F367633

General Info

Members Datasets Scaffolds Average Seq Length
257 170 514 291

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0012901|Ga0501034_0012901_5214_6161
Length 315
Sequence MSTPSITDAVKSKYAAVANSPLSSAHDGVRAVAEAFGYSASDLASIPADANMGLSCGNPVAMASLKPGETVVDLGCGGGLDVFLAAGRVGPAGKAIGIDMTPAMIDRARRNAAQTPDLHNVEFHLATIDKLPLPDASADVVISNCVINLAPDKAAVFKEIARVLKPGGRVAVSDIALKRPLPPELRESIMAYVGCIAGAILIPDYEAGLNAAGFSAVQVIDSGADLNAYAKVENQSGCCSPAMDDVTMDKATETRIAKTSCCSLPTADGGVSTXXXSPATVEKEKPDLHAHLKTLLQRYNVNDYAASVKVFALKS

Samples

Sample ID Description Type Environment
1 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
63 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
94 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
96 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
97 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
98 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
99 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
100 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
101 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
102 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
103 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
104 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
105 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
106 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
107 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
108 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
109 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
110 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
111 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
112 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
113 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
114 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
115 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
116 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
117 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
118 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
119 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
120 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
121 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
122 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
123 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
124 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
125 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
126 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
127 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
128 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
129 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
130 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
131 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
132 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
133 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
134 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
135 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
136 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
137 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
138 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
139 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
140 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
141 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
142 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
143 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
144 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
145 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
154 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
155 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
156 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
157 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
158 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
159 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
160 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
162 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
163 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
164 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
165 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
166 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
167 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
168 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
169 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
170 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.61
Metatranscriptomes 0.39
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.28
Nodule 0
Rhizoplane 1.56
Rhizosphere 90.66
Stem 0
Stem Tuber 0
Unclassified 3.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501034_0012901 3300049571 Bacteria 8619
2 rootH2_10121148 3300003320 Bacteria 2193
3 Ga0070658_10000010 3300005327 Bacteria 297212
4 Ga0070658_10167067 3300005327 Bacteria 1847
5 Ga0070658_10227395 3300005327 Bacteria 1579
6 Ga0070683_100164801 3300005329 Bacteria 2103
7 Ga0070683_100249273 3300005329 Bacteria 1689
8 Ga0070680_100052364 3300005336 Unclassified 3331
9 Ga0070682_100082129 3300005337 Bacteria 2088
10 Ga0068868_100048315 3300005338 Bacteria 3337
11 Ga0070660_100001412 3300005339 Bacteria 16343
12 Ga0070660_100024959 3300005339 Bacteria 4439
13 Ga0070660_100528019 3300005339 Bacteria 983
14 Ga0070661_100035046 3300005344 Bacteria 3643
15 Ga0070668_100058416 3300005347 Bacteria 2984
16 Ga0070675_100013128 3300005354 Bacteria 6509
17 Ga0070675_100113234 3300005354 Bacteria 2298
18 Ga0070674_100123460 3300005356 Bacteria 1920
19 Ga0070673_100056308 3300005364 Bacteria 3102
20 Ga0070667_100053432 3300005367 Bacteria 3409
21 Ga0070663_100001789 3300005455 Bacteria 11961
22 Ga0070663_100108748 3300005455 Bacteria 2080
23 Ga0070663_100404180 3300005455 Bacteria 1117
24 Ga0070678_100021834 3300005456 Bacteria 4229
25 Ga0070662_100036298 3300005457 Bacteria 3485
26 Ga0070681_10086429 3300005458 Bacteria 3089
27 Ga0068867_100282709 3300005459 Bacteria 1361
28 Ga0070679_100001011 3300005530 Bacteria 24495
29 Ga0070679_100010225 3300005530 Bacteria 8895
30 Ga0070679_100305504 3300005530 Bacteria 1541
31 Ga0070684_100318186 3300005535 Bacteria 1429
32 Ga0068853_100043683 3300005539 Bacteria 3834
33 Ga0068853_100063614 3300005539 Bacteria 3196
34 Ga0070672_100036620 3300005543 Bacteria 3739
35 Ga0070665_100033133 3300005548 Bacteria 5198
36 Ga0070665_100257480 3300005548 Bacteria 1746
37 Ga0068855_100006862 3300005563 Bacteria 13812
38 Ga0068855_100014200 3300005563 Bacteria 9594
39 Ga0068855_100031060 3300005563 Bacteria 6382
40 Ga0068855_100051423 3300005563 Bacteria 4853
41 Ga0068855_100052775 3300005563 Bacteria 4785
42 Ga0068855_100083771 3300005563 Bacteria 3694
43 Ga0068855_100220574 3300005563 Bacteria 2126
44 Ga0068855_100371185 3300005563 Bacteria 1572
45 Ga0068857_100024069 3300005577 Bacteria 5361
46 Ga0068854_100148288 3300005578 Unclassified 1806
47 Ga0068856_100021028 3300005614 Bacteria 6341
48 Ga0068856_100339371 3300005614 Bacteria 1520
49 Ga0068852_100021567 3300005616 Bacteria 5147
50 Ga0068852_100028127 3300005616 Bacteria 4596
51 Ga0068852_100080261 3300005616 Bacteria 2892
52 Ga0068852_100160844 3300005616 Bacteria 2097
53 Ga0068864_100098795 3300005618 Bacteria 2586
54 Ga0068866_10043086 3300005718 Bacteria 2250
55 Ga0068851_10046022 3300005834 Bacteria 2206
56 Ga0068863_100022816 3300005841 Bacteria 5979
57 Ga0068858_100047378 3300005842 Bacteria 3985
58 Ga0068858_100376310 3300005842 Bacteria 1362
59 Ga0070717_10001200 3300006028 Bacteria 17542
60 Ga0075368_10002113 3300006042 Bacteria 6413
61 Ga0075367_10177186 3300006178 Bacteria 1329
62 Ga0075366_10056337 3300006195 Bacteria 2335
63 Ga0097621_100063500 3300006237 Bacteria 3035
64 Ga0068871_100029982 3300006358 Bacteria 4279
65 Ga0075430_100004600 3300006846 Bacteria 11615
66 Ga0075430_100148753 3300006846 Bacteria 1950
67 Ga0075431_100124295 3300006847 Bacteria 2662
68 Ga0105240_10008154 3300009093 Bacteria 15021
69 Ga0105240_10162150 3300009093 Bacteria 2654
70 Ga0105240_10203099 3300009093 Bacteria 2321
71 Ga0105240_10269692 3300009093 Bacteria 1960
72 Ga0105245_10016635 3300009098 Bacteria 6421
73 Ga0105245_10053369 3300009098 Bacteria 3628
74 Ga0105245_10608307 3300009098 Bacteria 1120
75 Ga0105243_10026615 3300009148 Bacteria 4428
76 Ga0105241_10141753 3300009174 Bacteria 1958
77 Ga0105248_10020134 3300009177 Bacteria 7392
78 Ga0105248_10175339 3300009177 Bacteria 2416
79 Ga0105237_10085928 3300009545 Bacteria 3136
80 Ga0105237_10394478 3300009545 Bacteria 1389
81 Ga0105238_10004178 3300009551 Bacteria 14332
82 Ga0105238_10079160 3300009551 Bacteria 3276
83 Ga0105238_10215546 3300009551 Bacteria 1896
84 Ga0105238_10241965 3300009551 Bacteria 1782
85 Ga0105239_10248093 3300010375 Bacteria 1999
86 Ga0105239_10304428 3300010375 Bacteria 1795
87 Ga0105246_10049174 3300011119 Bacteria 2886
88 Ga0157371_10010847 3300013102 Bacteria 7071
89 Ga0157371_10068562 3300013102 Bacteria 2511
90 Ga0157370_10000943 3300013104 Bacteria 36885
91 Ga0157370_10123782 3300013104 Bacteria 2414
92 Ga0157369_10074834 3300013105 Bacteria 3632
93 Ga0157369_10089398 3300013105 Bacteria 3288
94 Ga0157369_10132164 3300013105 Bacteria 2644
95 Ga0157369_10187091 3300013105 Bacteria 2177
96 Ga0157369_10204763 3300013105 Unclassified 2070
97 Ga0157374_10249898 3300013296 Bacteria 1745
98 Ga0157378_10127807 3300013297 Bacteria 2349
99 Ga0157372_10000561 3300013307 Bacteria 40941
100 Ga0157372_10019354 3300013307 Bacteria 7335
101 Ga0157372_10104205 3300013307 Bacteria 3242
102 Ga0157372_11001832 3300013307 Unclassified 968
103 Ga0157375_10031203 3300013308 Bacteria 5033
104 Ga0157375_10223415 3300013308 Bacteria 2042
105 Ga0163163_10041869 3300014325 Bacteria 4482
106 Ga0157379_10061848 3300014968 Bacteria 3349
107 Ga0157376_10014558 3300014969 Bacteria 5908
108 Ga0224572_1001939 3300024225 Bacteria 3220
109 Ga0207697_10048784 3300025315 Bacteria 1747
110 Ga0207645_10032635 3300025907 Bacteria 3347
111 Ga0207705_10000016 3300025909 Bacteria 377359
112 Ga0207705_10082830 3300025909 Bacteria 2340
113 Ga0207705_10183776 3300025909 Bacteria 1579
114 Ga0207707_10044994 3300025912 Bacteria 3847
115 Ga0207695_10025799 3300025913 Bacteria 6571
116 Ga0207695_10202061 3300025913 Bacteria 1901
117 Ga0207660_10414229 3300025917 Bacteria 1086
118 Ga0207657_10008906 3300025919 Bacteria 10146
119 Ga0207649_10115579 3300025920 Unclassified 1800
120 Ga0207652_10005373 3300025921 Bacteria 10391
121 Ga0207652_10009604 3300025921 Bacteria 7781
122 Ga0207694_10001605 3300025924 Bacteria 19110
123 Ga0207694_10035987 3300025924 Bacteria 3798
124 Ga0207700_10099949 3300025928 Bacteria 2311
125 Ga0207664_10311427 3300025929 Bacteria 1387
126 Ga0207691_10022485 3300025940 Bacteria 5946
127 Ga0207711_10010800 3300025941 Bacteria 7589
128 Ga0207711_10327956 3300025941 Bacteria 1415
129 Ga0207661_10228288 3300025944 Bacteria 1648
130 Ga0207667_10004127 3300025949 Bacteria 17850
131 Ga0207667_10009723 3300025949 Bacteria 11306
132 Ga0207667_10072985 3300025949 Bacteria 3567
133 Ga0207667_10135991 3300025949 Plasmid 2531
134 Ga0207667_10168940 3300025949 Bacteria 2248
135 Ga0207651_10107310 3300025960 Bacteria 2087
136 Ga0207668_10241284 3300025972 Bacteria 1462
137 Ga0207640_10235792 3300025981 Unclassified 1411
138 Ga0207677_10150738 3300026023 Bacteria 1794
139 Ga0207703_10319642 3300026035 Bacteria 1421
140 Ga0207639_10130644 3300026041 Unclassified 2078
141 Ga0207639_10255738 3300026041 Bacteria 1529
142 Ga0207678_10001482 3300026067 Bacteria 21533
143 Ga0207641_10121378 3300026088 Bacteria 2333
144 Ga0207648_10139734 3300026089 Bacteria 2134
145 Ga0207683_10002695 3300026121 Bacteria 15523
146 Ga0207698_10015369 3300026142 Bacteria 5123
147 Ga0207698_10296862 3300026142 Bacteria 1502
148 Ga0207698_10353832 3300026142 Bacteria 1388
149 Ga0209813_10052472 3300027866 Bacteria 1279
150 Ga0268266_10130315 3300028379 Bacteria 2249
151 Ga0268266_10231260 3300028379 Bacteria 1703
152 Ga0268264_10102402 3300028381 Bacteria 2492
153 Ga0265338_10022605 3300028800 Bacteria 6502
154 Ga0265760_10036086 3300031090 Bacteria 1466
155 Ga0265316_10010271 3300031344 Bacteria 8542
156 Ga0265314_10000139 3300031711 Bacteria 108861
157 Ga0265314_10011615 3300031711 Bacteria 7249
158 Ga0307410_10061183 3300031852 Bacteria 2576
159 Ga0307406_10447288 3300031901 Bacteria 1036
160 Ga0307407_10044073 3300031903 Bacteria 2512
161 Ga0307409_100064114 3300031995 Bacteria 2885
162 Ga0307409_100134608 3300031995 Bacteria 2118
163 Ga0307409_100178281 3300031995 Bacteria 1878
164 Ga0307411_10017961 3300032005 Bacteria 4047
165 Ga0307510_10026884 3300033180 Bacteria 6605
166 Ga0307510_10247927 3300033180 Bacteria 1271
167 Ga0373937_0013926 3300036401 Bacteria 7092
168 Ga0395898_0210994 3300037466 Bacteria 1852
169 Ga0436361_0773113 3300039447 Bacteria 5764
170 Ga0451576_0019358 3300045051 Bacteria 7430
171 Ga0495603_0116018 3300046455 Bacteria 1561
172 Ga0495629_0020298 3300046459 Bacteria 4744
173 Ga0495651_0031494 3300046462 Bacteria 4136
174 Ga0495650_0000006 3300046471 Bacteria 721347
175 Ga0495650_0012556 3300046471 Bacteria 4549
176 Ga0495580_0279079 3300046472 Bacteria 1140
177 Ga0495639_0021513 3300046475 Bacteria 2824
178 Ga0495662_0002219 3300046476 Bacteria 9799
179 Ga0495664_0068637 3300046477 Bacteria 2115
180 Ga0495594_0000247 3300046499 Bacteria 26230
181 Ga0495583_0021374 3300046506 Bacteria 3331
182 Ga0495606_0085871 3300046507 Bacteria 1946
183 Ga0495608_0115093 3300046511 Bacteria 1727
184 Ga0495618_0270859 3300046514 Bacteria 1061
185 Ga0495643_0025003 3300046522 Bacteria 3383
186 Ga0495666_0001084 3300046526 Bacteria 12966
187 Ga0495642_0046699 3300046528 Bacteria 1772
188 Ga0495640_0029363 3300046533 Bacteria 3948
189 Ga0495640_0166873 3300046533 Bacteria 1408
190 Ga0495586_0010348 3300046535 Bacteria 4959
191 Ga0495667_0017049 3300046559 Bacteria 4904
192 Ga0495668_0040805 3300046616 Bacteria 2588
193 Ga0495668_0065877 3300046616 Bacteria 1994
194 Ga0495625_0001149 3300046660 Bacteria 34095
195 Ga0495661_0014845 3300046665 Bacteria 5211
196 Ga0495661_0073346 3300046665 Bacteria 1995
197 Ga0495599_0003948 3300046678 Bacteria 8721
198 Ga0495613_0001678 3300046689 Bacteria 16855
199 Ga0495613_0047910 3300046689 Bacteria 3156
200 Ga0495613_0074224 3300046689 Bacteria 2477
201 Ga0495613_0074346 3300046689 Bacteria 2475
202 Ga0495624_0047489 3300046690 Bacteria 2728
203 Ga0495581_0036380 3300047315 Bacteria 2848
204 Ga0495604_0087647 3300047317 Bacteria 2318
205 Ga0495674_0040716 3300047319 Bacteria 4153
206 Ga0495676_0003074 3300047321 Bacteria 15092
207 Ga0495684_0024805 3300047471 Bacteria 4611
208 Ga0495684_0054364 3300047471 Bacteria 3054
209 Ga0495686_0010906 3300047472 Bacteria 6435
210 Ga0495686_0012414 3300047472 Bacteria 5960
211 Ga0495686_0032875 3300047472 Bacteria 3354
212 Ga0495686_0056628 3300047472 Bacteria 2449
213 Ga0495614_0051051 3300048089 Bacteria 1772
214 Ga0496104_0000019 3300048907 Bacteria 249440
215 Ga0496107_0035155 3300048910 Bacteria 3592
216 Ga0496109_0436665 3300048912 Bacteria 1237
217 Ga0496115_0023158 3300048918 Bacteria 4819
218 Ga0496126_0000005 3300048929 Bacteria 891906
219 Ga0496126_0000020 3300048929 Bacteria 490805
220 Ga0496126_0034609 3300048929 Bacteria 4743
221 Ga0496126_0143050 3300048929 Bacteria 2057
222 Ga0496126_0143062 3300048929 Unclassified 2057
223 Ga0496126_0147774 3300048929 Bacteria 2017
224 Ga0495682_0028160 3300049460 Bacteria 2083
225 Ga0495682_0037785 3300049460 Bacteria 1775
226 Ga0501033_0225183 3300049570 Bacteria 1334
227 Ga0501034_0000697 3300049571 Bacteria 51021
228 Ga0501036_0139017 3300049572 Bacteria 2050
229 Ga0501040_0197155 3300049576 Bacteria 1429
230 Ga0501041_0014718 3300049577 Bacteria 4645
231 Ga0501042_0053406 3300049578 Bacteria 2883
232 Ga0501046_0011711 3300049580 Bacteria 7492
233 Ga0501047_0209551 3300049581 Bacteria 1808
234 Ga0501048_0196795 3300049582 Bacteria 1429
235 Ga0501071_0158848 3300049587 Bacteria 1689
236 Ga0501072_0027693 3300049588 Bacteria 4421
237 Ga0501074_0096636 3300049590 Bacteria 2115
238 Ga0501075_0021098 3300049591 Bacteria 4747
239 Ga0501080_0079195 3300049742 Bacteria 3055
240 Ga0501080_0106578 3300049742 Bacteria 2597
241 Ga0501081_0102481 3300049743 Bacteria 2024
242 Ga0501083_0164128 3300049744 Bacteria 1452
243 Ga0501044_0001174 3300049823 Bacteria 31048
244 Ga0501044_0012361 3300049823 Bacteria 9240
245 Ga0501044_0053241 3300049823 Bacteria 4165
246 Ga0501044_0295269 3300049823 Bacteria 1551
247 Ga0501045_0008664 3300049824 Bacteria 7093
248 nmdc:mga0k408_62797_c1 3300050493 Bacteria 2160
249 nmdc:mga04h51_42714_c1 3300050495 Bacteria 1488
250 nmdc:mga0qj67_69028_c1 3300050509 Bacteria 2818
251 Ga0500643_007546 3300053087 Bacteria 4367
252 Ga0500651_0000006 3300053093 Bacteria 305844
253 Ga0500595_000047 3300053119 Bacteria 90317
254 Ga0500595_052108 3300053119 Bacteria 1265
255 Ga0501084_0017667 3300054114 Bacteria 5934
256 Ga0500661_003045 3300055283 Bacteria 3151
257 Ga0501082_0097675 3300060353 Bacteria 2539
258 Ga0501034_0012901
259 rootH2_10121148
260 Ga0070658_10000010
261 Ga0070658_10167067
262 Ga0070658_10227395
263 Ga0070683_100164801
264 Ga0070683_100249273
265 Ga0070680_100052364
266 Ga0070682_100082129
267 Ga0068868_100048315
268 Ga0070660_100001412
269 Ga0070660_100024959
270 Ga0070660_100528019
271 Ga0070661_100035046
272 Ga0070668_100058416
273 Ga0070675_100013128
274 Ga0070675_100113234
275 Ga0070674_100123460
276 Ga0070673_100056308
277 Ga0070667_100053432
278 Ga0070663_100001789
279 Ga0070663_100108748
280 Ga0070663_100404180
281 Ga0070678_100021834
282 Ga0070662_100036298
283 Ga0070681_10086429
284 Ga0068867_100282709
285 Ga0070679_100001011
286 Ga0070679_100010225
287 Ga0070679_100305504
288 Ga0070684_100318186
289 Ga0068853_100043683
290 Ga0068853_100063614
291 Ga0070672_100036620
292 Ga0070665_100033133
293 Ga0070665_100257480
294 Ga0068855_100006862
295 Ga0068855_100014200
296 Ga0068855_100031060
297 Ga0068855_100051423
298 Ga0068855_100052775
299 Ga0068855_100083771
300 Ga0068855_100220574
301 Ga0068855_100371185
302 Ga0068857_100024069
303 Ga0068854_100148288
304 Ga0068856_100021028
305 Ga0068856_100339371
306 Ga0068852_100021567
307 Ga0068852_100028127
308 Ga0068852_100080261
309 Ga0068852_100160844
310 Ga0068864_100098795
311 Ga0068866_10043086
312 Ga0068851_10046022
313 Ga0068863_100022816
314 Ga0068858_100047378
315 Ga0068858_100376310
316 Ga0070717_10001200
317 Ga0075368_10002113
318 Ga0075367_10177186
319 Ga0075366_10056337
320 Ga0097621_100063500
321 Ga0068871_100029982
322 Ga0075430_100004600
323 Ga0075430_100148753
324 Ga0075431_100124295
325 Ga0105240_10008154
326 Ga0105240_10162150
327 Ga0105240_10203099
328 Ga0105240_10269692
329 Ga0105245_10016635
330 Ga0105245_10053369
331 Ga0105245_10608307
332 Ga0105243_10026615
333 Ga0105241_10141753
334 Ga0105248_10020134
335 Ga0105248_10175339
336 Ga0105237_10085928
337 Ga0105237_10394478
338 Ga0105238_10004178
339 Ga0105238_10079160
340 Ga0105238_10215546
341 Ga0105238_10241965
342 Ga0105239_10248093
343 Ga0105239_10304428
344 Ga0105246_10049174
345 Ga0157371_10010847
346 Ga0157371_10068562
347 Ga0157370_10000943
348 Ga0157370_10123782
349 Ga0157369_10074834
350 Ga0157369_10089398
351 Ga0157369_10132164
352 Ga0157369_10187091
353 Ga0157369_10204763
354 Ga0157374_10249898
355 Ga0157378_10127807
356 Ga0157372_10000561
357 Ga0157372_10019354
358 Ga0157372_10104205
359 Ga0157372_11001832
360 Ga0157375_10031203
361 Ga0157375_10223415
362 Ga0163163_10041869
363 Ga0157379_10061848
364 Ga0157376_10014558
365 Ga0224572_1001939
366 Ga0207697_10048784
367 Ga0207645_10032635
368 Ga0207705_10000016
369 Ga0207705_10082830
370 Ga0207705_10183776
371 Ga0207707_10044994
372 Ga0207695_10025799
373 Ga0207695_10202061
374 Ga0207660_10414229
375 Ga0207657_10008906
376 Ga0207649_10115579
377 Ga0207652_10005373
378 Ga0207652_10009604
379 Ga0207694_10001605
380 Ga0207694_10035987
381 Ga0207700_10099949
382 Ga0207664_10311427
383 Ga0207691_10022485
384 Ga0207711_10010800
385 Ga0207711_10327956
386 Ga0207661_10228288
387 Ga0207667_10004127
388 Ga0207667_10009723
389 Ga0207667_10072985
390 Ga0207667_10135991
391 Ga0207667_10168940
392 Ga0207651_10107310
393 Ga0207668_10241284
394 Ga0207640_10235792
395 Ga0207677_10150738
396 Ga0207703_10319642
397 Ga0207639_10130644
398 Ga0207639_10255738
399 Ga0207678_10001482
400 Ga0207641_10121378
401 Ga0207648_10139734
402 Ga0207683_10002695
403 Ga0207698_10015369
404 Ga0207698_10296862
405 Ga0207698_10353832
406 Ga0209813_10052472
407 Ga0268266_10130315
408 Ga0268266_10231260
409 Ga0268264_10102402
410 Ga0265338_10022605
411 Ga0265760_10036086
412 Ga0265316_10010271
413 Ga0265314_10000139
414 Ga0265314_10011615
415 Ga0307410_10061183
416 Ga0307406_10447288
417 Ga0307407_10044073
418 Ga0307409_100064114
419 Ga0307409_100134608
420 Ga0307409_100178281
421 Ga0307411_10017961
422 Ga0307510_10026884
423 Ga0307510_10247927
424 Ga0373937_0013926
425 Ga0395898_0210994
426 Ga0436361_0773113
427 Ga0451576_0019358
428 Ga0495603_0116018
429 Ga0495629_0020298
430 Ga0495651_0031494
431 Ga0495650_0000006
432 Ga0495650_0012556
433 Ga0495580_0279079
434 Ga0495639_0021513
435 Ga0495662_0002219
436 Ga0495664_0068637
437 Ga0495594_0000247
438 Ga0495583_0021374
439 Ga0495606_0085871
440 Ga0495608_0115093
441 Ga0495618_0270859
442 Ga0495643_0025003
443 Ga0495666_0001084
444 Ga0495642_0046699
445 Ga0495640_0029363
446 Ga0495640_0166873
447 Ga0495586_0010348
448 Ga0495667_0017049
449 Ga0495668_0040805
450 Ga0495668_0065877
451 Ga0495625_0001149
452 Ga0495661_0014845
453 Ga0495661_0073346
454 Ga0495599_0003948
455 Ga0495613_0001678
456 Ga0495613_0047910
457 Ga0495613_0074224
458 Ga0495613_0074346
459 Ga0495624_0047489
460 Ga0495581_0036380
461 Ga0495604_0087647
462 Ga0495674_0040716
463 Ga0495676_0003074
464 Ga0495684_0024805
465 Ga0495684_0054364
466 Ga0495686_0010906
467 Ga0495686_0012414
468 Ga0495686_0032875
469 Ga0495686_0056628
470 Ga0495614_0051051
471 Ga0496104_0000019
472 Ga0496107_0035155
473 Ga0496109_0436665
474 Ga0496115_0023158
475 Ga0496126_0000005
476 Ga0496126_0000020
477 Ga0496126_0034609
478 Ga0496126_0143050
479 Ga0496126_0143062
480 Ga0496126_0147774
481 Ga0495682_0028160
482 Ga0495682_0037785
483 Ga0501033_0225183
484 Ga0501034_0000697
485 Ga0501036_0139017
486 Ga0501040_0197155
487 Ga0501041_0014718
488 Ga0501042_0053406
489 Ga0501046_0011711
490 Ga0501047_0209551
491 Ga0501048_0196795
492 Ga0501071_0158848
493 Ga0501072_0027693
494 Ga0501074_0096636
495 Ga0501075_0021098
496 Ga0501080_0079195
497 Ga0501080_0106578
498 Ga0501081_0102481
499 Ga0501083_0164128
500 Ga0501044_0001174
501 Ga0501044_0012361
502 Ga0501044_0053241
503 Ga0501044_0295269
504 Ga0501045_0008664
505 nmdc:mga0k408_62797_c1
506 nmdc:mga04h51_42714_c1
507 nmdc:mga0qj67_69028_c1
508 Ga0500643_007546
509 Ga0500651_0000006
510 Ga0500595_000047
511 Ga0500595_052108
512 Ga0501084_0017667
513 Ga0500661_003045
514 Ga0501082_0097675

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

72

172

0.95

PF08242

Methyltransf_12

Methyltransferase domain

72

170

0.92

PF13649

Methyltransf_25

Methyltransferase domain

71

168

0.91

PF13847

Methyltransf_31

Methyltransferase domain

65

234

0.91

PF13489

Methyltransf_23

Methyltransferase domain

51

219

0.86

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

59

207

0.83

PF01135

PCMT

Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)

36

173

0.82

PF06325

PrmA

Ribosomal protein L11 methyltransferase (PrmA)

59

180

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ve3-assembly1.cif.gz_A-3 crystal structure of ph0226 protein from pyrococcus horikoshii ot3 0.865 68 171
2yxe-assembly1.cif.gz_B crystal structure of l-isoaspartyl protein carboxyl methyltranferase 0.8517 59 171
7r6k-assembly1.cif.gz_q state e2 nucleolar 60s ribosomal intermediate - model for noc2/noc3 region 0.8428 58 163
3c3p-assembly1.cif.gz_B crystal structure of a methyltransferase (np_951602.1) from geobacter sulfurreducens at 1.90 a resolution 0.8416 68 170
5fhr-assembly1.cif.gz_B crystal structure of y200l mutant of rat catechol-o-methyltransferase in complex with adomet and 3,5-dinitrocatechol 0.8386 68 141
ID Description Score Start End Superfamily
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9294 62 127 3.40.50.150
af_A0A0R0FLG0_1_109_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9219 63 113 3.40.50.150
af_K7LTE4_237_888_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9203 58 127 3.40.50.150
af_K7KE15_1_124_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9057 58 170 3.40.50.150
af_C0H5A2_481_622_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8991 64 122 3.40.50.150
ID Description Score Start End GO Terms
AF-J7T967-F1-model_v4 deleted 0.9769 53 181
AF-A0A1Z4T6Q9-F1-model_v4 deleted 0.96 63 170
AF-A0A2H0AUX0-F1-model_v4 Methyltransferase domain-containing protein 0.9476 63 122 GO:0016020
AF-X1HEA1-F1-model_v4 Methyltransferase type 11 domain-containing protein 0.945 63 170 GO:0008757
GO:0032259
AF-A0A838J840-F1-model_v4 Arsenite methyltransferase (EC 2.1.1.137) 0.9338 41 145 GO:0008168
GO:0032259

Map