 Ga0207654_10003217
403 Ga0207695_10000446
404 Ga0207695_10001024
405 Ga0207695_10005590
406 Ga0207695_10086798
407 Ga0207671_10001755
408 Ga0207671_10009364
409 Ga0207657_10009387
410 Ga0207652_10055705
411 Ga0207681_10014500
412 Ga0207681_10022738
413 Ga0207650_10003475
414 Ga0207659_10009312
415 Ga0207659_10017534
416 Ga0207690_10025350
417 Ga0207706_10007644
418 Ga0207706_10076911
419 Ga0207670_10028787
420 Ga0207691_10044585
421 Ga0207691_10049325
422 Ga0207689_10009681
423 Ga0207689_10011165
424 Ga0207689_10012158
425 Ga0207661_10042158
426 Ga0207679_10006376
427 Ga0207679_10013066
428 Ga0207667_10007925
429 Ga0207667_10085801
430 Ga0207651_10046213
431 Ga0207668_10002565
432 Ga0207668_10024549
433 Ga0207677_10068547
434 Ga0207639_10024464
435 Ga0207639_10061937
436 Ga0207678_10026455
437 Ga0207648_10016275
438 Ga0207648_10047678
439 Ga0207648_10049943
440 Ga0207676_10010732
441 Ga0207674_10019432
442 Ga0207674_10032499
443 Ga0207675_100002256
444 Ga0207675_100006051
445 Ga0207675_100086558
446 Ga0207683_10000468
447 Ga0207698_10007893
448 Ga0207698_10019672
449 Ga0207428_10009144
450 Ga0268265_10023635
451 Ga0268264_10001681
452 Ga0268264_10010667
453 Ga0268264_10012128
454 Ga0307517_10037547
455 Ga0307515_10000001
456 Ga0307515_10004411
457 Ga0307515_10011733
458 Ga0265327_10000099
459 Ga0307516_10001823
460 Ga0307410_10024792
461 Ga0307507_10000071
462 Ga0307510_10000042
463 Ga0436365_1889064
464 Ga0466972_0000016
465 Ga0466972_0000123
466 Ga0466972_0003885
467 Ga0466961_0019460
468 Ga0466959_0001524
469 Ga0495585_0012658
470 Ga0495606_0004646
471 Ga0495606_0014474
472 Ga0495630_0029876
473 Ga0495587_0034469
474 Ga0495633_0000015
475 Ga0495668_0000041
476 Ga0495668_0002730
477 Ga0495625_0001528
478 Ga0495625_0001551
479 Ga0495672_0012478
480 Ga0501300_002407
481 Ga0501032_0021501
482 Ga0501034_0000007
483 Ga0501034_0016834
484 Ga0501036_0004307
485 Ga0501038_0046149
486 Ga0501046_0033176
487 Ga0501047_0046730
488 Ga0501070_0037058
489 Ga0501072_0010433
490 Ga0501073_0000302
491 Ga0501201_000387
492 Ga0501222_002053
493 Ga0501235_001211
494 Ga0501242_000073
495 Ga0501252_000172
496 Ga0501259_000486
497 Ga0501080_0065998
498 Ga0501035_0029492
499 Ga0501044_0076382
500 Ga0501284_00017
501 nmdc:mga0k408_462_c1
502 nmdc:mga09592_1546_c1
503 nmdc:mga0qj67_14639_c1
504 nmdc:mga08y16_10001_c1
505 nmdc:mga08y16_36495_c1
506 Ga0500562_000063
507 Ga0500622_0000845
508 Ga0500611_000037
509 Ga0500611_000083
510 Ga0500645_002709
511 2819586302
512 2929158735

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14905

OMP_b-brl_3

Outer membrane protein beta-barrel family

419

833

0.9

PF07715

Plug

TonB-dependent Receptor Plug Domain

171

268

0.89

PF17802

SpaA

Prealbumin-like fold domain

69

124

0.88

PF13620

CarboxypepD_reg

Carboxypeptidase regulatory-like domain

70

152

0.87

PF00593

TonB_dep_Rec_b-barrel

TonB dependent receptor-like, beta-barrel

348

763

0.64

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v4c-assembly3.cif.gz_F crystal structure of pyrogallol-phloroglucinol transhydroxylase from pelobacter acidigallici 0.8912 21 101
6fwv-assembly2.cif.gz_B the bacillus anthracis tie protein 0.7914 21 104
3e8v-assembly1.cif.gz_A crystal structure of a possible transglutaminase-family protein proteolytic fragment from bacteroides fragilis 0.7865 21 98
3is1-assembly1.cif.gz_X crystal structure of functional region of uafa from staphylococcus saprophyticus in c2 form at 2.45 angstrom resolution 0.7789 21 104
4p0d-assembly1.cif.gz_A the t6 backbone pilin of serotype m6 streptococcus pyogenes has a modular three-domain structure decorated with variable loops and extensions 0.7755 21 89
ID Description Score Start End Superfamily
1ti2B03 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8925 21 101 2.60.40.10
af_P0CG96_23_100_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.8523 22 104 2.60.40.1120
af_E7FFQ7_314_405_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.8443 21 112 2.60.40.1120
af_P42787_1224_1309_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.8421 22 106 2.60.40.1120
af_P91359_377_465_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.8352 21 108 2.60.40.1120
ID Description Score Start End GO Terms
AF-A0A3C0UM90-F1-model_v4 TonB-dependent receptor 0.9364 14 766 GO:0009279
AF-A0A3C0UM90-F1-model_v4 TonB-dependent receptor 0.9127 14 766 GO:0009279
AF-A0A4R4PWR3-F1-model_v4 Carboxypeptidase regulatory-like domain-containing protein 0.9115 21 106 GO:0004180
AF-A0A355UVY8-F1-model_v4 Carboxypeptidase regulatory-like domain-containing protein 0.8934 21 106
AF-A0A418QLQ8-F1-model_v4 Outer membrane protein beta-barrel domain-containing protein 0.8889 620 786

Map