F367403

General Info

Members Datasets Scaffolds Average Seq Length
257 176 514 246

Family's Representative Sequence

Representative Sequence 3300031456|Ga0307513_10008792|Ga0307513_1000879213
Length 285
Sequence MTTRTVQALIDPHREDIGVNAPIKSALPGREGDRLAGKVALVTGIGAGIGRACARLFAQQGARVFGCDIDAAAAQATVEAAAAQGLALHSLHPCDLTAPGQARHVVEQAVQLHGGIDIVVNAAAFGAFAWFDEMDHAAWRKTLVGELDIVFLACQAVWPQLIARGGGSVINFASVSARMAMPLLPAVAHSAGKGGVLAMSRQLAMEGAPHGIRVNTISPALVQTAATQHPLDNVAGFREQVMSKLMLKRLGQPEDVAWCAVYLASDEASWVTAADFAIDAGATAW

Samples

Sample ID Description Type Environment
1 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
13 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
31 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
32 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
33 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
34 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
35 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
36 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
50 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
51 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
54 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
57 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
82 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
83 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
84 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
85 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
86 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
87 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
88 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
89 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
90 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
91 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
92 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
93 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
94 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
95 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
96 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
97 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
98 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
99 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
101 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
102 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
103 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
104 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
105 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
106 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
107 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
108 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
109 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
110 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
111 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
112 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
113 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
114 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
115 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
116 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
117 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
118 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
119 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
120 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
121 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
122 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
123 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
124 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
125 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
126 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
127 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
128 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
129 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
130 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
131 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
132 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
133 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
134 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
135 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
136 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
137 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
138 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
139 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
140 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
141 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
142 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
143 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
144 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
145 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
146 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
147 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
148 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
149 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
150 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
154 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
155 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
156 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
157 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
158 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
159 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
160 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
161 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
162 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
163 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
164 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
165 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
166 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
167 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
168 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
169 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
170 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
171 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
172 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
173 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
174 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
175 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
176 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.61
Metatranscriptomes 1.17
Isolates 6.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.23
Nodule 0.78
Rhizoplane 2.33
Rhizosphere 73.15
Stem 0
Stem Tuber 0
Unclassified 5.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307513_10008792 3300031456 Bacteria 12862
2 JGI24736J21556_1000059 3300001904 Bacteria 18112
3 JGI24736J21556_1001950 3300001904 Bacteria 3670
4 JGI24741J21665_1000068 3300001915 Bacteria 25347
5 JGI24741J21665_1001001 3300001915 Bacteria 8482
6 JGI24740J21852_10001360 3300001979 Bacteria 11160
7 JGI24740J21852_10009901 3300001979 Bacteria 3700
8 JGI24737J22298_10007289 3300001990 Bacteria 3738
9 JGI24737J22298_10062276 3300001990 Bacteria 1121
10 JGI24735J21928_10005197 3300002067 Bacteria 4330
11 JGI24738J21930_10001771 3300002075 Bacteria 5884
12 JGI24738J21930_10006285 3300002075 Bacteria 2797
13 JGI25156J39149_1014684 3300002705 Bacteria 1601
14 JGI25153J46596_10008544 3300003215 Bacteria 4881
15 rootH1_10058872 3300003316 Bacteria 9634
16 rootL2_10060416 3300003322 Bacteria 28530
17 Ga0055535_1000052 3300003761 Bacteria 132513
18 Ga0055529_1000239 3300003763 Bacteria 68765
19 Ga0055530_10023833 3300003791 Bacteria 1750
20 Ga0070658_10000180 3300005327 Bacteria 55242
21 Ga0070658_10009883 3300005327 Bacteria 7665
22 Ga0070660_100013899 3300005339 Bacteria 5791
23 Ga0070660_100160514 3300005339 Unclassified 1811
24 Ga0070661_100016319 3300005344 Bacteria 5249
25 Ga0070663_100010890 3300005455 Bacteria 5682
26 Ga0070663_100678356 3300005455 Bacteria 874
27 Ga0070698_100116149 3300005471 Bacteria 2640
28 Ga0070665_100027445 3300005548 Bacteria 5735
29 Ga0068855_100062069 3300005563 Bacteria 4364
30 Ga0070664_100035255 3300005564 Bacteria 4200
31 Ga0068854_100000459 3300005578 Bacteria 25127
32 Ga0068856_100013450 3300005614 Bacteria 7921
33 Ga0068852_100000231 3300005616 Bacteria 37728
34 Ga0068864_100386069 3300005618 Bacteria 1328
35 Ga0068861_100220605 3300005719 Bacteria 1602
36 Ga0068861_100561826 3300005719 Bacteria 1041
37 Ga0068851_10042616 3300005834 Bacteria 2285
38 Ga0068851_10052933 3300005834 Bacteria 2065
39 Ga0068851_10071769 3300005834 Unclassified 1792
40 Ga0068862_100003586 3300005844 Bacteria 13290
41 Ga0075432_10004880 3300006058 Bacteria 4565
42 Ga0075362_10143503 3300006177 Bacteria 1142
43 Ga0075370_10073887 3300006353 Bacteria 1953
44 Ga0079104_1057640 3300006946 Bacteria 846
45 Ga0099794_10035490 3300007265 Bacteria 2354
46 Ga0099795_10000501 3300007788 Bacteria 7366
47 Ga0105250_10151523 3300009092 Bacteria 965
48 Ga0105240_10012850 3300009093 Bacteria 11536
49 Ga0105240_10014876 3300009093 Bacteria 10603
50 Ga0105240_10337584 3300009093 Bacteria 1712
51 Ga0105240_10594478 3300009093 Unclassified 1219
52 Ga0105241_10000903 3300009174 Bacteria 22440
53 Ga0105248_10004370 3300009177 Bacteria 15640
54 Ga0105237_10076868 3300009545 Bacteria 3329
55 Ga0105237_10247601 3300009545 Bacteria 1784
56 Ga0105238_10070766 3300009551 Bacteria 3487
57 Ga0105238_10183733 3300009551 Unclassified 2068
58 Ga0105238_10208929 3300009551 Bacteria 1928
59 Ga0099796_10004497 3300010159 Bacteria 3382
60 Ga0105239_10279378 3300010375 Bacteria 1879
61 Ga0105239_11142443 3300010375 Bacteria 897
62 Ga0157373_10030401 3300013100 Bacteria 3887
63 Ga0157373_10031020 3300013100 Bacteria 3847
64 Ga0157373_10039862 3300013100 Bacteria 3362
65 Ga0157371_10000111 3300013102 Bacteria 123977
66 Ga0157371_10093202 3300013102 Bacteria 2134
67 Ga0157370_10006543 3300013104 Bacteria 12831
68 Ga0157370_10350461 3300013104 Bacteria 1361
69 Ga0157369_10008707 3300013105 Bacteria 11637
70 Ga0157369_10686351 3300013105 Unclassified 1055
71 Ga0157372_10024644 3300013307 Bacteria 6539
72 Ga0157372_10072472 3300013307 Bacteria 3882
73 Ga0182008_10039689 3300014497 Bacteria 2352
74 Ga0157379_10154965 3300014968 Bacteria 2066
75 Ga0157379_10589465 3300014968 Bacteria 1037
76 Ga0209258_100074 3300025242 Bacteria 271062
77 Ga0209148_1013406 3300025254 Bacteria 1475
78 Ga0209759_1000123 3300025256 Bacteria 137819
79 Ga0209759_1002215 3300025256 Bacteria 8882
80 Ga0209455_1000066 3300025272 Bacteria 316811
81 Ga0209050_1003321 3300025298 Bacteria 12015
82 Ga0207426_1014377 3300025302 Bacteria 2900
83 Ga0209257_1003504 3300025304 Bacteria 13364
84 Ga0207656_10009418 3300025321 Unclassified 3628
85 Ga0207656_10013476 3300025321 Bacteria 3127
86 Ga0207656_10035157 3300025321 Bacteria 2096
87 Ga0207647_10006230 3300025904 Bacteria 8691
88 Ga0207647_10022138 3300025904 Bacteria 4227
89 Ga0207705_10000004 3300025909 Bacteria 705756
90 Ga0207705_10000228 3300025909 Bacteria 55776
91 Ga0207654_10000534 3300025911 Bacteria 21724
92 Ga0207654_10030983 3300025911 Unclassified 2942
93 Ga0207695_10012817 3300025913 Bacteria 10041
94 Ga0207695_10023634 3300025913 Bacteria 6936
95 Ga0207695_10072671 3300025913 Bacteria 3508
96 Ga0207695_10083811 3300025913 Plasmid 3220
97 Ga0207671_10001418 3300025914 Bacteria 27830
98 Ga0207693_10553572 3300025915 Bacteria 897
99 Ga0207657_10000465 3300025919 Bacteria 42880
100 Ga0207649_10007501 3300025920 Bacteria 5930
101 Ga0207694_10002689 3300025924 Bacteria 14378
102 Ga0207694_10014531 3300025924 Bacteria 5936
103 Ga0207694_10095294 3300025924 Bacteria 2352
104 Ga0207690_10014957 3300025932 Bacteria 4698
105 Ga0207711_10005041 3300025941 Bacteria 11197
106 Ga0207667_10000004 3300025949 Bacteria 737718
107 Ga0207667_10000603 3300025949 Bacteria 46518
108 Ga0207667_10011650 3300025949 Bacteria 10205
109 Ga0207640_10000508 3300025981 Bacteria 23527
110 Ga0207640_10018543 3300025981 Bacteria 4091
111 Ga0207640_10086993 3300025981 Bacteria 2153
112 Ga0207640_10131963 3300025981 Bacteria 1807
113 Ga0207639_10001050 3300026041 Bacteria 18776
114 Ga0207639_10002672 3300026041 Bacteria 11975
115 Ga0207678_10000851 3300026067 Bacteria 28009
116 Ga0207678_10008944 3300026067 Bacteria 8818
117 Ga0207678_10027504 3300026067 Bacteria 4963
118 Ga0207678_10216871 3300026067 Bacteria 1637
119 Ga0207702_10000723 3300026078 Bacteria 35400
120 Ga0207702_10010038 3300026078 Bacteria 7938
121 Ga0207702_10039474 3300026078 Bacteria 3955
122 Ga0207676_10221878 3300026095 Bacteria 1684
123 Ga0207674_10415552 3300026116 Unclassified 1300
124 Ga0207698_10000058 3300026142 Bacteria 78048
125 Ga0207698_10005498 3300026142 Bacteria 7840
126 Ga0207698_10036831 3300026142 Unclassified 3596
127 Ga0209179_1004167 3300027512 Bacteria 2160
128 Ga0209588_1056210 3300027671 Bacteria 1272
129 Ga0268266_10006099 3300028379 Bacteria 11100
130 Ga0265334_10005846 3300028573 Bacteria 5356
131 Ga0307515_10000257 3300028794 Bacteria 131732
132 Ga0307515_10000358 3300028794 Bacteria 112133
133 Ga0307515_10061581 3300028794 Bacteria 5319
134 Ga0265762_1024771 3300030760 Bacteria 1117
135 Ga0265760_10000016 3300031090 Bacteria 89697
136 Ga0265760_10082074 3300031090 Bacteria 1000
137 Ga0265316_10297030 3300031344 Unclassified 1177
138 Ga0307513_10007577 3300031456 Bacteria 14030
139 Ga0307513_10167937 3300031456 Bacteria 2075
140 Ga0307408_100009563 3300031548 Bacteria 6396
141 Ga0307508_10130696 3300031616 Bacteria 2114
142 Ga0307405_10018376 3300031731 Bacteria 3855
143 Ga0307413_10000754 3300031824 Bacteria 11163
144 Ga0307413_10457950 3300031824 Bacteria 1014
145 Ga0307406_10153549 3300031901 Bacteria 1645
146 Ga0307412_10043613 3300031911 Bacteria 2921
147 Ga0307409_100171199 3300031995 Bacteria 1911
148 Ga0307409_100655412 3300031995 Bacteria 1044
149 Ga0307416_100024533 3300032002 Bacteria 4404
150 Ga0307416_100043901 3300032002 Bacteria 3505
151 Ga0307414_10011682 3300032004 Bacteria 5161
152 Ga0307414_10737483 3300032004 Bacteria 894
153 Ga0307411_10029961 3300032005 Bacteria 3330
154 Ga0307411_10041291 3300032005 Bacteria 2934
155 Ga0307510_10000017 3300033180 Bacteria 195521
156 Ga0373962_0088558 3300035242 Bacteria 950
157 Ga0373931_0024623 3300035691 Bacteria 3052
158 Ga0373931_0184090 3300035691 Bacteria 1239
159 Ga0373925_0016731 3300037068 Bacteria 5311
160 Ga0395898_0030092 3300037466 Bacteria 5436
161 Ga0395905_0005798 3300037471 Bacteria 12545
162 Ga0400487_62830 3300039110 Bacteria 1076
163 Ga0439438_042473 3300041405 Bacteria 1176
164 Ga0450891_001701 3300042129 Bacteria 2262
165 Ga0450894_002926 3300042131 Bacteria 2265
166 Ga0450898_000809 3300042134 Bacteria 3869
167 Ga0439446_0022352 3300042156 Bacteria 1792
168 Ga0439458_0036711 3300042157 Bacteria 1180
169 Ga0450916_019877 3300042530 Bacteria 915
170 Ga0450893_0017513 3300042532 Bacteria 1217
171 Ga0495627_016454 3300046453 Bacteria 2530
172 Ga0495638_0000074 3300046460 Bacteria 163843
173 Ga0495638_0035643 3300046460 Unclassified 3171
174 Ga0495580_0138286 3300046472 Bacteria 1689
175 Ga0495605_0062375 3300046474 Unclassified 1781
176 Ga0495585_0096919 3300046492 Bacteria 1582
177 Ga0495596_0002742 3300046500 Bacteria 9247
178 Ga0495583_0000275 3300046506 Bacteria 83178
179 Ga0495583_0121312 3300046506 Bacteria 1100
180 Ga0495606_0019706 3300046507 Bacteria 5005
181 Ga0495610_0000022 3300046512 Bacteria 317107
182 Ga0495610_0002224 3300046512 Bacteria 16409
183 Ga0495610_0012897 3300046512 Bacteria 4999
184 Ga0495620_0000620 3300046515 Bacteria 22120
185 Ga0495632_0000001 3300046519 Bacteria 873295
186 Ga0495632_0000813 3300046519 Bacteria 27616
187 Ga0495643_0026721 3300046522 Bacteria 3252
188 Ga0495643_0028440 3300046522 Bacteria 3134
189 Ga0495648_0000050 3300046524 Bacteria 163843
190 Ga0495648_0012776 3300046524 Bacteria 6237
191 Ga0495652_0112666 3300046529 Bacteria 2185
192 Ga0495633_0000208 3300046558 Bacteria 74469
193 Ga0495633_0019735 3300046558 Bacteria 3404
194 Ga0495668_0032568 3300046616 Bacteria 2932
195 Ga0495625_0019959 3300046660 Bacteria 5183
196 Ga0495671_0000096 3300046692 Bacteria 82384
197 Ga0495687_062082 3300047443 Unclassified 1535
198 Ga0495673_0000157 3300047469 Bacteria 117733
199 Ga0495686_0023752 3300047472 Bacteria 4038
200 Ga0495615_0000002 3300048090 Bacteria 167871
201 Ga0495626_0000852 3300048091 Bacteria 27166
202 Ga0496100_0146044 3300048903 Bacteria 1682
203 Ga0496101_0163197 3300048904 Bacteria 1710
204 Ga0496102_0017674 3300048905 Bacteria 6251
205 Ga0496103_0126600 3300048906 Bacteria 1629
206 Ga0496105_0199598 3300048908 Bacteria 1633
207 Ga0496106_0366619 3300048909 Bacteria 1157
208 Ga0496116_0000093 3300048919 Bacteria 205660
209 Ga0496117_0000110 3300048920 Bacteria 184627
210 Ga0496117_0259022 3300048920 Bacteria 944
211 Ga0496118_0000170 3300048921 Bacteria 117661
212 Ga0496118_0093011 3300048921 Bacteria 2067
213 Ga0496120_0121806 3300048923 Bacteria 1347
214 Ga0496121_0004428 3300048924 Bacteria 18910
215 Ga0496121_0122759 3300048924 Unclassified 1958
216 Ga0496122_0000702 3300048925 Bacteria 66240
217 Ga0496122_0010843 3300048925 Bacteria 9330
218 Ga0496123_0000914 3300048926 Bacteria 46373
219 Ga0496123_0039927 3300048926 Bacteria 3278
220 Ga0496124_0008549 3300048927 Bacteria 10687
221 Ga0496124_0092490 3300048927 Bacteria 2463
222 Ga0496124_0151203 3300048927 Bacteria 1820
223 Ga0496124_0237834 3300048927 Unclassified 1356
224 Ga0496125_0000373 3300048928 Bacteria 84239
225 Ga0496125_0008193 3300048928 Bacteria 10996
226 Ga0496125_0030387 3300048928 Bacteria 4834
227 Ga0496126_0000512 3300048929 Bacteria 75587
228 Ga0496126_0060444 3300048929 Bacteria 3407
229 Ga0496126_0147975 3300048929 Bacteria 2015
230 Ga0501034_0227256 3300049571 Bacteria 1816
231 Ga0501038_0119642 3300049574 Bacteria 2174
232 Ga0501038_0422565 3300049574 Bacteria 1028
233 Ga0501047_0165029 3300049581 Bacteria 2085
234 Ga0501073_0058593 3300049589 Bacteria 2691
235 Ga0501079_0155482 3300049741 Bacteria 1783
236 Ga0501044_0237581 3300049823 Bacteria 1767
237 nmdc:mga03683_22872_c1 3300050489 Bacteria 2427
238 nmdc:mga0sz30_156376_c1 3300050516 Bacteria 1009
239 Ga0500583_0120886 3300053092 Bacteria 1295
240 Ga0500611_005422 3300053727 Bacteria 1794
241 Ga0501082_0587005 3300060353 Bacteria 975
242 2511822809 2511231156 Bacteria 6845832
243 2585264122 2582581305 Bacteria 4895574
244 2738712963 2738541275 Bacteria 4830863
245 2738851387 2738541301 Bacteria 4834102
246 2738867117 2738541304 Bacteria 4833665
247 2739299634 2738543022 Bacteria 4835059
248 2739361313 2738543033 Bacteria 4833336
249 2856745594 2856741275 Bacteria 8096094
250 2862289269 2862281513 Bacteria 9621493
251 2874171059 2874168670 Bacteria 8062617
252 2919139507 2919138771 Bacteria 5281312
253 2928103582 2928100450 Bacteria 4837635
254 2928963273 2928959182 Bacteria 4725774
255 2971414565 2971410472 Bacteria 8311090
256 8056537843 8056533031 Bacteria 8964429
257 8057348869 8057345674 Bacteria 4160394
258 Ga0307513_10008792
259 JGI24736J21556_1000059
260 JGI24736J21556_1001950
261 JGI24741J21665_1000068
262 JGI24741J21665_1001001
263 JGI24740J21852_10001360
264 JGI24740J21852_10009901
265 JGI24737J22298_10007289
266 JGI24737J22298_10062276
267 JGI24735J21928_10005197
268 JGI24738J21930_10001771
269 JGI24738J21930_10006285
270 JGI25156J39149_1014684
271 JGI25153J46596_10008544
272 rootH1_10058872
273 rootL2_10060416
274 Ga0055535_1000052
275 Ga0055529_1000239
276 Ga0055530_10023833
277 Ga0070658_10000180
278 Ga0070658_10009883
279 Ga0070660_100013899
280 Ga0070660_100160514
281 Ga0070661_100016319
282 Ga0070663_100010890
283 Ga0070663_100678356
284 Ga0070698_100116149
285 Ga0070665_100027445
286 Ga0068855_100062069
287 Ga0070664_100035255
288 Ga0068854_100000459
289 Ga0068856_100013450
290 Ga0068852_100000231
291 Ga0068864_100386069
292 Ga0068861_100220605
293 Ga0068861_100561826
294 Ga0068851_10042616
295 Ga0068851_10052933
296 Ga0068851_10071769
297 Ga0068862_100003586
298 Ga0075432_10004880
299 Ga0075362_10143503
300 Ga0075370_10073887
301 Ga0079104_1057640
302 Ga0099794_10035490
303 Ga0099795_10000501
304 Ga0105250_10151523
305 Ga0105240_10012850
306 Ga0105240_10014876
307 Ga0105240_10337584
308 Ga0105240_10594478
309 Ga0105241_10000903
310 Ga0105248_10004370
311 Ga0105237_10076868
312 Ga0105237_10247601
313 Ga0105238_10070766
314 Ga0105238_10183733
315 Ga0105238_10208929
316 Ga0099796_10004497
317 Ga0105239_10279378
318 Ga0105239_11142443
319 Ga0157373_10030401
320 Ga0157373_10031020
321 Ga0157373_10039862
322 Ga0157371_10000111
323 Ga0157371_10093202
324 Ga0157370_10006543
325 Ga0157370_10350461
326 Ga0157369_10008707
327 Ga0157369_10686351
328 Ga0157372_10024644
329 Ga0157372_10072472
330 Ga0182008_10039689
331 Ga0157379_10154965
332 Ga0157379_10589465
333 Ga0209258_100074
334 Ga0209148_1013406
335 Ga0209759_1000123
336 Ga0209759_1002215
337 Ga0209455_1000066
338 Ga0209050_1003321
339 Ga0207426_1014377
340 Ga0209257_1003504
341 Ga0207656_10009418
342 Ga0207656_10013476
343 Ga0207656_10035157
344 Ga0207647_10006230
345 Ga0207647_10022138
346 Ga0207705_10000004
347 Ga0207705_10000228
348 Ga0207654_10000534
349 Ga0207654_10030983
350 Ga0207695_10012817
351 Ga0207695_10023634
352 Ga0207695_10072671
353 Ga0207695_10083811
354 Ga0207671_10001418
355 Ga0207693_10553572
356 Ga0207657_10000465
357 Ga0207649_10007501
358 Ga0207694_10002689
359 Ga0207694_10014531
360 Ga0207694_10095294
361 Ga0207690_10014957
362 Ga0207711_10005041
363 Ga0207667_10000004
364 Ga0207667_10000603
365 Ga0207667_10011650
366 Ga0207640_10000508
367 Ga0207640_10018543
368 Ga0207640_10086993
369 Ga0207640_10131963
370 Ga0207639_10001050
371 Ga0207639_10002672
372 Ga0207678_10000851
373 Ga0207678_10008944
374 Ga0207678_10027504
375 Ga0207678_10216871
376 Ga0207702_10000723
377 Ga0207702_10010038
378 Ga0207702_10039474
379 Ga0207676_10221878
380 Ga0207674_10415552
381 Ga0207698_10000058
382 Ga0207698_10005498
383 Ga0207698_10036831
384 Ga0209179_1004167
385 Ga0209588_1056210
386 Ga0268266_10006099
387 Ga0265334_10005846
388 Ga0307515_10000257
389 Ga0307515_10000358
390 Ga0307515_10061581
391 Ga0265762_1024771
392 Ga0265760_10000016
393 Ga0265760_10082074
394 Ga0265316_10297030
395 Ga0307513_10007577
396 Ga0307513_10167937
397 Ga0307408_100009563
398 Ga0307508_10130696
399 Ga0307405_10018376
400 Ga0307413_10000754
401 Ga0307413_10457950
402 Ga0307406_10153549
403 Ga0307412_10043613
404 Ga0307409_100171199
405 Ga0307409_100655412
406 Ga0307416_100024533
407 Ga0307416_100043901
408 Ga0307414_10011682
409 Ga0307414_10737483
410 Ga0307411_10029961
411 Ga0307411_10041291
412 Ga0307510_10000017
413 Ga0373962_0088558
414 Ga0373931_0024623
415 Ga0373931_0184090
416 Ga0373925_0016731
417 Ga0395898_0030092
418 Ga0395905_0005798
419 Ga0400487_62830
420 Ga0439438_042473
421 Ga0450891_001701
422 Ga0450894_002926
423 Ga0450898_000809
424 Ga0439446_0022352
425 Ga0439458_0036711
426 Ga0450916_019877
427 Ga0450893_0017513
428 Ga0495627_016454
429 Ga0495638_0000074
430 Ga0495638_0035643
431 Ga0495580_0138286
432 Ga0495605_0062375
433 Ga0495585_0096919
434 Ga0495596_0002742
435 Ga0495583_0000275
436 Ga0495583_0121312
437 Ga0495606_0019706
438 Ga0495610_0000022
439 Ga0495610_0002224
440 Ga0495610_0012897
441 Ga0495620_0000620
442 Ga0495632_0000001
443 Ga0495632_0000813
444 Ga0495643_0026721
445 Ga0495643_0028440
446 Ga0495648_0000050
447 Ga0495648_0012776
448 Ga0495652_0112666
449 Ga0495633_0000208
450 Ga0495633_0019735
451 Ga0495668_0032568
452 Ga0495625_0019959
453 Ga0495671_0000096
454 Ga0495687_062082
455 Ga0495673_0000157
456 Ga0495686_0023752
457 Ga0495615_0000002
458 Ga0495626_0000852
459 Ga0496100_0146044
460 Ga0496101_0163197
461 Ga0496102_0017674
462 Ga0496103_0126600
463 Ga0496105_0199598
464 Ga0496106_0366619
465 Ga0496116_0000093
466 Ga0496117_0000110
467 Ga0496117_0259022
468 Ga0496118_0000170
469 Ga0496118_0093011
470 Ga0496120_0121806
471 Ga0496121_0004428
472 Ga0496121_0122759
473 Ga0496122_0000702
474 Ga0496122_0010843
475 Ga0496123_0000914
476 Ga0496123_0039927
477 Ga0496124_0008549
478 Ga0496124_0092490
479 Ga0496124_0151203
480 Ga0496124_0237834
481 Ga0496125_0000373
482 Ga0496125_0008193
483 Ga0496125_0030387
484 Ga0496126_0000512
485 Ga0496126_0060444
486 Ga0496126_0147975
487 Ga0501034_0227256
488 Ga0501038_0119642
489 Ga0501038_0422565
490 Ga0501047_0165029
491 Ga0501073_0058593
492 Ga0501079_0155482
493 Ga0501044_0237581
494 nmdc:mga03683_22872_c1
495 nmdc:mga0sz30_156376_c1
496 Ga0500583_0120886
497 Ga0500611_005422
498 Ga0501082_0587005
499 2511822809
500 2585264122
501 2738712963
502 2738851387
503 2738867117
504 2739299634
505 2739361313
506 2856745594
507 2862289269
508 2874171059
509 2919139507
510 2928103582
511 2928963273
512 2971414565
513 8056537843
514 8057348869

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

38

234

0.94

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

44

283

0.92

PF08659

KR

KR domain

38

148

0.91

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

40

176

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5jc8-assembly1.cif.gz_D crystal structure of a putative short-chain dehydrogenase/reductase from burkholderia xenovorans 0.9512 18 251
5jc8-assembly1.cif.gz_A crystal structure of a putative short-chain dehydrogenase/reductase from burkholderia xenovorans 0.9504 18 251
3awd-assembly1.cif.gz_D crystal structure of gox2181 0.9449 15 251
4ni5-assembly1.cif.gz_B crystal structure of a short chain dehydrogenase from brucella suis 0.9426 18 251
4ni5-assembly1.cif.gz_A crystal structure of a short chain dehydrogenase from brucella suis 0.9405 18 251
ID Description Score Start End Superfamily
5jc8D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9511 18 251 3.40.50.720
3awdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9459 15 251 3.40.50.720
4ni5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9405 18 251 3.40.50.720
af_A0A1D8PPB1_4_280_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9395 17 248 3.40.50.720
1vl8B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9385 19 251 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1V8UQ90-F1-model_v4 D-arabinitol 2-dehydrogenase [ribulose-forming] 0.9547 58 251 GO:0016616
GO:0050664
AF-A0A0T2KYL0-F1-model_v4 Short-chain dehydrogenase 0.9493 22 251 GO:0016491
AF-A0A2V3U8G4-F1-model_v4 3-oxoacyl-[acyl-carrier protein] reductase/meso-butanediol dehydrogenase/(S,S)-butanediol dehydrogenase/diacetyl reductase 0.9468 18 248 GO:0016616
AF-W3VKG4-F1-model_v4 D-arabinitol 2-dehydrogenase 0.9462 16 251 GO:0016616
GO:0050664
AF-A0A7C3P7A7-F1-model_v4 SDR family oxidoreductase 0.9461 61 250 GO:0016616

Map