F367640

General Info

Members Datasets Scaffolds Average Seq Length
257 165 256 124

Family's Representative Sequence

Representative Sequence 3300049581|Ga0501047_0330160|Ga0501047_0330160_415_810
Length 131
Sequence MLQIKRAYEEPTSKDGQRILVDRLWPRGLTKARAAIDLWMKEVAPSPALRKWFAHDPAKWKQFQQRYFKELQEHPQAVDQLRKKARRGRVTLVHSARDEQHNGALALKAYLERGVQRTSKSRVEPQKRVQS

Samples

Sample ID Description Type Environment
1 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
51 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
52 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
72 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
74 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
75 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
76 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
77 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
78 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
79 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
80 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
81 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
82 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
83 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
84 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
85 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
87 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
88 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
89 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
90 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
91 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
92 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
93 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
94 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
95 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
96 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
97 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
98 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
99 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
100 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
101 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
102 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
103 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
104 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
105 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
106 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
107 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
108 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
109 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
110 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
111 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
112 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
113 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
114 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
115 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
116 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
131 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
132 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
133 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
134 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
135 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
136 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
137 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
138 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
139 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
140 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
141 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
142 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
145 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
146 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
147 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
148 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
149 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
150 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
151 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
152 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
153 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300059608 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.94
Metatranscriptomes 4.67
Isolates 0.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.56
Nodule 0.39
Rhizoplane 0.39
Rhizosphere 91.44
Stem 0
Stem Tuber 0
Unclassified 6.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10248658 3300003320 Bacteria 2669
2 rootH1_10152172 3300003323 Bacteria 2034
3 rootH1_10248646 3300003323 Bacteria 2198
4 rootH1_10306382 3300003323 Unclassified 1144
5 Ga0070658_10058918 3300005327 Unclassified 3127
6 Ga0070683_100237774 3300005329 Bacteria 1732
7 Ga0070680_100489863 3300005336 Unclassified 1051
8 Ga0070660_100026077 3300005339 Bacteria 4350
9 Ga0070687_100353279 3300005343 Bacteria 949
10 Ga0070675_101228586 3300005354 Unclassified 690
11 Ga0070703_10011920 3300005406 Bacteria 2459
12 Ga0070714_100031378 3300005435 Unclassified 4433
13 Ga0070713_100666513 3300005436 Bacteria 992
14 Ga0070708_100304196 3300005445 Bacteria 1501
15 Ga0070708_100785010 3300005445 Bacteria 895
16 Ga0070681_10058539 3300005458 Bacteria 3833
17 Ga0070681_10154335 3300005458 Bacteria 2222
18 Ga0070681_10168164 3300005458 Bacteria 2115
19 Ga0070706_100069184 3300005467 Unclassified 3265
20 Ga0070699_100065144 3300005518 Unclassified 3161
21 Ga0070679_100000727 3300005530 Bacteria 28440
22 Ga0070679_100044243 3300005530 Bacteria 4436
23 Ga0070684_100908610 3300005535 Unclassified 825
24 Ga0070684_102055369 3300005535 Bacteria 539
25 Ga0070697_100049580 3300005536 Unclassified 3408
26 Ga0070697_100065086 3300005536 Bacteria 2978
27 Ga0070697_100461214 3300005536 Bacteria 1108
28 Ga0068853_100506881 3300005539 Unclassified 1140
29 Ga0070686_100118087 3300005544 Bacteria 1817
30 Ga0070696_100014884 3300005546 Bacteria 5223
31 Ga0070665_100059245 3300005548 Bacteria 3838
32 Ga0068855_100010813 3300005563 Bacteria 11019
33 Ga0068855_100020615 3300005563 Bacteria 7905
34 Ga0068855_100564845 3300005563 Bacteria 1230
35 Ga0068857_100925266 3300005577 Unclassified 837
36 Ga0068854_100231354 3300005578 Bacteria 1467
37 Ga0068856_100037230 3300005614 Bacteria 4773
38 Ga0068856_100526065 3300005614 Bacteria 1204
39 Ga0068852_100000021 3300005616 Bacteria 126061
40 Ga0068852_100189984 3300005616 Unclassified 1937
41 Ga0068852_100533718 3300005616 Bacteria 1172
42 Ga0068861_101173458 3300005719 Unclassified 741
43 Ga0068863_101834825 3300005841 Bacteria 616
44 Ga0070717_10058051 3300006028 Bacteria 3200
45 Ga0070712_100484210 3300006175 Bacteria 1035
46 Ga0075433_10257661 3300006852 Bacteria 1547
47 Ga0075434_100681465 3300006871 Bacteria 1046
48 Ga0068865_100378398 3300006881 Bacteria 1154
49 Ga0075436_100025290 3300006914 Bacteria 4085
50 Ga0105240_10012314 3300009093 Bacteria 11817
51 Ga0111539_10083531 3300009094 Bacteria 3755
52 Ga0105245_11474153 3300009098 Unclassified 731
53 Ga0114129_10038210 3300009147 Bacteria 6773
54 Ga0114129_10382626 3300009147 Unclassified 1858
55 Ga0105237_10024989 3300009545 Bacteria 6111
56 Ga0105237_10292039 3300009545 Unclassified 1633
57 Ga0105237_10637372 3300009545 Bacteria 1073
58 Ga0105237_12132922 3300009545 Bacteria 570
59 Ga0105238_10027816 3300009551 Bacteria 5762
60 Ga0105238_10051450 3300009551 Bacteria 4143
61 Ga0105238_10596710 3300009551 Bacteria 1112
62 Ga0105239_10643723 3300010375 Bacteria 1210
63 Ga0105239_11260549 3300010375 Unclassified 852
64 Ga0105239_11463420 3300010375 Unclassified 789
65 Ga0157373_11323637 3300013100 Unclassified 546
66 Ga0157371_10136439 3300013102 Bacteria 1747
67 Ga0157370_10000067 3300013104 Bacteria 113351
68 Ga0157370_10013909 3300013104 Bacteria 8263
69 Ga0157369_10011102 3300013105 Bacteria 10248
70 Ga0157369_10034716 3300013105 Bacteria 5532
71 Ga0157369_10111657 3300013105 Bacteria 2905
72 Ga0157369_10372577 3300013105 Bacteria 1482
73 Ga0157369_11219154 3300013105 Bacteria 768
74 Ga0157369_11517989 3300013105 Bacteria 681
75 Ga0157369_12265253 3300013105 Unclassified 551
76 Ga0157374_10852704 3300013296 Bacteria 928
77 Ga0157372_10013430 3300013307 Bacteria 8749
78 Ga0157372_10070399 3300013307 Bacteria 3935
79 Ga0157372_10071062 3300013307 Bacteria 3918
80 Ga0157372_10239801 3300013307 Bacteria 2104
81 Ga0157372_10306198 3300013307 Bacteria 1849
82 Ga0157372_10414528 3300013307 Unclassified 1570
83 Ga0157372_10592608 3300013307 Bacteria 1292
84 Ga0157379_10003366 3300014968 Bacteria 13526
85 Ga0209025_1019543 3300025294 Bacteria 3761
86 Ga0209257_1082497 3300025304 Bacteria 821
87 Ga0207705_10407955 3300025909 Bacteria 1051
88 Ga0207684_10095013 3300025910 Bacteria 2543
89 Ga0207707_10014491 3300025912 Bacteria 6866
90 Ga0207695_10036566 3300025913 Bacteria 5308
91 Ga0207695_10369870 3300025913 Bacteria 1320
92 Ga0207671_10444045 3300025914 Unclassified 1033
93 Ga0207657_10030312 3300025919 Bacteria 4910
94 Ga0207657_10375993 3300025919 Unclassified 1119
95 Ga0207646_10023292 3300025922 Bacteria 5690
96 Ga0207694_11429092 3300025924 Unclassified 584
97 Ga0207700_11142387 3300025928 Bacteria 696
98 Ga0207664_10224775 3300025929 Unclassified 1629
99 Ga0207690_11849562 3300025932 Bacteria 504
100 Ga0207670_11598399 3300025936 Bacteria 554
101 Ga0207661_10300027 3300025944 Bacteria 1440
102 Ga0207667_10027597 3300025949 Bacteria 6176
103 Ga0207667_10410164 3300025949 Unclassified 1379
104 Ga0207639_10946062 3300026041 Unclassified 806
105 Ga0207702_10134835 3300026078 Bacteria 2226
106 Ga0207702_10956047 3300026078 Bacteria 849
107 Ga0207674_10259615 3300026116 Unclassified 1684
108 Ga0207674_10684772 3300026116 Unclassified 990
109 Ga0207698_10049306 3300026142 Bacteria 3204
110 Ga0207428_10267748 3300027907 Bacteria 1271
111 Ga0268266_10060634 3300028379 Bacteria 3261
112 Ga0307517_10034329 3300028786 Bacteria 5782
113 Ga0307405_11178272 3300031731 Bacteria 662
114 Ga0307413_10949790 3300031824 Bacteria 733
115 Ga0307407_10034682 3300031903 Bacteria 2765
116 Ga0307409_101144110 3300031995 Bacteria 800
117 Ga0307416_101033012 3300032002 Bacteria 925
118 Ga0307414_10215057 3300032004 Bacteria 1574
119 Ga0307411_10721823 3300032005 Bacteria 870
120 Ga0307415_100439715 3300032126 Bacteria 1124
121 Ga0373959_0084004 3300034820 Bacteria 737
122 Ga0373934_0459535 3300035086 Unclassified 534
123 Ga0373931_0049027 3300035691 Bacteria 2241
124 Ga0373937_0148768 3300036401 Bacteria 2193
125 Ga0395905_0248147 3300037471 Unclassified 1663
126 Ga0395905_1864200 3300037471 Bacteria 507
127 Ga0451577_0020747 3300042876 Bacteria 6023
128 Ga0453683_0336897 3300044673 Bacteria 968
129 Ga0451576_0000319 3300045051 Bacteria 116651
130 Ga0495592_0126383 3300046454 Bacteria 1793
131 Ga0495651_0042845 3300046462 Bacteria 3513
132 Ga0495651_0068247 3300046462 Bacteria 2710
133 Ga0495628_0538954 3300046516 Bacteria 839
134 Ga0495652_0030807 3300046529 Bacteria 4701
135 Ga0495645_0002823 3300046543 Bacteria 11783
136 Ga0495656_0238445 3300046615 Bacteria 915
137 Ga0495668_0083338 3300046616 Bacteria 1754
138 Ga0495599_0626420 3300046678 Unclassified 625
139 Ga0495623_0008896 3300046679 Bacteria 6518
140 Ga0495623_0019730 3300046679 Bacteria 4358
141 Ga0495646_0069010 3300046680 Bacteria 2086
142 Ga0495669_0032412 3300046684 Bacteria 2297
143 Ga0495674_0049201 3300047319 Bacteria 3726
144 Ga0495675_0196228 3300047444 Bacteria 1230
145 Ga0495677_0376460 3300047445 Bacteria 561
146 Ga0495602_0045460 3300048088 Bacteria 3973
147 Ga0495602_0236617 3300048088 Bacteria 1368
148 Ga0496102_1276157 3300048905 Bacteria 654
149 Ga0496116_0012906 3300048919 Bacteria 6782
150 Ga0496116_0044622 3300048919 Bacteria 3009
151 Ga0496117_0058846 3300048920 Bacteria 2659
152 Ga0496118_0156598 3300048921 Unclassified 1416
153 Ga0496119_0077205 3300048922 Bacteria 1930
154 Ga0496120_0157716 3300048923 Bacteria 1134
155 Ga0496122_0127805 3300048925 Unclassified 1622
156 Ga0496123_0052581 3300048926 Bacteria 2701
157 Ga0496124_0000434 3300048927 Bacteria 74161
158 Ga0496125_0003034 3300048928 Bacteria 21003
159 Ga0496126_0148005 3300048929 Bacteria 2015
160 Ga0501032_0329616 3300049569 Bacteria 984
161 Ga0501033_0005076 3300049570 Bacteria 10474
162 Ga0501033_0013659 3300049570 Bacteria 6179
163 Ga0501033_0145964 3300049570 Bacteria 1708
164 Ga0501034_0000429 3300049571 Bacteria 69803
165 Ga0501034_0041544 3300049571 Bacteria 4653
166 Ga0501036_0078736 3300049572 Bacteria 2788
167 Ga0501036_0143460 3300049572 Bacteria 2014
168 Ga0501036_1096401 3300049572 Unclassified 650
169 Ga0501037_0063849 3300049573 Bacteria 2684
170 Ga0501037_0491580 3300049573 Bacteria 833
171 Ga0501038_0019944 3300049574 Bacteria 6034
172 Ga0501038_0020522 3300049574 Bacteria 5938
173 Ga0501039_0035809 3300049575 Bacteria 3831
174 Ga0501040_0218799 3300049576 Archaea 1355
175 Ga0501040_0766341 3300049576 Bacteria 698
176 Ga0501041_0246775 3300049577 Bacteria 1122
177 Ga0501041_0940639 3300049577 Bacteria 556
178 Ga0501042_0405235 3300049578 Unclassified 988
179 Ga0501042_0849720 3300049578 Bacteria 664
180 Ga0501043_0021156 3300049579 Bacteria 5099
181 Ga0501043_0063295 3300049579 Bacteria 2905
182 Ga0501043_0817604 3300049579 Bacteria 673
183 Ga0501043_1269149 3300049579 Bacteria 515
184 Ga0501046_0127887 3300049580 Bacteria 1928
185 Ga0501047_0057775 3300049581 Bacteria 3751
186 Ga0501047_0224102 3300049581 Bacteria 1736
187 Ga0501047_0242399 3300049581 Unclassified 1653
188 Ga0501047_0330160 3300049581 Bacteria 1364
189 Ga0501047_0632161 3300049581 Archaea 890
190 Ga0501048_0038353 3300049582 Bacteria 3437
191 Ga0501048_0077805 3300049582 Bacteria 2341
192 Ga0501067_0002413 3300049583 Bacteria 10330
193 Ga0501069_0070546 3300049585 Bacteria 1957
194 Ga0501070_0009587 3300049586 Bacteria 8179
195 Ga0501070_0028570 3300049586 Bacteria 4678
196 Ga0501070_0921911 3300049586 Bacteria 681
197 Ga0501070_1250840 3300049586 Unclassified 568
198 Ga0501071_0038453 3300049587 Bacteria 3420
199 Ga0501071_0173186 3300049587 Unclassified 1616
200 Ga0501073_0058823 3300049589 Bacteria 2685
201 Ga0501074_0243655 3300049590 Unclassified 1278
202 Ga0501075_0044225 3300049591 Bacteria 3341
203 Ga0501075_0129456 3300049591 Bacteria 1923
204 Ga0501076_0062661 3300049592 Unclassified 2962
205 Ga0501076_0524789 3300049592 Unclassified 976
206 Ga0501077_0408269 3300049593 Unclassified 868
207 Ga0501079_0043585 3300049741 Bacteria 3463
208 Ga0501079_0383893 3300049741 Unclassified 1101
209 Ga0501080_0009051 3300049742 Bacteria 9061
210 Ga0501080_0028638 3300049742 Bacteria 5185
211 Ga0501080_0699044 3300049742 Unclassified 894
212 Ga0501080_0760126 3300049742 Bacteria 852
213 Ga0501080_1288641 3300049742 Unclassified 626
214 Ga0501083_0012906 3300049744 Bacteria 5838
215 Ga0501083_0103657 3300049744 Bacteria 1874
216 Ga0501035_0095212 3300049822 Bacteria 2617
217 Ga0501035_0628514 3300049822 Bacteria 872
218 Ga0501035_0924907 3300049822 Unclassified 689
219 Ga0501044_0003132 3300049823 Bacteria 18736
220 Ga0501044_0009239 3300049823 Bacteria 10766
221 Ga0501044_0035822 3300049823 Bacteria 5195
222 Ga0501044_0040604 3300049823 Bacteria 4848
223 Ga0501044_0185913 3300049823 Bacteria 2043
224 Ga0501044_0368385 3300049823 Bacteria 1353
225 Ga0501044_0427153 3300049823 Archaea 1234
226 Ga0501044_1303546 3300049823 Bacteria 593
227 Ga0501045_0063503 3300049824 Bacteria 2710
228 Ga0501045_0150233 3300049824 Bacteria 1733
229 Ga0501045_0491401 3300049824 Unclassified 911
230 Ga0501045_0899437 3300049824 Unclassified 650
231 nmdc:mga05p37_393530_c1 3300050507 Bacteria 1620
232 nmdc:mga05p37_61720_c1 3300050507 Bacteria 4614
233 nmdc:mga08y16_93365_c1 3300050511 Bacteria 3135
234 nmdc:mga0n895_929572_c1 3300050512 Unclassified 854
235 nmdc:mga0rr50_244646_c1 3300050513 Bacteria 1488
236 nmdc:mga08x19_65626_c1 3300050514 Bacteria 2358
237 Ga0500566_0489029 3300053094 Unclassified 532
238 Ga0500639_322055 3300053163 Bacteria 566
239 Ga0501084_0025473 3300054114 Bacteria 4936
240 Ga0501084_0065267 3300054114 Bacteria 3045
241 Ga0501084_0113726 3300054114 Bacteria 2275
242 Ga0501084_0332855 3300054114 Unclassified 1282
243 Ga0501084_1563448 3300054114 Unclassified 552
244 Ga0587066_050774 3300059490 Bacteria 816
245 Ga0587073_0205602 3300059492 Bacteria 593
246 Ga0587089_015593 3300059509 Unclassified 1004
247 Ga0587090_059110 3300059510 Bacteria 723
248 Ga0587091_012928 3300059511 Bacteria 1331
249 Ga0587098_065393 3300059604 Bacteria 579
250 Ga0587129_022505 3300059608 Bacteria 568
251 Ga0587113_006329 3300059625 Unclassified 1003
252 Ga0587128_005603 3300059630 Bacteria 1509
253 Ga0587067_059510 3300059640 Bacteria 797
254 Ga0587107_018433 3300059652 Unclassified 946
255 Ga0587114_010638 3300059655 Unclassified 1129
256 Ga0501082_0267886 3300060353 Unclassified 1486

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049579 Ga0501043_1269149 Ga0501043_1269149_185_502 102
2 3300009098 Ga0105245_11474153 Ga0105245_114741532 104
3 3300005548 Ga0070665_100059245 Ga0070665_1000592454 110
4 3300028379 Ga0268266_10060634 Ga0268266_100606343 110
5 3300049570 Ga0501033_0145964 Ga0501033_0145964_349_690 111
6 3300049581 Ga0501047_0242399 Ga0501047_0242399_298_639 111
7 3300049586 Ga0501070_0921911 Ga0501070_0921911_15_356 111
8 3300049822 Ga0501035_0628514 Ga0501035_0628514_31_372 111
9 3300049822 Ga0501035_0924907 Ga0501035_0924907_282_623 111
10 3300049823 Ga0501044_0185913 Ga0501044_0185913_20_361 111
11 iso_pu_bacteria 2615840624 2616294944 111
12 3300014968 Ga0157379_10003366 Ga0157379_1000336612 112
13 3300049570 Ga0501033_0013659 Ga0501033_0013659_5531_5875 112
14 3300049579 Ga0501043_0817604 Ga0501043_0817604_199_543 112
15 3300049823 Ga0501044_0035822 Ga0501044_0035822_328_672 112
16 3300010375 Ga0105239_11463420 Ga0105239_114634202 114
17 3300005327 Ga0070658_10058918 Ga0070658_100589182 115
18 3300005841 Ga0068863_101834825 Ga0068863_1018348252 115
19 3300025294 Ga0209025_1019543 Ga0209025_10195434 115
20 3300025304 Ga0209257_1082497 Ga0209257_10824972 115
21 3300026116 Ga0207674_10684772 Ga0207674_106847722 115
22 3300028786 Ga0307517_10034329 Ga0307517_100343294 115
23 3300046616 Ga0495668_0083338 Ga0495668_0083338_860_1225 115
24 3300046684 Ga0495669_0032412 Ga0495669_0032412_223_588 115
25 3300047445 Ga0495677_0376460 Ga0495677_0376460_72_437 115
26 3300042876 Ga0451577_0020747 Ga0451577_0020747_38_442 116
27 3300048919 Ga0496116_0012906 Ga0496116_0012906_2005_2364 116
28 3300048922 Ga0496119_0077205 Ga0496119_0077205_438_797 116
29 3300048923 Ga0496120_0157716 Ga0496120_0157716_456_815 116
30 3300048925 Ga0496122_0127805 Ga0496122_0127805_1037_1396 116
31 3300048926 Ga0496123_0052581 Ga0496123_0052581_91_450 116
32 3300048927 Ga0496124_0000434 Ga0496124_0000434_41061_41420 116
33 3300048928 Ga0496125_0003034 Ga0496125_0003034_14831_15190 116
34 3300049572 Ga0501036_0078736 Ga0501036_0078736_1401_1778 116
35 3300049574 Ga0501038_0020522 Ga0501038_0020522_1590_1967 116
36 3300049579 Ga0501043_0063295 Ga0501043_0063295_2470_2847 116
37 3300049581 Ga0501047_0057775 Ga0501047_0057775_2164_2541 116
38 3300049823 Ga0501044_0040604 Ga0501044_0040604_953_1330 116
39 3300050513 nmdc:mga0rr50_244646_c1 nmdc:mga0rr50_244646_c1_958_1308 116
40 3300005343 Ga0070687_100353279 Ga0070687_1003532792 117
41 3300005536 Ga0070697_100065086 Ga0070697_1000650864 117
42 3300005544 Ga0070686_100118087 Ga0070686_1001180873 117
43 3300025936 Ga0207670_11598399 Ga0207670_115983992 117
44 3300034820 Ga0373959_0084004 Ga0373959_0084004_267_629 117
45 3300035691 Ga0373931_0049027 Ga0373931_0049027_81_443 117
46 3300049577 Ga0501041_0940639 Ga0501041_0940639_35_412 117
47 3300049581 Ga0501047_0224102 Ga0501047_0224102_815_1168 117
48 3300049586 Ga0501070_0028570 Ga0501070_0028570_1671_2036 117
49 3300049742 Ga0501080_0760126 Ga0501080_0760126_286_663 117
50 3300053094 Ga0500566_0489029 Ga0500566_0489029_102_476 117
51 3300053163 Ga0500639_322055 Ga0500639_322055_44_418 117
52 3300003320 rootH2_10248658 rootH2_102486583 118
53 3300003323 rootH1_10152172 rootH1_101521724 118
54 3300003323 rootH1_10248646 rootH1_102486463 118
55 3300003323 rootH1_10306382 rootH1_103063822 118
56 3300005329 Ga0070683_100237774 Ga0070683_1002377742 118
57 3300005336 Ga0070680_100489863 Ga0070680_1004898632 118
58 3300005339 Ga0070660_100026077 Ga0070660_1000260771 118
59 3300005354 Ga0070675_101228586 Ga0070675_1012285862 118
60 3300005406 Ga0070703_10011920 Ga0070703_100119203 118
61 3300005435 Ga0070714_100031378 Ga0070714_1000313782 118
62 3300005436 Ga0070713_100666513 Ga0070713_1006665131 118
63 3300005445 Ga0070708_100304196 Ga0070708_1003041962 118
64 3300005445 Ga0070708_100785010 Ga0070708_1007850102 118
65 3300005458 Ga0070681_10058539 Ga0070681_100585393 118
66 3300005458 Ga0070681_10154335 Ga0070681_101543351 118
67 3300005458 Ga0070681_10168164 Ga0070681_101681642 118
68 3300005467 Ga0070706_100069184 Ga0070706_1000691842 118
69 3300005518 Ga0070699_100065144 Ga0070699_1000651445 118
70 3300005530 Ga0070679_100000727 Ga0070679_10000072725 118
71 3300005530 Ga0070679_100044243 Ga0070679_1000442434 118
72 3300005535 Ga0070684_100908610 Ga0070684_1009086101 118
73 3300005535 Ga0070684_102055369 Ga0070684_1020553691 118
74 3300005536 Ga0070697_100049580 Ga0070697_1000495806 118
75 3300005536 Ga0070697_100461214 Ga0070697_1004612142 118
76 3300005539 Ga0068853_100506881 Ga0068853_1005068811 118
77 3300005546 Ga0070696_100014884 Ga0070696_1000148842 118
78 3300005563 Ga0068855_100010813 Ga0068855_1000108138 118
79 3300005563 Ga0068855_100020615 Ga0068855_1000206157 118
80 3300005563 Ga0068855_100564845 Ga0068855_1005648452 118
81 3300005577 Ga0068857_100925266 Ga0068857_1009252662 118
82 3300005578 Ga0068854_100231354 Ga0068854_1002313543 118
83 3300005614 Ga0068856_100037230 Ga0068856_1000372305 118
84 3300005614 Ga0068856_100526065 Ga0068856_1005260652 118
85 3300005616 Ga0068852_100000021 Ga0068852_100000021113 118
86 3300005616 Ga0068852_100189984 Ga0068852_1001899843 118
87 3300005616 Ga0068852_100533718 Ga0068852_1005337182 118
88 3300005719 Ga0068861_101173458 Ga0068861_1011734581 118
89 3300006028 Ga0070717_10058051 Ga0070717_100580512 118
90 3300006175 Ga0070712_100484210 Ga0070712_1004842102 118
91 3300006852 Ga0075433_10257661 Ga0075433_102576613 118
92 3300006871 Ga0075434_100681465 Ga0075434_1006814651 118
93 3300006881 Ga0068865_100378398 Ga0068865_1003783982 118
94 3300006914 Ga0075436_100025290 Ga0075436_1000252904 118
95 3300009093 Ga0105240_10012314 Ga0105240_100123149 118
96 3300009094 Ga0111539_10083531 Ga0111539_100835315 118
97 3300009147 Ga0114129_10038210 Ga0114129_100382107 118
98 3300009147 Ga0114129_10382626 Ga0114129_103826262 118
99 3300009545 Ga0105237_10024989 Ga0105237_100249891 118
100 3300009545 Ga0105237_10292039 Ga0105237_102920393 118
101 3300009545 Ga0105237_10637372 Ga0105237_106373722 118
102 3300009545 Ga0105237_12132922 Ga0105237_121329221 118
103 3300009551 Ga0105238_10027816 Ga0105238_100278163 118
104 3300009551 Ga0105238_10051450 Ga0105238_100514503 118
105 3300009551 Ga0105238_10596710 Ga0105238_105967103 118
106 3300010375 Ga0105239_10643723 Ga0105239_106437232 118
107 3300010375 Ga0105239_11260549 Ga0105239_112605492 118
108 3300013100 Ga0157373_11323637 Ga0157373_113236371 118
109 3300013102 Ga0157371_10136439 Ga0157371_101364392 118
110 3300013104 Ga0157370_10000067 Ga0157370_1000006793 118
111 3300013104 Ga0157370_10013909 Ga0157370_100139091 118
112 3300013105 Ga0157369_10011102 Ga0157369_100111029 118
113 3300013105 Ga0157369_10034716 Ga0157369_100347165 118
114 3300013105 Ga0157369_10111657 Ga0157369_101116572 118
115 3300013105 Ga0157369_10372577 Ga0157369_103725772 118
116 3300013105 Ga0157369_11219154 Ga0157369_112191541 118
117 3300013105 Ga0157369_11517989 Ga0157369_115179891 118
118 3300013105 Ga0157369_12265253 Ga0157369_122652532 118
119 3300013296 Ga0157374_10852704 Ga0157374_108527042 118
120 3300013307 Ga0157372_10013430 Ga0157372_100134305 118
121 3300013307 Ga0157372_10070399 Ga0157372_100703994 118
122 3300013307 Ga0157372_10071062 Ga0157372_100710622 118
123 3300013307 Ga0157372_10239801 Ga0157372_102398012 118
124 3300013307 Ga0157372_10306198 Ga0157372_103061984 118
125 3300013307 Ga0157372_10414528 Ga0157372_104145283 118
126 3300013307 Ga0157372_10592608 Ga0157372_105926082 118
127 3300025909 Ga0207705_10407955 Ga0207705_104079552 118
128 3300025910 Ga0207684_10095013 Ga0207684_100950134 118
129 3300025912 Ga0207707_10014491 Ga0207707_100144917 118
130 3300025913 Ga0207695_10036566 Ga0207695_100365663 118
131 3300025913 Ga0207695_10369870 Ga0207695_103698702 118
132 3300025914 Ga0207671_10444045 Ga0207671_104440452 118
133 3300025919 Ga0207657_10030312 Ga0207657_100303123 118
134 3300025919 Ga0207657_10375993 Ga0207657_103759932 118
135 3300025922 Ga0207646_10023292 Ga0207646_100232923 118
136 3300025924 Ga0207694_11429092 Ga0207694_114290922 118
137 3300025928 Ga0207700_11142387 Ga0207700_111423871 118
138 3300025929 Ga0207664_10224775 Ga0207664_102247751 118
139 3300025932 Ga0207690_11849562 Ga0207690_118495621 118
140 3300025944 Ga0207661_10300027 Ga0207661_103000272 118
141 3300025949 Ga0207667_10027597 Ga0207667_100275978 118
142 3300025949 Ga0207667_10410164 Ga0207667_104101642 118
143 3300026041 Ga0207639_10946062 Ga0207639_109460622 118
144 3300026078 Ga0207702_10134835 Ga0207702_101348352 118
145 3300026078 Ga0207702_10956047 Ga0207702_109560471 118
146 3300026116 Ga0207674_10259615 Ga0207674_102596152 118
147 3300026142 Ga0207698_10049306 Ga0207698_100493063 118
148 3300027907 Ga0207428_10267748 Ga0207428_102677481 118
149 3300031731 Ga0307405_11178272 Ga0307405_111782722 118
150 3300031824 Ga0307413_10949790 Ga0307413_109497902 118
151 3300031903 Ga0307407_10034682 Ga0307407_100346822 118
152 3300031995 Ga0307409_101144110 Ga0307409_1011441102 118
153 3300032002 Ga0307416_101033012 Ga0307416_1010330122 118
154 3300032004 Ga0307414_10215057 Ga0307414_102150572 118
155 3300032005 Ga0307411_10721823 Ga0307411_107218232 118
156 3300032126 Ga0307415_100439715 Ga0307415_1004397152 118
157 3300035086 Ga0373934_0459535 Ga0373934_0459535_116_490 118
158 3300036401 Ga0373937_0148768 Ga0373937_0148768_1098_1466 118
159 3300037471 Ga0395905_0248147 Ga0395905_0248147_200_577 118
160 3300037471 Ga0395905_1864200 Ga0395905_1864200_40_441 118
161 3300044673 Ga0453683_0336897 Ga0453683_0336897_429_797 118
162 3300045051 Ga0451576_0000319 Ga0451576_0000319_115672_116034 118
163 3300046454 Ga0495592_0126383 Ga0495592_0126383_481_849 118
164 3300046462 Ga0495651_0042845 Ga0495651_0042845_765_1133 118
165 3300046462 Ga0495651_0068247 Ga0495651_0068247_388_762 118
166 3300046516 Ga0495628_0538954 Ga0495628_0538954_159_527 118
167 3300046529 Ga0495652_0030807 Ga0495652_0030807_3614_3982 118
168 3300046543 Ga0495645_0002823 Ga0495645_0002823_5809_6177 118
169 3300046615 Ga0495656_0238445 Ga0495656_0238445_332_703 118
170 3300046678 Ga0495599_0626420 Ga0495599_0626420_178_546 118
171 3300046679 Ga0495623_0008896 Ga0495623_0008896_288_662 118
172 3300046679 Ga0495623_0019730 Ga0495623_0019730_2033_2401 118
173 3300046680 Ga0495646_0069010 Ga0495646_0069010_1169_1537 118
174 3300047319 Ga0495674_0049201 Ga0495674_0049201_2065_2439 118
175 3300047444 Ga0495675_0196228 Ga0495675_0196228_144_518 118
176 3300048088 Ga0495602_0045460 Ga0495602_0045460_1613_1981 118
177 3300048088 Ga0495602_0236617 Ga0495602_0236617_797_1171 118
178 3300048905 Ga0496102_1276157 Ga0496102_1276157_54_461 118
179 3300048919 Ga0496116_0044622 Ga0496116_0044622_412_771 118
180 3300048920 Ga0496117_0058846 Ga0496117_0058846_1347_1706 118
181 3300048921 Ga0496118_0156598 Ga0496118_0156598_250_609 118
182 3300048929 Ga0496126_0148005 Ga0496126_0148005_1282_1641 118
183 3300049569 Ga0501032_0329616 Ga0501032_0329616_176_559 118
184 3300049570 Ga0501033_0005076 Ga0501033_0005076_4349_4732 118
185 3300049571 Ga0501034_0000429 Ga0501034_0000429_57992_58360 118
186 3300049571 Ga0501034_0041544 Ga0501034_0041544_224_607 118
187 3300049572 Ga0501036_0143460 Ga0501036_0143460_1621_2004 118
188 3300049572 Ga0501036_1096401 Ga0501036_1096401_205_564 118
189 3300049573 Ga0501037_0063849 Ga0501037_0063849_1608_1991 118
190 3300049573 Ga0501037_0491580 Ga0501037_0491580_370_729 118
191 3300049574 Ga0501038_0019944 Ga0501038_0019944_1151_1534 118
192 3300049575 Ga0501039_0035809 Ga0501039_0035809_1701_2084 118
193 3300049576 Ga0501040_0218799 Ga0501040_0218799_279_662 118
194 3300049576 Ga0501040_0766341 Ga0501040_0766341_230_598 118
195 3300049577 Ga0501041_0246775 Ga0501041_0246775_463_828 118
196 3300049578 Ga0501042_0405235 Ga0501042_0405235_110_478 118
197 3300049578 Ga0501042_0849720 Ga0501042_0849720_284_649 118
198 3300049579 Ga0501043_0021156 Ga0501043_0021156_4153_4536 118
199 3300049580 Ga0501046_0127887 Ga0501046_0127887_1475_1858 118
200 3300049581 Ga0501047_0330160 Ga0501047_0330160_415_810 118
201 3300049581 Ga0501047_0632161 Ga0501047_0632161_497_880 118
202 3300049582 Ga0501048_0038353 Ga0501048_0038353_1072_1455 118
203 3300049582 Ga0501048_0077805 Ga0501048_0077805_1840_2235 118
204 3300049583 Ga0501067_0002413 Ga0501067_0002413_8757_9140 118
205 3300049585 Ga0501069_0070546 Ga0501069_0070546_83_466 118
206 3300049586 Ga0501070_0009587 Ga0501070_0009587_1072_1455 118
207 3300049586 Ga0501070_1250840 Ga0501070_1250840_121_516 118
208 3300049587 Ga0501071_0038453 Ga0501071_0038453_1548_1907 118
209 3300049587 Ga0501071_0173186 Ga0501071_0173186_58_453 118
210 3300049589 Ga0501073_0058823 Ga0501073_0058823_71_454 118
211 3300049590 Ga0501074_0243655 Ga0501074_0243655_561_944 118
212 3300049591 Ga0501075_0044225 Ga0501075_0044225_1458_1817 118
213 3300049591 Ga0501075_0129456 Ga0501075_0129456_1353_1718 118
214 3300049592 Ga0501076_0062661 Ga0501076_0062661_2042_2401 118
215 3300049592 Ga0501076_0524789 Ga0501076_0524789_533_916 118
216 3300049593 Ga0501077_0408269 Ga0501077_0408269_137_532 118
217 3300049741 Ga0501079_0043585 Ga0501079_0043585_3038_3421 118
218 3300049741 Ga0501079_0383893 Ga0501079_0383893_119_514 118
219 3300049742 Ga0501080_0009051 Ga0501080_0009051_1150_1533 118
220 3300049742 Ga0501080_0028638 Ga0501080_0028638_2028_2396 118
221 3300049742 Ga0501080_0699044 Ga0501080_0699044_356_718 118
222 3300049742 Ga0501080_1288641 Ga0501080_1288641_216_611 118
223 3300049744 Ga0501083_0012906 Ga0501083_0012906_1302_1697 118
224 3300049744 Ga0501083_0103657 Ga0501083_0103657_1290_1673 118
225 3300049822 Ga0501035_0095212 Ga0501035_0095212_252_635 118
226 3300049823 Ga0501044_0003132 Ga0501044_0003132_4789_5166 118
227 3300049823 Ga0501044_0009239 Ga0501044_0009239_2940_3308 118
228 3300049823 Ga0501044_0368385 Ga0501044_0368385_127_510 118
229 3300049823 Ga0501044_0427153 Ga0501044_0427153_481_864 118
230 3300049823 Ga0501044_1303546 Ga0501044_1303546_12_395 118
231 3300049824 Ga0501045_0063503 Ga0501045_0063503_1066_1449 118
232 3300049824 Ga0501045_0150233 Ga0501045_0150233_612_977 118
233 3300049824 Ga0501045_0491401 Ga0501045_0491401_385_780 118
234 3300049824 Ga0501045_0899437 Ga0501045_0899437_64_423 118
235 3300050507 nmdc:mga05p37_393530_c1 nmdc:mga05p37_393530_c1_945_1349 118
236 3300050507 nmdc:mga05p37_61720_c1 nmdc:mga05p37_61720_c1_4154_4561 118
237 3300050511 nmdc:mga08y16_93365_c1 nmdc:mga08y16_93365_c1_1258_1617 118
238 3300050512 nmdc:mga0n895_929572_c1 nmdc:mga0n895_929572_c1_132_536 118
239 3300050514 nmdc:mga08x19_65626_c1 nmdc:mga08x19_65626_c1_592_975 118
240 3300054114 Ga0501084_0025473 Ga0501084_0025473_3165_3530 118
241 3300054114 Ga0501084_0065267 Ga0501084_0065267_2111_2506 118
242 3300054114 Ga0501084_0113726 Ga0501084_0113726_1061_1444 118
243 3300054114 Ga0501084_0332855 Ga0501084_0332855_693_1052 118
244 3300054114 Ga0501084_1563448 Ga0501084_1563448_59_463 118
245 3300059490 Ga0587066_050774 Ga0587066_050774_130_531 118
246 3300059492 Ga0587073_0205602 Ga0587073_0205602_20_421 118
247 3300059509 Ga0587089_015593 Ga0587089_015593_79_480 118
248 3300059510 Ga0587090_059110 Ga0587090_059110_63_464 118
249 3300059511 Ga0587091_012928 Ga0587091_012928_293_694 118
250 3300059604 Ga0587098_065393 Ga0587098_065393_35_436 118
251 3300059608 Ga0587129_022505 Ga0587129_022505_14_415 118
252 3300059625 Ga0587113_006329 Ga0587113_006329_473_874 118
253 3300059630 Ga0587128_005603 Ga0587128_005603_192_593 118
254 3300059640 Ga0587067_059510 Ga0587067_059510_271_672 118
255 3300059652 Ga0587107_018433 Ga0587107_018433_473_874 118
256 3300059655 Ga0587114_010638 Ga0587114_010638_473_874 118
257 3300060353 Ga0501082_0267886 Ga0501082_0267886_467_850 118

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04343

DUF488

Domain of unknown function DUF488

3

111

0.98

PF22752

DUF488-N3i

Inactive DUF488-N3 subclade

1

129

0.96

PF22751

DUF488-N3a

Active DUF488-N3 subclade

2

114

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
8fr8-assembly1.cif.gz_D structure of mycobacterium smegmatis rsh bound to a 70s translation initiation complex 0.4873 77 113
8cvm-assembly1.cif.gz_n cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map 0.4608 68 113
5mmm-assembly1.cif.gz_P structure of the 70s chloroplast ribosome 0.4561 71 115
4v4w-assembly1.cif.gz_BM structure of a secm-stalled e. coli ribosome complex obtained by fitting atomic models for rna and protein components into cryo-em map emd-1143 0.4555 76 113
7pal-assembly1.cif.gz_n 70s ribosome with a- and p-site trnas in mycoplasma pneumoniae cells 0.4545 76 118
ID Description Score Start End Superfamily
af_G5ED36_2031_2223_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.4884 48 87 1.25.10.10
5zetP01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.4828 77 118 3.30.420.100
af_Q6ZPE2_1107_1532_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.4776 9 116 3.90.190.10
5xymO01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.4764 77 113 3.30.420.100
af_F4I4B6_271_375_1.20.58.1220 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Exo84p, C-terminal helical domain 0.4613 47 85 1.20.58.1220
ID Description Score Start End GO Terms
AF-A0A7V7WUZ4-F1-model_v4 DUF488 family protein 0.9983 1 113
AF-A0A2V9IEJ5-F1-model_v4 DUF488 domain-containing protein 0.9956 1 113
AF-A0A2H5VW72-F1-model_v4 DUF488 domain-containing protein 0.9943 2 113
AF-A0A7C2S619-F1-model_v4 DUF488 domain-containing protein 0.9925 2 113
AF-A0A1S5XZZ7-F1-model_v4 DUF488 domain-containing protein 0.992 2 113

Feature Viewer

pLDDT pTM Quality
94.45 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map