F367300

General Info

Members Datasets Scaffolds Average Seq Length
257 155 257 226

Family's Representative Sequence

Representative Sequence 3300013296|Ga0157374_10177533|Ga0157374_101775331
Length 263
Sequence MLWTIVVLLLILWLLGFTMHVAGGLIHILLKVGXXRGRMDVYLVPIGRDRYELYCEVPDEPEATVDETSTGFVSRMKHRFMALLAEAERERRRGHTDDQPKGTFARTKAVILRYVAETIAEQRLLWHLRRQDSARLFFPDDLDEPRASTLLRRQLARDFEKHRFWLIVDTLGFVASGALVLLPGPNIVAYYFAFRMAGHYLSLRGARQGLDSVTWTAEESPPLSELRRAIDLDGAERERRVHDVAAALKLEHLVKFFERTAVT

Samples

Sample ID Description Type Environment
1 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
75 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
76 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
77 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
78 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
79 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
80 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
81 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
82 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
83 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
84 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
85 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
86 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
87 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
88 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
89 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
90 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
91 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
92 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
93 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
94 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
95 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
96 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
97 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
98 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
99 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
100 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
101 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
102 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
103 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
104 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
105 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
106 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
107 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
108 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
109 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
110 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
111 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
112 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
113 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
114 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
115 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
116 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
117 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
118 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
119 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
130 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
131 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
132 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
133 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
134 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
135 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
136 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
137 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
138 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
139 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
140 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
141 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
142 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
143 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
144 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
145 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
146 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
147 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
148 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
149 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
150 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
151 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
152 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
153 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
154 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
155 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.61
Metatranscriptomes 0.39
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.78
Nodule 0
Rhizoplane 5.45
Rhizosphere 93.77
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0032354_1007197 3300003693 Unclassified 1116
2 Ga0065712_10069367 3300005290 Bacteria 7437
3 Ga0070683_100003335 3300005329 Bacteria 12986
4 Ga0070683_100652671 3300005329 Unclassified 1007
5 Ga0070670_100017537 3300005331 Bacteria 6143
6 Ga0070670_100418591 3300005331 Bacteria 1184
7 Ga0070670_100828290 3300005331 Bacteria 837
8 Ga0068869_100564119 3300005334 Bacteria 958
9 Ga0070666_10072120 3300005335 Bacteria 2351
10 Ga0070666_10253454 3300005335 Unclassified 1246
11 Ga0070660_100188025 3300005339 Bacteria 1672
12 Ga0070689_100154333 3300005340 Bacteria 1853
13 Ga0070689_100401698 3300005340 Unclassified 1158
14 Ga0070689_100437879 3300005340 Archaea 1110
15 Ga0070689_100541854 3300005340 Unclassified 1002
16 Ga0070661_100079336 3300005344 Bacteria 2422
17 Ga0070661_100128603 3300005344 Bacteria 1901
18 Ga0070661_100220590 3300005344 Unclassified 1454
19 Ga0070661_100595693 3300005344 Unclassified 893
20 Ga0070669_100163950 3300005353 Bacteria 1729
21 Ga0070675_100240502 3300005354 Bacteria 1582
22 Ga0070675_100367661 3300005354 Bacteria 1278
23 Ga0070671_100069479 3300005355 Bacteria 2938
24 Ga0070671_100568765 3300005355 Bacteria 978
25 Ga0070673_100436015 3300005364 Unclassified 1177
26 Ga0070659_100127628 3300005366 Bacteria 2064
27 Ga0070667_100992588 3300005367 Unclassified 783
28 Ga0070701_10189869 3300005438 Bacteria 1208
29 Ga0070711_100190388 3300005439 Bacteria 1576
30 Ga0070700_100187651 3300005441 Bacteria 1443
31 Ga0070678_100047666 3300005456 Bacteria 3081
32 Ga0070662_100040542 3300005457 Bacteria 3316
33 Ga0068867_100032579 3300005459 Bacteria 3770
34 Ga0070685_10115039 3300005466 Archaea 1663
35 Ga0070679_100664489 3300005530 Bacteria 985
36 Ga0070684_100000403 3300005535 Bacteria 29597
37 Ga0068853_100644839 3300005539 Bacteria 1008
38 Ga0070704_100500937 3300005549 Bacteria 1054
39 Ga0068855_100456744 3300005563 Bacteria 1393
40 Ga0068855_100500830 3300005563 Bacteria 1320
41 Ga0070664_100008181 3300005564 Bacteria 8455
42 Ga0070664_100092558 3300005564 Bacteria 2618
43 Ga0068856_100467931 3300005614 Viruses 1281
44 Ga0068866_10351084 3300005718 Bacteria 937
45 Ga0068870_10188311 3300005840 Unclassified 1243
46 Ga0068860_100746091 3300005843 Unclassified 990
47 Ga0075366_10253770 3300006195 Bacteria 1073
48 Ga0075428_100013190 3300006844 Bacteria 9193
49 Ga0075428_100020402 3300006844 Bacteria 7337
50 Ga0075428_100044206 3300006844 Bacteria 4895
51 Ga0075428_100215586 3300006844 Unclassified 2074
52 Ga0075430_100012910 3300006846 Bacteria 7118
53 Ga0075430_100014097 3300006846 Bacteria 6816
54 Ga0075430_100021276 3300006846 Bacteria 5515
55 Ga0075430_100034258 3300006846 Unclassified 4310
56 Ga0075430_100422411 3300006846 Unclassified 1100
57 Ga0075431_100044587 3300006847 Bacteria 4574
58 Ga0075431_100075512 3300006847 Bacteria 3478
59 Ga0075431_100093423 3300006847 Bacteria 3104
60 Ga0075431_100890881 3300006847 Unclassified 860
61 Ga0075433_10721542 3300006852 Unclassified 872
62 Ga0075434_100935956 3300006871 Unclassified 881
63 Ga0075429_100010261 3300006880 Bacteria 8107
64 Ga0075429_100047529 3300006880 Bacteria 3734
65 Ga0075429_100100840 3300006880 Bacteria 2520
66 Ga0068865_100274634 3300006881 Unclassified 1339
67 Ga0068865_100780721 3300006881 Archaea 823
68 Ga0105240_10215277 3300009093 Unclassified 2242
69 Ga0111539_10002839 3300009094 Bacteria 23023
70 Ga0111539_10127777 3300009094 Bacteria 2977
71 Ga0114129_10019579 3300009147 Bacteria 9634
72 Ga0114129_10022615 3300009147 Bacteria 8917
73 Ga0114129_10038959 3300009147 Bacteria 6699
74 Ga0114129_10217318 3300009147 Bacteria 2581
75 Ga0105242_10215403 3300009176 Unclassified 1713
76 Ga0105248_10239554 3300009177 Bacteria 2042
77 Ga0105248_10312506 3300009177 Bacteria 1770
78 Ga0105238_10577023 3300009551 Bacteria 1131
79 Ga0105239_10386432 3300010375 Unclassified 1583
80 Ga0157370_10582787 3300013104 Bacteria 1025
81 Ga0157369_10610213 3300013105 Unclassified 1126
82 Ga0157374_10177533 3300013296 Bacteria 2079
83 Ga0157374_10709454 3300013296 Bacteria 1019
84 Ga0157372_10545986 3300013307 Bacteria 1351
85 Ga0157380_11363848 3300014326 Archaea 758
86 Ga0207697_10002911 3300025315 Bacteria 8660
87 Ga0207642_10339580 3300025899 Bacteria 883
88 Ga0207688_10063750 3300025901 Bacteria 2079
89 Ga0207680_10054776 3300025903 Bacteria 2401
90 Ga0207649_10051307 3300025920 Bacteria 2554
91 Ga0207649_10182420 3300025920 Unclassified 1470
92 Ga0207681_10106268 3300025923 Bacteria 2034
93 Ga0207650_10027000 3300025925 Bacteria 4104
94 Ga0207650_10697607 3300025925 Bacteria 857
95 Ga0207644_10050718 3300025931 Bacteria 2976
96 Ga0207644_10526713 3300025931 Bacteria 977
97 Ga0207670_10237085 3300025936 Unclassified 1404
98 Ga0207704_10152417 3300025938 Unclassified 1633
99 Ga0207691_10252043 3300025940 Unclassified 1524
100 Ga0207711_10043038 3300025941 Bacteria 3850
101 Ga0207711_10571326 3300025941 Unclassified 1055
102 Ga0207661_10007418 3300025944 Bacteria 7804
103 Ga0207679_10045507 3300025945 Bacteria 3174
104 Ga0207679_10114918 3300025945 Bacteria 2132
105 Ga0207679_10266240 3300025945 Bacteria 1464
106 Ga0207658_10888101 3300025986 Unclassified 811
107 Ga0207708_10507491 3300026075 Bacteria 1012
108 Ga0207702_10526113 3300026078 Bacteria 1155
109 Ga0207641_10266085 3300026088 Bacteria 1607
110 Ga0207648_10048137 3300026089 Bacteria 3733
111 Ga0207683_10044232 3300026121 Bacteria 3893
112 Ga0209971_1015178 3300027682 Unclassified 1825
113 Ga0207428_10000353 3300027907 Bacteria 59325
114 Ga0307408_100121601 3300031548 Bacteria 2023
115 Ga0307408_100173259 3300031548 Bacteria 1724
116 Ga0316577_10405567 3300031733 Unclassified 774
117 Ga0307413_10012068 3300031824 Bacteria 4282
118 Ga0307410_10007048 3300031852 Bacteria 6123
119 Ga0307410_10166964 3300031852 Bacteria 1655
120 Ga0307406_10180006 3300031901 Bacteria 1538
121 Ga0307407_10003691 3300031903 Bacteria 6341
122 Ga0307407_10182316 3300031903 Bacteria 1392
123 Ga0307407_10441091 3300031903 Bacteria 943
124 Ga0307412_10067504 3300031911 Bacteria 2428
125 Ga0307412_10136498 3300031911 Bacteria 1790
126 Ga0307409_100033917 3300031995 Bacteria 3721
127 Ga0307409_100093492 3300031995 Bacteria 2471
128 Ga0307416_100086840 3300032002 Bacteria 2668
129 Ga0307416_100114421 3300032002 Unclassified 2387
130 Ga0307416_100140450 3300032002 Bacteria 2194
131 Ga0307416_100249894 3300032002 Bacteria 1725
132 Ga0307414_10240597 3300032004 Bacteria 1498
133 Ga0307411_10020378 3300032005 Bacteria 3855
134 Ga0307411_10182350 3300032005 Unclassified 1595
135 Ga0307415_100010400 3300032126 Bacteria 5270
136 Ga0307415_100267097 3300032126 Bacteria 1399
137 Ga0373937_0237723 3300036401 Bacteria 1716
138 Ga0395900_0474810 3300037418 Bacteria 1204
139 Ga0395905_0238467 3300037471 Bacteria 1700
140 Ga0439462_0082315 3300042015 Bacteria 880
141 Ga0450914_010167 3300042118 Bacteria 904
142 Ga0439446_0017770 3300042156 Bacteria 1988
143 Ga0439434_0076850 3300042435 Unclassified 1056
144 Ga0439435_0006473 3300042436 Bacteria 2634
145 Ga0439464_0024492 3300042439 Bacteria 1669
146 Ga0439460_0032821 3300042461 Bacteria 1489
147 Ga0439460_0142016 3300042461 Unclassified 797
148 Ga0451577_0085303 3300042876 Bacteria 2817
149 Ga0495592_0076590 3300046454 Bacteria 2426
150 Ga0495651_0340651 3300046462 Unclassified 994
151 Ga0495628_0177777 3300046516 Bacteria 1611
152 Ga0495630_0665787 3300046517 Unclassified 797
153 Ga0495635_0237959 3300046663 Unclassified 1229
154 Ga0495599_0066692 3300046678 Bacteria 2248
155 Ga0495599_0240692 3300046678 Unclassified 1103
156 Ga0495658_0035596 3300046683 Bacteria 2741
157 Ga0495613_0125715 3300046689 Bacteria 1839
158 Ga0495674_0135362 3300047319 Bacteria 2074
159 Ga0495680_0479627 3300047322 Unclassified 847
160 Ga0496101_0094839 3300048904 Bacteria 2225
161 Ga0496101_0226347 3300048904 Bacteria 1453
162 Ga0496104_0112827 3300048907 Bacteria 2607
163 Ga0496105_0009321 3300048908 Bacteria 7674
164 Ga0496106_0211990 3300048909 Unclassified 1543
165 Ga0496108_0161958 3300048911 Bacteria 1934
166 Ga0496109_0001814 3300048912 Bacteria 17769
167 Ga0496109_0148305 3300048912 Bacteria 2195
168 Ga0496110_0002760 3300048913 Bacteria 13257
169 Ga0496110_0132764 3300048913 Bacteria 2249
170 Ga0496111_0023638 3300048914 Bacteria 4317
171 Ga0496112_0001902 3300048915 Bacteria 16471
172 Ga0496113_0180100 3300048916 Bacteria 1675
173 Ga0496114_0231997 3300048917 Bacteria 1622
174 Ga0501036_0042204 3300049572 Bacteria 3862
175 Ga0501036_0083529 3300049572 Bacteria 2700
176 Ga0501037_0123208 3300049573 Bacteria 1863
177 Ga0501039_0004451 3300049575 Bacteria 10577
178 Ga0501039_0108367 3300049575 Bacteria 2171
179 Ga0501039_0163297 3300049575 Unclassified 1751
180 Ga0501040_0028451 3300049576 Bacteria 3768
181 Ga0501040_0157096 3300049576 Unclassified 1606
182 Ga0501040_0396153 3300049576 Bacteria 991
183 Ga0501041_0024384 3300049577 Bacteria 3631
184 Ga0501041_0062852 3300049577 Bacteria 2274
185 Ga0501041_0154812 3300049577 Bacteria 1432
186 Ga0501041_0187195 3300049577 Unclassified 1296
187 Ga0501041_0267240 3300049577 Bacteria 1076
188 Ga0501042_0058556 3300049578 Bacteria 2750
189 Ga0501043_0088428 3300049579 Bacteria 2435
190 Ga0501046_0099359 3300049580 Bacteria 2234
191 Ga0501046_0323572 3300049580 Bacteria 1123
192 Ga0501047_0171090 3300049581 Bacteria 2041
193 Ga0501048_0030123 3300049582 Bacteria 3929
194 Ga0501048_0275085 3300049582 Unclassified 1197
195 Ga0501048_0285464 3300049582 Unclassified 1174
196 Ga0501048_0287522 3300049582 Bacteria 1169
197 Ga0501068_0305191 3300049584 Unclassified 1019
198 Ga0501071_0004268 3300049587 Bacteria 9052
199 Ga0501071_0026603 3300049587 Bacteria 4062
200 Ga0501071_0063996 3300049587 Bacteria 2668
201 Ga0501071_0286457 3300049587 Bacteria 1247
202 Ga0501071_0344827 3300049587 Bacteria 1133
203 Ga0501071_0519667 3300049587 Bacteria 913
204 Ga0501072_0007846 3300049588 Bacteria 8109
205 Ga0501072_0091031 3300049588 Bacteria 2421
206 Ga0501072_0187274 3300049588 Bacteria 1651
207 Ga0501072_0202108 3300049588 Bacteria 1584
208 Ga0501072_0243804 3300049588 Bacteria 1431
209 Ga0501074_0112856 3300049590 Bacteria 1945
210 Ga0501075_0010641 3300049591 Bacteria 6472
211 Ga0501075_0037839 3300049591 Bacteria 3606
212 Ga0501075_0050242 3300049591 Bacteria 3134
213 Ga0501075_0220909 3300049591 Bacteria 1445
214 Ga0501075_0381518 3300049591 Bacteria 1074
215 Ga0501076_0006812 3300049592 Bacteria 8292
216 Ga0501076_0053885 3300049592 Bacteria 3188
217 Ga0501076_0264828 3300049592 Bacteria 1407
218 Ga0501077_0067983 3300049593 Bacteria 2259
219 Ga0501227_069786 3300049665 Unclassified 911
220 Ga0501233_100526 3300049668 Bacteria 764
221 Ga0501079_0074908 3300049741 Bacteria 2617
222 Ga0501080_0173223 3300049742 Unclassified 1989
223 Ga0501080_0634434 3300049742 Unclassified 946
224 Ga0501081_0010046 3300049743 Bacteria 6172
225 Ga0501081_0019589 3300049743 Bacteria 4506
226 Ga0501081_0032006 3300049743 Bacteria 3566
227 Ga0501081_0101316 3300049743 Bacteria 2036
228 Ga0501083_0298194 3300049744 Unclassified 1048
229 Ga0501045_0023125 3300049824 Bacteria 4453
230 Ga0501045_0038331 3300049824 Bacteria 3485
231 Ga0501045_0315303 3300049824 Bacteria 1164
232 nmdc:mga0k408_142417_c1 3300050493 Unclassified 1426
233 nmdc:mga05p37_10431_c1 3300050507 Bacteria 11027
234 nmdc:mga05p37_39755_c1 3300050507 Bacteria 5775
235 nmdc:mga05p37_68282_c1 3300050507 Bacteria 4371
236 nmdc:mga09592_14256_c1 3300050508 Bacteria 6488
237 nmdc:mga0qj67_29215_c1 3300050509 Bacteria 4282
238 nmdc:mga0qj67_636440_c1 3300050509 Unclassified 852
239 nmdc:mga0qj67_8452_c1 3300050509 Bacteria 7639
240 nmdc:mga06r32_29273_c1 3300050510 Bacteria 5160
241 nmdc:mga06r32_372728_c1 3300050510 Unclassified 1411
242 nmdc:mga06r32_382784_c1 3300050510 Bacteria 1390
243 nmdc:mga06r32_60791_c1 3300050510 Bacteria 3636
244 nmdc:mga08y16_11136_c1 3300050511 Bacteria 9446
245 Ga0495601_0046124 3300053077 Bacteria 2743
246 Ga0501084_0020703 3300054114 Bacteria 5487
247 Ga0501084_0091438 3300054114 Bacteria 2555
248 Ga0501084_0190578 3300054114 Bacteria 1730
249 Ga0501084_0268894 3300054114 Bacteria 1439
250 Ga0590074_003428 3300059423 Bacteria 2617
251 Ga0590075_000115 3300059424 Bacteria 20695
252 Ga0590077_000614 3300059426 Bacteria 9614
253 Ga0501082_0089875 3300060353 Bacteria 2652
254 Ga0501082_0178946 3300060353 Bacteria 1844
255 Ga0501082_0716299 3300060353 Bacteria 876
256 Ga0530510_0002092 3300061734 Bacteria 13716
257 Ga0530510_1014380 3300061734 Bacteria 635

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049577 Ga0501041_0154812 Ga0501041_0154812_805_1419 172
2 3300049577 Ga0501041_0267240 Ga0501041_0267240_493_1065 176
3 3300061734 Ga0530510_1014380 Ga0530510_1014380_34_606 176
4 3300049587 Ga0501071_0519667 Ga0501071_0519667_23_607 181
5 3300047322 Ga0495680_0479627 Ga0495680_0479627_199_831 182
6 3300006844 Ga0075428_100020402 Ga0075428_1000204025 186
7 3300006846 Ga0075430_100422411 Ga0075430_1004224111 186
8 3300006847 Ga0075431_100890881 Ga0075431_1008908812 186
9 3300006880 Ga0075429_100010261 Ga0075429_1000102615 186
10 3300009094 Ga0111539_10127777 Ga0111539_101277771 186
11 3300009147 Ga0114129_10022615 Ga0114129_100226155 186
12 3300050507 nmdc:mga05p37_39755_c1 nmdc:mga05p37_39755_c1_2487_3185 186
13 3300050508 nmdc:mga09592_14256_c1 nmdc:mga09592_14256_c1_3594_4292 186
14 3300050507 nmdc:mga05p37_68282_c1 nmdc:mga05p37_68282_c1_1923_2537 188
15 3300050509 nmdc:mga0qj67_8452_c1 nmdc:mga0qj67_8452_c1_3628_4242 188
16 3300050510 nmdc:mga06r32_29273_c1 nmdc:mga06r32_29273_c1_276_890 188
17 3300026075 Ga0207708_10507491 Ga0207708_105074912 189
18 3300049576 Ga0501040_0157096 Ga0501040_0157096_190_858 189
19 3300049743 Ga0501081_0010046 Ga0501081_0010046_3192_3860 189
20 3300050510 nmdc:mga06r32_60791_c1 nmdc:mga06r32_60791_c1_44_676 189
21 3300054114 Ga0501084_0268894 Ga0501084_0268894_303_971 190
22 3300005331 Ga0070670_100017537 Ga0070670_1000175372 193
23 3300005335 Ga0070666_10253454 Ga0070666_102534542 193
24 3300005344 Ga0070661_100220590 Ga0070661_1002205902 193
25 3300005355 Ga0070671_100069479 Ga0070671_1000694793 193
26 3300005456 Ga0070678_100047666 Ga0070678_1000476664 193
27 3300005840 Ga0068870_10188311 Ga0068870_101883111 193
28 3300013296 Ga0157374_10709454 Ga0157374_107094541 193
29 3300025315 Ga0207697_10002911 Ga0207697_1000291111 193
30 3300025901 Ga0207688_10063750 Ga0207688_100637502 193
31 3300025920 Ga0207649_10182420 Ga0207649_101824201 193
32 3300025925 Ga0207650_10027000 Ga0207650_100270004 193
33 3300025931 Ga0207644_10050718 Ga0207644_100507184 193
34 3300025940 Ga0207691_10252043 Ga0207691_102520432 193
35 3300025945 Ga0207679_10114918 Ga0207679_101149184 193
36 3300026121 Ga0207683_10044232 Ga0207683_100442322 193
37 3300048913 Ga0496110_0132764 Ga0496110_0132764_1520_2212 193
38 3300031733 Ga0316577_10405567 Ga0316577_104055671 194
39 3300005340 Ga0070689_100401698 Ga0070689_1004016982 196
40 3300005367 Ga0070667_100992588 Ga0070667_1009925881 196
41 3300005459 Ga0068867_100032579 Ga0068867_1000325795 196
42 3300005843 Ga0068860_100746091 Ga0068860_1007460912 196
43 3300006881 Ga0068865_100274634 Ga0068865_1002746341 196
44 3300025936 Ga0207670_10237085 Ga0207670_102370852 196
45 3300025938 Ga0207704_10152417 Ga0207704_101524172 196
46 3300025986 Ga0207658_10888101 Ga0207658_108881011 196
47 3300026089 Ga0207648_10048137 Ga0207648_100481371 196
48 3300005339 Ga0070660_100188025 Ga0070660_1001880252 197
49 3300005344 Ga0070661_100128603 Ga0070661_1001286033 197
50 3300005366 Ga0070659_100127628 Ga0070659_1001276283 197
51 3300005563 Ga0068855_100456744 Ga0068855_1004567442 197
52 3300013104 Ga0157370_10582787 Ga0157370_105827871 197
53 3300013307 Ga0157372_10545986 Ga0157372_105459862 197
54 3300042461 Ga0439460_0142016 Ga0439460_0142016_73_768 201
55 3300031548 Ga0307408_100173259 Ga0307408_1001732592 202
56 3300031824 Ga0307413_10012068 Ga0307413_100120685 202
57 3300031852 Ga0307410_10007048 Ga0307410_100070488 202
58 3300031901 Ga0307406_10180006 Ga0307406_101800062 202
59 3300031903 Ga0307407_10003691 Ga0307407_100036914 202
60 3300031911 Ga0307412_10136498 Ga0307412_101364982 202
61 3300031995 Ga0307409_100033917 Ga0307409_1000339173 202
62 3300032002 Ga0307416_100086840 Ga0307416_1000868402 202
63 3300032005 Ga0307411_10020378 Ga0307411_100203783 202
64 3300032126 Ga0307415_100010400 Ga0307415_1000104007 202
65 3300049572 Ga0501036_0083529 Ga0501036_0083529_1210_1896 202
66 3300049575 Ga0501039_0108367 Ga0501039_0108367_534_1220 202
67 3300049577 Ga0501041_0187195 Ga0501041_0187195_219_905 202
68 3300049578 Ga0501042_0058556 Ga0501042_0058556_1365_2051 202
69 3300049582 Ga0501048_0030123 Ga0501048_0030123_704_1390 202
70 3300049584 Ga0501068_0305191 Ga0501068_0305191_39_725 202
71 3300049587 Ga0501071_0026603 Ga0501071_0026603_2638_3324 202
72 3300049588 Ga0501072_0091031 Ga0501072_0091031_1155_1841 202
73 3300049590 Ga0501074_0112856 Ga0501074_0112856_466_1152 202
74 3300049591 Ga0501075_0010641 Ga0501075_0010641_280_966 202
75 3300049742 Ga0501080_0173223 Ga0501080_0173223_599_1285 202
76 3300049743 Ga0501081_0101316 Ga0501081_0101316_211_897 202
77 3300049744 Ga0501083_0298194 Ga0501083_0298194_323_1009 202
78 3300049824 Ga0501045_0038331 Ga0501045_0038331_1869_2555 202
79 3300054114 Ga0501084_0020703 Ga0501084_0020703_580_1266 202
80 3300060353 Ga0501082_0089875 Ga0501082_0089875_82_768 202
81 3300042439 Ga0439464_0024492 Ga0439464_0024492_34_729 203
82 3300005334 Ga0068869_100564119 Ga0068869_1005641191 204
83 3300005355 Ga0070671_100568765 Ga0070671_1005687652 204
84 3300005530 Ga0070679_100664489 Ga0070679_1006644891 204
85 3300005539 Ga0068853_100644839 Ga0068853_1006448391 204
86 3300025931 Ga0207644_10526713 Ga0207644_105267131 204
87 3300005457 Ga0070662_100040542 Ga0070662_1000405422 205
88 3300010375 Ga0105239_10386432 Ga0105239_103864321 205
89 3300036401 Ga0373937_0237723 Ga0373937_0237723_115_801 205
90 3300046663 Ga0495635_0237959 Ga0495635_0237959_372_1058 205
91 3300048904 Ga0496101_0094839 Ga0496101_0094839_794_1483 205
92 3300048909 Ga0496106_0211990 Ga0496106_0211990_570_1259 205
93 3300048911 Ga0496108_0161958 Ga0496108_0161958_823_1506 205
94 3300048912 Ga0496109_0148305 Ga0496109_0148305_242_925 205
95 3300048916 Ga0496113_0180100 Ga0496113_0180100_726_1409 205
96 3300049580 Ga0501046_0323572 Ga0501046_0323572_297_965 205
97 3300049591 Ga0501075_0050242 Ga0501075_0050242_12_680 205
98 3300053077 Ga0495601_0046124 Ga0495601_0046124_596_1282 205
99 3300009177 Ga0105248_10312506 Ga0105248_103125062 206
100 3300025941 Ga0207711_10571326 Ga0207711_105713261 206
101 3300046454 Ga0495592_0076590 Ga0495592_0076590_1295_1978 206
102 3300046462 Ga0495651_0340651 Ga0495651_0340651_66_749 206
103 3300046516 Ga0495628_0177777 Ga0495628_0177777_501_1184 206
104 3300046517 Ga0495630_0665787 Ga0495630_0665787_25_699 206
105 3300046678 Ga0495599_0066692 Ga0495599_0066692_395_1069 206
106 3300046678 Ga0495599_0240692 Ga0495599_0240692_134_817 206
107 3300046683 Ga0495658_0035596 Ga0495658_0035596_1383_2057 206
108 3300046689 Ga0495613_0125715 Ga0495613_0125715_72_746 206
109 3300005331 Ga0070670_100418591 Ga0070670_1004185912 207
110 3300009176 Ga0105242_10215403 Ga0105242_102154032 207
111 3300009177 Ga0105248_10239554 Ga0105248_102395542 207
112 3300047319 Ga0495674_0135362 Ga0495674_0135362_783_1481 207
113 3300049824 Ga0501045_0315303 Ga0501045_0315303_282_971 207
114 3300031903 Ga0307407_10441091 Ga0307407_104410911 208
115 3300032002 Ga0307416_100249894 Ga0307416_1002498942 208
116 3300032005 Ga0307411_10182350 Ga0307411_101823503 208
117 3300049581 Ga0501047_0171090 Ga0501047_0171090_288_971 208
118 3300049588 Ga0501072_0187274 Ga0501072_0187274_153_836 208
119 3300049665 Ga0501227_069786 Ga0501227_069786_153_842 208
120 3300032002 Ga0307416_100114421 Ga0307416_1001144212 209
121 3300042435 Ga0439434_0076850 Ga0439434_0076850_189_881 209
122 3300005340 Ga0070689_100541854 Ga0070689_1005418542 210
123 3300005344 Ga0070661_100595693 Ga0070661_1005956931 210
124 3300005353 Ga0070669_100163950 Ga0070669_1001639502 210
125 3300005354 Ga0070675_100240502 Ga0070675_1002405022 210
126 3300005364 Ga0070673_100436015 Ga0070673_1004360152 210
127 3300005438 Ga0070701_10189869 Ga0070701_101898691 210
128 3300005564 Ga0070664_100092558 Ga0070664_1000925581 210
129 3300025923 Ga0207681_10106268 Ga0207681_101062682 210
130 3300025945 Ga0207679_10266240 Ga0207679_102662402 210
131 3300005441 Ga0070700_100187651 Ga0070700_1001876512 211
132 3300005549 Ga0070704_100500937 Ga0070704_1005009372 211
133 3300005718 Ga0068866_10351084 Ga0068866_103510842 211
134 3300006881 Ga0068865_100780721 Ga0068865_1007807211 211
135 3300014326 Ga0157380_11363848 Ga0157380_113638481 211
136 3300025899 Ga0207642_10339580 Ga0207642_103395802 211
137 3300048904 Ga0496101_0226347 Ga0496101_0226347_491_1177 211
138 3300048907 Ga0496104_0112827 Ga0496104_0112827_320_1006 211
139 3300049587 Ga0501071_0063996 Ga0501071_0063996_1796_2467 211
140 3300049588 Ga0501072_0202108 Ga0501072_0202108_317_988 211
141 3300054114 Ga0501084_0190578 Ga0501084_0190578_405_1076 211
142 3300060353 Ga0501082_0178946 Ga0501082_0178946_336_1007 211
143 3300005329 Ga0070683_100652671 Ga0070683_1006526711 212
144 3300005340 Ga0070689_100437879 Ga0070689_1004378791 212
145 3300005466 Ga0070685_10115039 Ga0070685_101150392 212
146 3300005563 Ga0068855_100500830 Ga0068855_1005008301 212
147 3300006846 Ga0075430_100034258 Ga0075430_1000342582 212
148 3300006852 Ga0075433_10721542 Ga0075433_107215421 212
149 3300006871 Ga0075434_100935956 Ga0075434_1009359561 212
150 3300009093 Ga0105240_10215277 Ga0105240_102152772 212
151 3300009551 Ga0105238_10577023 Ga0105238_105770231 212
152 3300013105 Ga0157369_10610213 Ga0157369_106102133 212
153 3300026088 Ga0207641_10266085 Ga0207641_102660853 212
154 3300031852 Ga0307410_10166964 Ga0307410_101669642 212
155 3300005290 Ga0065712_10069367 Ga0065712_100693675 213
156 3300005329 Ga0070683_100003335 Ga0070683_1000033355 213
157 3300005331 Ga0070670_100828290 Ga0070670_1008282901 213
158 3300005335 Ga0070666_10072120 Ga0070666_100721204 213
159 3300005340 Ga0070689_100154333 Ga0070689_1001543331 213
160 3300005344 Ga0070661_100079336 Ga0070661_1000793361 213
161 3300005354 Ga0070675_100367661 Ga0070675_1003676611 213
162 3300005535 Ga0070684_100000403 Ga0070684_1000004035 213
163 3300005564 Ga0070664_100008181 Ga0070664_1000081811 213
164 3300005614 Ga0068856_100467931 Ga0068856_1004679312 213
165 3300013296 Ga0157374_10177533 Ga0157374_101775331 213
166 3300025903 Ga0207680_10054776 Ga0207680_100547764 213
167 3300025920 Ga0207649_10051307 Ga0207649_100513071 213
168 3300025925 Ga0207650_10697607 Ga0207650_106976071 213
169 3300025941 Ga0207711_10043038 Ga0207711_100430385 213
170 3300025944 Ga0207661_10007418 Ga0207661_100074183 213
171 3300025945 Ga0207679_10045507 Ga0207679_100455073 213
172 3300026078 Ga0207702_10526113 Ga0207702_105261132 213
173 3300031548 Ga0307408_100121601 Ga0307408_1001216012 213
174 3300031903 Ga0307407_10182316 Ga0307407_101823162 213
175 3300031911 Ga0307412_10067504 Ga0307412_100675042 213
176 3300032002 Ga0307416_100140450 Ga0307416_1001404503 213
177 3300032126 Ga0307415_100267097 Ga0307415_1002670972 213
178 3300037418 Ga0395900_0474810 Ga0395900_0474810_481_1161 213
179 3300037471 Ga0395905_0238467 Ga0395905_0238467_56_736 213
180 3300042015 Ga0439462_0082315 Ga0439462_0082315_57_776 213
181 3300042156 Ga0439446_0017770 Ga0439446_0017770_1109_1828 213
182 3300048908 Ga0496105_0009321 Ga0496105_0009321_6237_6914 213
183 3300048912 Ga0496109_0001814 Ga0496109_0001814_10684_11361 213
184 3300048913 Ga0496110_0002760 Ga0496110_0002760_2544_3221 213
185 3300048914 Ga0496111_0023638 Ga0496111_0023638_2122_2799 213
186 3300048915 Ga0496112_0001902 Ga0496112_0001902_7985_8662 213
187 3300048917 Ga0496114_0231997 Ga0496114_0231997_334_1011 213
188 3300049576 Ga0501040_0396153 Ga0501040_0396153_197_895 213
189 3300049582 Ga0501048_0275085 Ga0501048_0275085_47_745 213
190 3300049587 Ga0501071_0286457 Ga0501071_0286457_420_1118 213
191 3300049591 Ga0501075_0220909 Ga0501075_0220909_666_1364 213
192 3300049592 Ga0501076_0264828 Ga0501076_0264828_214_912 213
193 3300049668 Ga0501233_100526 Ga0501233_100526_22_726 213
194 3300060353 Ga0501082_0716299 Ga0501082_0716299_135_833 213
195 3300003693 Ga0032354_1007197 Ga0032354_10071972 214
196 3300005439 Ga0070711_100190388 Ga0070711_1001903882 214
197 3300006195 Ga0075366_10253770 Ga0075366_102537702 214
198 3300006844 Ga0075428_100013190 Ga0075428_10001319012 214
199 3300006844 Ga0075428_100044206 Ga0075428_1000442063 214
200 3300006844 Ga0075428_100215586 Ga0075428_1002155862 214
201 3300006846 Ga0075430_100012910 Ga0075430_1000129105 214
202 3300006846 Ga0075430_100014097 Ga0075430_1000140974 214
203 3300006846 Ga0075430_100021276 Ga0075430_1000212766 214
204 3300006847 Ga0075431_100044587 Ga0075431_1000445874 214
205 3300006847 Ga0075431_100075512 Ga0075431_1000755122 214
206 3300006847 Ga0075431_100093423 Ga0075431_1000934232 214
207 3300006880 Ga0075429_100047529 Ga0075429_1000475293 214
208 3300006880 Ga0075429_100100840 Ga0075429_1001008402 214
209 3300009094 Ga0111539_10002839 Ga0111539_1000283911 214
210 3300009147 Ga0114129_10019579 Ga0114129_100195793 214
211 3300009147 Ga0114129_10038959 Ga0114129_100389594 214
212 3300009147 Ga0114129_10217318 Ga0114129_102173182 214
213 3300027682 Ga0209971_1015178 Ga0209971_10151783 214
214 3300027907 Ga0207428_10000353 Ga0207428_1000035342 214
215 3300031995 Ga0307409_100093492 Ga0307409_1000934924 214
216 3300032004 Ga0307414_10240597 Ga0307414_102405972 214
217 3300042118 Ga0450914_010167 Ga0450914_010167_124_804 214
218 3300042436 Ga0439435_0006473 Ga0439435_0006473_1894_2574 214
219 3300042461 Ga0439460_0032821 Ga0439460_0032821_628_1320 214
220 3300042876 Ga0451577_0085303 Ga0451577_0085303_1731_2420 214
221 3300049572 Ga0501036_0042204 Ga0501036_0042204_2494_3237 214
222 3300049573 Ga0501037_0123208 Ga0501037_0123208_326_1069 214
223 3300049575 Ga0501039_0004451 Ga0501039_0004451_8152_8895 214
224 3300049575 Ga0501039_0163297 Ga0501039_0163297_839_1528 214
225 3300049576 Ga0501040_0028451 Ga0501040_0028451_1235_1978 214
226 3300049577 Ga0501041_0024384 Ga0501041_0024384_2715_3458 214
227 3300049577 Ga0501041_0062852 Ga0501041_0062852_1400_2089 214
228 3300049579 Ga0501043_0088428 Ga0501043_0088428_973_1716 214
229 3300049580 Ga0501046_0099359 Ga0501046_0099359_422_1165 214
230 3300049582 Ga0501048_0285464 Ga0501048_0285464_171_914 214
231 3300049582 Ga0501048_0287522 Ga0501048_0287522_366_1055 214
232 3300049587 Ga0501071_0004268 Ga0501071_0004268_3738_4481 214
233 3300049587 Ga0501071_0344827 Ga0501071_0344827_169_990 214
234 3300049588 Ga0501072_0007846 Ga0501072_0007846_32_775 214
235 3300049588 Ga0501072_0243804 Ga0501072_0243804_400_1089 214
236 3300049591 Ga0501075_0037839 Ga0501075_0037839_308_1051 214
237 3300049591 Ga0501075_0381518 Ga0501075_0381518_224_913 214
238 3300049592 Ga0501076_0006812 Ga0501076_0006812_1334_2023 214
239 3300049592 Ga0501076_0053885 Ga0501076_0053885_2092_2835 214
240 3300049593 Ga0501077_0067983 Ga0501077_0067983_222_965 214
241 3300049741 Ga0501079_0074908 Ga0501079_0074908_855_1544 214
242 3300049742 Ga0501080_0634434 Ga0501080_0634434_106_849 214
243 3300049743 Ga0501081_0019589 Ga0501081_0019589_2484_3227 214
244 3300049743 Ga0501081_0032006 Ga0501081_0032006_1389_2078 214
245 3300049824 Ga0501045_0023125 Ga0501045_0023125_87_830 214
246 3300050493 nmdc:mga0k408_142417_c1 nmdc:mga0k408_142417_c1_229_939 214
247 3300050507 nmdc:mga05p37_10431_c1 nmdc:mga05p37_10431_c1_7534_8247 214
248 3300050509 nmdc:mga0qj67_29215_c1 nmdc:mga0qj67_29215_c1_1745_2458 214
249 3300050509 nmdc:mga0qj67_636440_c1 nmdc:mga0qj67_636440_c1_34_729 214
250 3300050510 nmdc:mga06r32_372728_c1 nmdc:mga06r32_372728_c1_124_819 214
251 3300050510 nmdc:mga06r32_382784_c1 nmdc:mga06r32_382784_c1_554_1267 214
252 3300050511 nmdc:mga08y16_11136_c1 nmdc:mga08y16_11136_c1_7234_7929 214
253 3300054114 Ga0501084_0091438 Ga0501084_0091438_224_913 214
254 3300059423 Ga0590074_003428 Ga0590074_003428_394_1077 214
255 3300059424 Ga0590075_000115 Ga0590075_000115_11180_11863 214
256 3300059426 Ga0590077_000614 Ga0590077_000614_38_721 214
257 3300061734 Ga0530510_0002092 Ga0530510_0002092_3845_4588 214

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18919

DUF5670

Family of unknown function (DUF5670)

1

33

0.97

PF10173

Mit_KHE1

Mitochondrial K+-H+ exchange-related

40

213

0.78

Feature Viewer

pLDDT pTM Quality
61.08 0.49 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map