F367476

General Info

Members Datasets Scaffolds Average Seq Length
257 176 514 474

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_1240257|Ga0436365_1240257_213_1712
Length 499
Sequence LSARDSLPDHGGKPSRPSQTKEPDKLDLVITGGTAVLPTGAEAADIAIQGERIAAIGAPGSLAALGAGRTVDATGQIVIPGGIDPHVHCNWPMPIPDGEAKLTAPASVVSRAALFGGTTTTIDFAPVEGGMSVQQAIEHRMQQWAGDCYGDYAFHTMLLGKIAPEILPQVAEAVAAGHPSVKMFTTDITPSRRGRMVDHGDIWEVLKVLAEAGGIAAIHAEDNDIVMHMYEKLMREQRTGFENMAEVHNTLSEDLSFNRVIRLAANIEGAALYMMHTSAATGVNAIAQARSRGTPIYGETLHQYLMYNSADYKRPNGQIYHTYPSLKFPEDQAALWAATDHGAIQTVATDEICCPLRIKLQGRRIDDTTGGNAGVEPRVSLIYTETVEKRGYGLGDFVGLVSTNAAKIMGLYPRKGALAAGSDADIVLLDPRRRHTVRASDMHEADYSPWEGRDLAAWPSLTMLRGKIVVEGGDFHGDPKDGKFIPRKIAAAIRARPAV

Samples

Sample ID Description Type Environment
1 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
59 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
60 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
61 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
62 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
97 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
98 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
99 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
100 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
101 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
102 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
103 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
104 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
105 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
106 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
107 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
108 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
109 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
112 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
113 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
116 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
117 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
118 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
119 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
120 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
121 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
122 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
123 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
124 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
125 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
126 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
127 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
128 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
129 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
130 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
131 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
132 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
133 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
134 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
135 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
136 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
137 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
138 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
139 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
140 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
141 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
142 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
151 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
152 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
153 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
154 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
155 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
156 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
157 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
158 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
159 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
160 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
161 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
162 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
163 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
164 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
165 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
166 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
167 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
168 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
169 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
170 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
171 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
172 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
173 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
174 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
175 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
176 2773857925 Microvirga vignae BR3299 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.22
Metatranscriptomes 0
Isolates 0.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.5
Nodule 0
Rhizoplane 0.39
Rhizosphere 90.66
Stem 0
Stem Tuber 0
Unclassified 5.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436365_1240257 3300039437 Bacteria 1877
2 JGI25405J52794_10013718 3300003911 Bacteria 1575
3 Ga0070658_10114234 3300005327 Bacteria 2239
4 Ga0070683_100278676 3300005329 Bacteria 1590
5 Ga0070690_100018539 3300005330 Bacteria 4206
6 Ga0070690_100028763 3300005330 Bacteria 3444
7 Ga0068868_100002518 3300005338 Bacteria 12728
8 Ga0070661_100104537 3300005344 Bacteria 2110
9 Ga0070692_10037281 3300005345 Bacteria 2471
10 Ga0070669_100004253 3300005353 Bacteria 10340
11 Ga0070675_100062955 3300005354 Bacteria 3066
12 Ga0070675_100096921 3300005354 Bacteria 2479
13 Ga0070671_100009799 3300005355 Bacteria 7689
14 Ga0070714_100123284 3300005435 Bacteria 2307
15 Ga0070713_100005375 3300005436 Bacteria 8749
16 Ga0070713_100063577 3300005436 Bacteria 3095
17 Ga0070710_10039189 3300005437 Bacteria 2606
18 Ga0070710_10121833 3300005437 Bacteria 1580
19 Ga0070711_100030003 3300005439 Bacteria 3595
20 Ga0070711_100160710 3300005439 Bacteria 1703
21 Ga0070711_100194111 3300005439 Bacteria 1562
22 Ga0070708_100078170 3300005445 Bacteria 2991
23 Ga0070678_100001132 3300005456 Bacteria 14056
24 Ga0070678_100007493 3300005456 Bacteria 6480
25 Ga0068867_100001824 3300005459 Bacteria 14842
26 Ga0068867_100096679 3300005459 Bacteria 2249
27 Ga0070706_100046929 3300005467 Bacteria 3986
28 Ga0070707_100000318 3300005468 Bacteria 47325
29 Ga0070707_100142146 3300005468 Unclassified 2336
30 Ga0070707_100195307 3300005468 Unclassified 1973
31 Ga0070698_100001975 3300005471 Bacteria 22794
32 Ga0070698_100009155 3300005471 Bacteria 10628
33 Ga0070698_100011449 3300005471 Bacteria 9411
34 Ga0070698_100067303 3300005471 Bacteria 3602
35 Ga0070698_100160184 3300005471 Unclassified 2195
36 Ga0070699_100024397 3300005518 Bacteria 5211
37 Ga0070684_100003788 3300005535 Bacteria 11421
38 Ga0070684_100039370 3300005535 Bacteria 4065
39 Ga0070697_100019807 3300005536 Bacteria 5316
40 Ga0070697_100020919 3300005536 Bacteria 5180
41 Ga0070697_100036599 3300005536 Bacteria 3964
42 Ga0068853_100250538 3300005539 Bacteria 1625
43 Ga0070672_100014809 3300005543 Bacteria 5534
44 Ga0070665_100008914 3300005548 Bacteria 10162
45 Ga0070665_100072531 3300005548 Bacteria 3450
46 Ga0070665_100159281 3300005548 Bacteria 2259
47 Ga0068855_100045789 3300005563 Bacteria 5172
48 Ga0068855_100062390 3300005563 Bacteria 4351
49 Ga0070664_100053765 3300005564 Bacteria 3415
50 Ga0070664_100094068 3300005564 Unclassified 2598
51 Ga0068856_100010253 3300005614 Bacteria 9108
52 Ga0068856_100016769 3300005614 Bacteria 7097
53 Ga0068852_100072699 3300005616 Bacteria 3023
54 Ga0068859_100065375 3300005617 Bacteria 3671
55 Ga0068864_100079524 3300005618 Unclassified 2871
56 Ga0068861_100002205 3300005719 Bacteria 12632
57 Ga0068862_100005492 3300005844 Bacteria 10594
58 Ga0081455_10001257 3300005937 Bacteria 31648
59 Ga0081455_10008247 3300005937 Bacteria 10860
60 Ga0081540_1017354 3300005983 Bacteria 4459
61 Ga0081539_10000311 3300005985 Bacteria 108579
62 Ga0081539_10003999 3300005985 Bacteria 16991
63 Ga0081539_10007885 3300005985 Bacteria 9496
64 Ga0070717_10003138 3300006028 Bacteria 11808
65 Ga0070717_10007680 3300006028 Bacteria 8018
66 Ga0070717_10021668 3300006028 Bacteria 5067
67 Ga0070717_10139605 3300006028 Bacteria 2089
68 Ga0070712_100010351 3300006175 Bacteria 5881
69 Ga0070712_100012860 3300006175 Bacteria 5331
70 Ga0070712_100121227 3300006175 Bacteria 1968
71 Ga0075362_10007852 3300006177 Bacteria 4060
72 Ga0075362_10008940 3300006177 Bacteria 3852
73 Ga0097621_100009595 3300006237 Bacteria 7034
74 Ga0075370_10061323 3300006353 Bacteria 2142
75 Ga0075428_100011387 3300006844 Bacteria 9894
76 Ga0068865_100021717 3300006881 Bacteria 4179
77 Ga0097620_100065384 3300006931 Bacteria 3671
78 Ga0111539_10108223 3300009094 Bacteria 3262
79 Ga0105245_10295736 3300009098 Bacteria 1587
80 Ga0114129_10075361 3300009147 Bacteria 4698
81 Ga0105238_10103222 3300009551 Bacteria 2832
82 Ga0105238_10121779 3300009551 Bacteria 2588
83 Ga0157374_10039756 3300013296 Bacteria 4329
84 Ga0157374_10069645 3300013296 Bacteria 3312
85 Ga0157378_10011239 3300013297 Bacteria 7832
86 Ga0163162_10183333 3300013306 Bacteria 2220
87 Ga0157375_10047444 3300013308 Bacteria 4195
88 Ga0182008_10065510 3300014497 Bacteria 1787
89 Ga0157379_10238635 3300014968 Bacteria 1649
90 Ga0157376_10050331 3300014969 Bacteria 3456
91 Ga0157376_10137302 3300014969 Bacteria 2190
92 Ga0213876_10055015 3300021384 Bacteria 2101
93 Ga0213875_10000222 3300021388 Bacteria 57848
94 Ga0213875_10001013 3300021388 Bacteria 19912
95 Ga0213871_10020824 3300021441 Bacteria 1629
96 Ga0207426_1014249 3300025302 Bacteria 2917
97 Ga0207692_10037949 3300025898 Bacteria 2359
98 Ga0207710_10006463 3300025900 Bacteria 5004
99 Ga0207647_10080975 3300025904 Bacteria 1946
100 Ga0207699_10012817 3300025906 Bacteria 4271
101 Ga0207645_10053376 3300025907 Bacteria 2583
102 Ga0207643_10067120 3300025908 Bacteria 2058
103 Ga0207643_10072175 3300025908 Bacteria 1988
104 Ga0207684_10102241 3300025910 Bacteria 2450
105 Ga0207684_10152779 3300025910 Unclassified 1986
106 Ga0207707_10100620 3300025912 Bacteria 2526
107 Ga0207693_10005227 3300025915 Bacteria 10862
108 Ga0207693_10011765 3300025915 Bacteria 7072
109 Ga0207663_10029874 3300025916 Bacteria 3207
110 Ga0207646_10002508 3300025922 Bacteria 21676
111 Ga0207646_10026432 3300025922 Bacteria 5296
112 Ga0207650_10012814 3300025925 Bacteria 5793
113 Ga0207650_10110095 3300025925 Unclassified 2131
114 Ga0207687_10043494 3300025927 Bacteria 3095
115 Ga0207700_10129505 3300025928 Bacteria 2058
116 Ga0207664_10047253 3300025929 Bacteria 3380
117 Ga0207644_10027719 3300025931 Bacteria 3915
118 Ga0207691_10050209 3300025940 Bacteria 3820
119 Ga0207689_10033984 3300025942 Bacteria 4235
120 Ga0207661_10095706 3300025944 Bacteria 2483
121 Ga0207679_10111322 3300025945 Bacteria 2161
122 Ga0207667_10138714 3300025949 Bacteria 2503
123 Ga0207651_10057774 3300025960 Bacteria 2678
124 Ga0207658_10096031 3300025986 Unclassified 2311
125 Ga0207708_10002431 3300026075 Bacteria 13681
126 Ga0207702_10007137 3300026078 Bacteria 9560
127 Ga0207702_10043580 3300026078 Bacteria 3768
128 Ga0207648_10002687 3300026089 Bacteria 18922
129 Ga0207676_10022818 3300026095 Bacteria 4608
130 Ga0207674_10039612 3300026116 Bacteria 4884
131 Ga0207675_100022863 3300026118 Bacteria 5817
132 Ga0207683_10017152 3300026121 Bacteria 6165
133 Ga0209967_1005786 3300027364 Bacteria 1669
134 Ga0207428_10013025 3300027907 Bacteria 7284
135 Ga0207428_10045693 3300027907 Bacteria 3525
136 Ga0268266_10014335 3300028379 Bacteria 6817
137 Ga0268266_10025657 3300028379 Bacteria 5013
138 Ga0268265_10022740 3300028380 Bacteria 4409
139 Ga0268265_10142036 3300028380 Bacteria 2011
140 Ga0265340_10059718 3300031247 Unclassified 1828
141 Ga0373926_0000213 3300035083 Bacteria 13577
142 Ga0373936_0000086 3300035113 Bacteria 34644
143 Ga0373945_0000790 3300035116 Bacteria 9250
144 Ga0373945_0038901 3300035116 Bacteria 1713
145 Ga0373953_0011144 3300035117 Bacteria 3147
146 Ga0373954_0003548 3300035118 Bacteria 6630
147 Ga0373954_0010629 3300035118 Bacteria 4065
148 Ga0373943_0000340 3300035170 Bacteria 19572
149 Ga0373943_0045936 3300035170 Bacteria 2130
150 Ga0373943_0050861 3300035170 Bacteria 2038
151 Ga0373946_0000681 3300035171 Bacteria 11405
152 Ga0373955_0005722 3300035172 Bacteria 5599
153 Ga0373931_0010386 3300035691 Bacteria 4475
154 Ga0373935_0000446 3300035692 Bacteria 21391
155 Ga0373927_0001440 3300035695 Bacteria 17944
156 Ga0373947_0000763 3300035725 Bacteria 19282
157 Ga0373937_0002666 3300036401 Bacteria 14879
158 Ga0373937_0011430 3300036401 Bacteria 7791
159 Ga0373937_0021328 3300036401 Bacteria 5815
160 Ga0373925_0003347 3300037068 Bacteria 12442
161 Ga0373925_0112716 3300037068 Bacteria 2103
162 Ga0395899_0023064 3300037312 Bacteria 4717
163 Ga0395900_0005011 3300037418 Bacteria 13894
164 Ga0395900_0167185 3300037418 Unclassified 2241
165 Ga0436364_0164728 3300037853 Bacteria 2455
166 Ga0436364_0331623 3300037853 Bacteria 59138
167 Ga0436364_0799099 3300037853 Bacteria 2326
168 Ga0436364_0822297 3300037853 Bacteria 75298
169 Ga0436364_0936501 3300037853 Bacteria 40899
170 Ga0395901_0013516 3300038443 Bacteria 8301
171 Ga0395901_0155244 3300038443 Bacteria 2404
172 Ga0436365_0015868 3300039437 Bacteria 4919
173 Ga0436365_0173302 3300039437 Bacteria 1879
174 Ga0436360_0429961 3300039438 Bacteria 10956
175 Ga0436360_0827134 3300039438 Bacteria 2586
176 Ga0436361_0668894 3300039447 Bacteria 8025
177 Ga0436361_0823479 3300039447 Bacteria 2414
178 Ga0436361_1106654 3300039447 Bacteria 1382
179 Ga0436362_0171672 3300039453 Bacteria 4310
180 Ga0451853_0225771 3300041512 Bacteria 1897
181 Ga0439460_0007797 3300042461 Bacteria 2688
182 Ga0451577_0007416 3300042876 Bacteria 10773
183 Ga0466963_0013555 3300044694 Bacteria 5006
184 Ga0453684_0317059 3300044712 Bacteria 1767
185 Ga0451576_0002244 3300045051 Bacteria 29629
186 Ga0451576_0303839 3300045051 Unclassified 1669
187 Ga0495603_0002067 3300046455 Bacteria 11799
188 Ga0495629_0104493 3300046459 Bacteria 1976
189 Ga0495580_0003335 3300046472 Bacteria 13727
190 Ga0495582_0044784 3300046473 Bacteria 2436
191 Ga0495639_0003075 3300046475 Bacteria 7264
192 Ga0495662_0010063 3300046476 Bacteria 4638
193 Ga0495640_0028440 3300046533 Bacteria 4025
194 Ga0495640_0055931 3300046533 Bacteria 2698
195 Ga0495640_0058135 3300046533 Bacteria 2638
196 Ga0495640_0093237 3300046533 Bacteria 1985
197 Ga0495586_0060931 3300046535 Bacteria 2053
198 Ga0495634_0143611 3300046642 Unclassified 1514
199 Ga0495588_0004702 3300046674 Bacteria 6032
200 Ga0495647_0000146 3300046681 Bacteria 18116
201 Ga0495613_0081610 3300046689 Unclassified 2349
202 Ga0495624_0025118 3300046690 Bacteria 3916
203 Ga0495581_0042037 3300047315 Bacteria 2646
204 Ga0495676_0116302 3300047321 Bacteria 1953
205 Ga0495684_0067140 3300047471 Unclassified 2727
206 Ga0496112_0146216 3300048915 Bacteria 2332
207 Ga0496119_0008042 3300048922 Bacteria 9367
208 Ga0501034_0000459 3300049571 Bacteria 67365
209 Ga0501034_0011479 3300049571 Bacteria 9181
210 Ga0501036_0044435 3300049572 Bacteria 3763
211 Ga0501039_0025393 3300049575 Bacteria 4552
212 Ga0501041_0005661 3300049577 Bacteria 7302
213 Ga0501041_0041606 3300049577 Bacteria 2791
214 Ga0501043_0025169 3300049579 Bacteria 4669
215 Ga0501046_0129857 3300049580 Bacteria 1912
216 Ga0501047_0050984 3300049581 Bacteria 3997
217 Ga0501048_0072937 3300049582 Bacteria 2423
218 Ga0501069_0109835 3300049585 Bacteria 1570
219 Ga0501070_0066780 3300049586 Bacteria 2979
220 Ga0501071_0011568 3300049587 Bacteria 5954
221 Ga0501075_0008008 3300049591 Bacteria 7343
222 Ga0501075_0011376 3300049591 Bacteria 6299
223 Ga0501075_0118916 3300049591 Bacteria 2010
224 Ga0501076_0003554 3300049592 Bacteria 10951
225 Ga0501076_0004738 3300049592 Bacteria 9706
226 Ga0501076_0091313 3300049592 Bacteria 2450
227 Ga0501077_0013230 3300049593 Bacteria 5171
228 Ga0501079_0001926 3300049741 Bacteria 14875
229 Ga0501079_0013261 3300049741 Bacteria 6283
230 Ga0501080_0003555 3300049742 Bacteria 13722
231 Ga0501080_0053852 3300049742 Bacteria 3747
232 Ga0501081_0000978 3300049743 Bacteria 16984
233 Ga0501081_0002179 3300049743 Bacteria 12306
234 Ga0501045_0012534 3300049824 Bacteria 5971
235 nmdc:mga03683_22264_c1 3300050489 Bacteria 2456
236 nmdc:mga07m45_20302_c1 3300050496 Bacteria 3608
237 nmdc:mga05p37_184190_c1 3300050507 Bacteria 2539
238 nmdc:mga09592_13689_c1 3300050508 Bacteria 5348
239 nmdc:mga09592_58233_c1 3300050508 Bacteria 3268
240 nmdc:mga08y16_24843_c1 3300050511 Bacteria 6322
241 nmdc:mga08y16_314406_c1 3300050511 Bacteria 1613
242 nmdc:mga08y16_81593_c1 3300050511 Unclassified 3371
243 nmdc:mga0n895_56362_c1 3300050512 Bacteria 3871
244 nmdc:mga08x19_39271_c1 3300050514 Bacteria 3008
245 nmdc:mga0sz30_3649_c1 3300050516 Bacteria 5547
246 Ga0495601_0009607 3300053077 Bacteria 5726
247 Ga0495601_0009674 3300053077 Bacteria 5705
248 Ga0495619_0009488 3300053085 Bacteria 6138
249 Ga0500641_0004703 3300053096 Bacteria 4825
250 Ga0500618_000564 3300053125 Bacteria 22973
251 Ga0501084_0011654 3300054114 Bacteria 7279
252 Ga0501082_0019202 3300060353 Bacteria 5890
253 Ga0530510_0000097 3300061734 Bacteria 47406
254 Ga0530510_0060275 3300061734 Bacteria 2746
255 Ga0530510_0063078 3300061734 Bacteria 2683
256 2585255813 2582581304 Bacteria 5831370
257 2774873563 2773857925 Bacteria 6472445
258 Ga0436365_1240257
259 JGI25405J52794_10013718
260 Ga0070658_10114234
261 Ga0070683_100278676
262 Ga0070690_100018539
263 Ga0070690_100028763
264 Ga0068868_100002518
265 Ga0070661_100104537
266 Ga0070692_10037281
267 Ga0070669_100004253
268 Ga0070675_100062955
269 Ga0070675_100096921
270 Ga0070671_100009799
271 Ga0070714_100123284
272 Ga0070713_100005375
273 Ga0070713_100063577
274 Ga0070710_10039189
275 Ga0070710_10121833
276 Ga0070711_100030003
277 Ga0070711_100160710
278 Ga0070711_100194111
279 Ga0070708_100078170
280 Ga0070678_100001132
281 Ga0070678_100007493
282 Ga0068867_100001824
283 Ga0068867_100096679
284 Ga0070706_100046929
285 Ga0070707_100000318
286 Ga0070707_100142146
287 Ga0070707_100195307
288 Ga0070698_100001975
289 Ga0070698_100009155
290 Ga0070698_100011449
291 Ga0070698_100067303
292 Ga0070698_100160184
293 Ga0070699_100024397
294 Ga0070684_100003788
295 Ga0070684_100039370
296 Ga0070697_100019807
297 Ga0070697_100020919
298 Ga0070697_100036599
299 Ga0068853_100250538
300 Ga0070672_100014809
301 Ga0070665_100008914
302 Ga0070665_100072531
303 Ga0070665_100159281
304 Ga0068855_100045789
305 Ga0068855_100062390
306 Ga0070664_100053765
307 Ga0070664_100094068
308 Ga0068856_100010253
309 Ga0068856_100016769
310 Ga0068852_100072699
311 Ga0068859_100065375
312 Ga0068864_100079524
313 Ga0068861_100002205
314 Ga0068862_100005492
315 Ga0081455_10001257
316 Ga0081455_10008247
317 Ga0081540_1017354
318 Ga0081539_10000311
319 Ga0081539_10003999
320 Ga0081539_10007885
321 Ga0070717_10003138
322 Ga0070717_10007680
323 Ga0070717_10021668
324 Ga0070717_10139605
325 Ga0070712_100010351
326 Ga0070712_100012860
327 Ga0070712_100121227
328 Ga0075362_10007852
329 Ga0075362_10008940
330 Ga0097621_100009595
331 Ga0075370_10061323
332 Ga0075428_100011387
333 Ga0068865_100021717
334 Ga0097620_100065384
335 Ga0111539_10108223
336 Ga0105245_10295736
337 Ga0114129_10075361
338 Ga0105238_10103222
339 Ga0105238_10121779
340 Ga0157374_10039756
341 Ga0157374_10069645
342 Ga0157378_10011239
343 Ga0163162_10183333
344 Ga0157375_10047444
345 Ga0182008_10065510
346 Ga0157379_10238635
347 Ga0157376_10050331
348 Ga0157376_10137302
349 Ga0213876_10055015
350 Ga0213875_10000222
351 Ga0213875_10001013
352 Ga0213871_10020824
353 Ga0207426_1014249
354 Ga0207692_10037949
355 Ga0207710_10006463
356 Ga0207647_10080975
357 Ga0207699_10012817
358 Ga0207645_10053376
359 Ga0207643_10067120
360 Ga0207643_10072175
361 Ga0207684_10102241
362 Ga0207684_10152779
363 Ga0207707_10100620
364 Ga0207693_10005227
365 Ga0207693_10011765
366 Ga0207663_10029874
367 Ga0207646_10002508
368 Ga0207646_10026432
369 Ga0207650_10012814
370 Ga0207650_10110095
371 Ga0207687_10043494
372 Ga0207700_10129505
373 Ga0207664_10047253
374 Ga0207644_10027719
375 Ga0207691_10050209
376 Ga0207689_10033984
377 Ga0207661_10095706
378 Ga0207679_10111322
379 Ga0207667_10138714
380 Ga0207651_10057774
381 Ga0207658_10096031
382 Ga0207708_10002431
383 Ga0207702_10007137
384 Ga0207702_10043580
385 Ga0207648_10002687
386 Ga0207676_10022818
387 Ga0207674_10039612
388 Ga0207675_100022863
389 Ga0207683_10017152
390 Ga0209967_1005786
391 Ga0207428_10013025
392 Ga0207428_10045693
393 Ga0268266_10014335
394 Ga0268266_10025657
395 Ga0268265_10022740
396 Ga0268265_10142036
397 Ga0265340_10059718
398 Ga0373926_0000213
399 Ga0373936_0000086
400 Ga0373945_0000790
401 Ga0373945_0038901
402 Ga0373953_0011144
403 Ga0373954_0003548
404 Ga0373954_0010629
405 Ga0373943_0000340
406 Ga0373943_0045936
407 Ga0373943_0050861
408 Ga0373946_0000681
409 Ga0373955_0005722
410 Ga0373931_0010386
411 Ga0373935_0000446
412 Ga0373927_0001440
413 Ga0373947_0000763
414 Ga0373937_0002666
415 Ga0373937_0011430
416 Ga0373937_0021328
417 Ga0373925_0003347
418 Ga0373925_0112716
419 Ga0395899_0023064
420 Ga0395900_0005011
421 Ga0395900_0167185
422 Ga0436364_0164728
423 Ga0436364_0331623
424 Ga0436364_0799099
425 Ga0436364_0822297
426 Ga0436364_0936501
427 Ga0395901_0013516
428 Ga0395901_0155244
429 Ga0436365_0015868
430 Ga0436365_0173302
431 Ga0436360_0429961
432 Ga0436360_0827134
433 Ga0436361_0668894
434 Ga0436361_0823479
435 Ga0436361_1106654
436 Ga0436362_0171672
437 Ga0451853_0225771
438 Ga0439460_0007797
439 Ga0451577_0007416
440 Ga0466963_0013555
441 Ga0453684_0317059
442 Ga0451576_0002244
443 Ga0451576_0303839
444 Ga0495603_0002067
445 Ga0495629_0104493
446 Ga0495580_0003335
447 Ga0495582_0044784
448 Ga0495639_0003075
449 Ga0495662_0010063
450 Ga0495640_0028440
451 Ga0495640_0055931
452 Ga0495640_0058135
453 Ga0495640_0093237
454 Ga0495586_0060931
455 Ga0495634_0143611
456 Ga0495588_0004702
457 Ga0495647_0000146
458 Ga0495613_0081610
459 Ga0495624_0025118
460 Ga0495581_0042037
461 Ga0495676_0116302
462 Ga0495684_0067140
463 Ga0496112_0146216
464 Ga0496119_0008042
465 Ga0501034_0000459
466 Ga0501034_0011479
467 Ga0501036_0044435
468 Ga0501039_0025393
469 Ga0501041_0005661
470 Ga0501041_0041606
471 Ga0501043_0025169
472 Ga0501046_0129857
473 Ga0501047_0050984
474 Ga0501048_0072937
475 Ga0501069_0109835
476 Ga0501070_0066780
477 Ga0501071_0011568
478 Ga0501075_0008008
479 Ga0501075_0011376
480 Ga0501075_0118916
481 Ga0501076_0003554
482 Ga0501076_0004738
483 Ga0501076_0091313
484 Ga0501077_0013230
485 Ga0501079_0001926
486 Ga0501079_0013261
487 Ga0501080_0003555
488 Ga0501080_0053852
489 Ga0501081_0000978
490 Ga0501081_0002179
491 Ga0501045_0012534
492 nmdc:mga03683_22264_c1
493 nmdc:mga07m45_20302_c1
494 nmdc:mga05p37_184190_c1
495 nmdc:mga09592_13689_c1
496 nmdc:mga09592_58233_c1
497 nmdc:mga08y16_24843_c1
498 nmdc:mga08y16_314406_c1
499 nmdc:mga08y16_81593_c1
500 nmdc:mga0n895_56362_c1
501 nmdc:mga08x19_39271_c1
502 nmdc:mga0sz30_3649_c1
503 Ga0495601_0009607
504 Ga0495601_0009674
505 Ga0495619_0009488
506 Ga0500641_0004703
507 Ga0500618_000564
508 Ga0501084_0011654
509 Ga0501082_0019202
510 Ga0530510_0000097
511 Ga0530510_0060275
512 Ga0530510_0063078
513 2585255813
514 2774873563

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07969

Amidohydro_3

Amidohydrolase family

337

470

0.93

PF01979

Amidohydro_1

Amidohydrolase family

77

469

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
4kqn-assembly1.cif.gz_A 2.8 angstrom resolution crystal structure of d-hydantoinase from bacillus sp. ar9 in c2221 space group 0.9546 3 464
1yny-assembly2.cif.gz_B molecular structure of d-hydantoinase from a bacillus sp. ar9: evidence for mercury inhibition 0.9501 3 465
3sfw-assembly1.cif.gz_A crystal structure of dihydropyrimidinase from brevibacillus agri nchu1002 0.9488 1 465
4tqt-assembly1.cif.gz_D crystal structure of dihydropyrimidinase from brucella suis 0.9475 4 469
1yny-assembly1.cif.gz_A molecular structure of d-hydantoinase from a bacillus sp. ar9: evidence for mercury inhibition 0.9471 3 464
ID Description Score Start End Superfamily
af_P77671_2_52_2.30.40.10 Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 0.9762 1 51 2.30.40.10
3e74D01 Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 0.9663 1 52 2.30.40.10
1gkqA01 Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 0.9527 386 450 2.30.40.10
1ynyA01 Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 0.9446 388 465 2.30.40.10
af_Q46806_2_437_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9442 4 445 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A537QH40-F1-model_v4 Amidohydrolase-related domain-containing protein 0.9865 1 474 GO:0005829
GO:0016812
AF-A0A382NZU8-F1-model_v4 Amidohydrolase-related domain-containing protein 0.9865 84 443 GO:0016810
AF-F4CIX0-F1-model_v4 Dihydropyrimidinase (EC 3.5.2.2) 0.9859 1 474 GO:0004157
GO:0005829
AF-A0A537NJQ6-F1-model_v4 Amidohydrolase-related domain-containing protein 0.9859 171 474 GO:0005829
GO:0016812
AF-A0A537QH40-F1-model_v4 Amidohydrolase-related domain-containing protein 0.9845 1 474 GO:0005829
GO:0016812

Map