F367776

General Info

Members Datasets Scaffolds Average Seq Length
258 132 242 123

Family's Representative Sequence

Representative Sequence 3300003322|rootL2_10153920|rootL2_101539202
Length 146
Sequence VVKIYLFCYAHHIAIHLLICRPQLLIMIIIINVIFCLSFLVFAYLNLNDIDPWLWVPIYLSAAICCGLVVFHLVYPRVYLCLIAIYLIHATTIYFSKDGVHDWIIKYNRPSLVETMQAEKPYIEKTREFFGLLIIAGALLINYFAA

Samples

Sample ID Description Type Environment
1 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
2 2738541283 Pedobacter sp. OK701 Isolate Unclassified
3 2738541284 Pedobacter sp. YR016 Isolate Unclassified
4 2738541302 Pedobacter sp. CF074 Isolate Unclassified
5 2738543023 Pedobacter sp. OK628 Isolate Unclassified
6 2739367651 Pedobacter sp. OK291 Isolate Unclassified
7 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
8 2818991437 Pedobacter terrae 518 Isolate Unclassified
9 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
10 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
11 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
12 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
13 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
14 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
15 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
16 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
17 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
18 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
19 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
20 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
21 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
22 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
23 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
24 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
25 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
26 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
27 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
61 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
62 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
63 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
67 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
68 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
69 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
70 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
93 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
94 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
95 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
96 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
97 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
98 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
99 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
100 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
101 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
102 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
103 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
104 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
105 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
106 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
107 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
108 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
109 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
110 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
111 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
112 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
113 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
114 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
115 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
116 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
117 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
118 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
119 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
120 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
121 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
124 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
125 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
126 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
128 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
129 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
130 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
131 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
132 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.41
Metatranscriptomes 0
Isolates 6.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.36
Nodule 0
Rhizoplane 1.16
Rhizosphere 85.66
Stem 0
Stem Tuber 0
Unclassified 5.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10000002 3300002067 Bacteria 624895
2 JGI24735J21928_10016714 3300002067 Bacteria 2273
3 JGI25164J39214_1000613 3300002772 Bacteria 15237
4 JGI25165J46597_1001106 3300003214 Bacteria 17078
5 rootH1_10024311 3300003316 Bacteria 10720
6 rootH1_10024311 3300003323 Bacteria 6433
7 rootH2_10021466 3300003320 Bacteria 12680
8 rootH2_10186657 3300003320 Bacteria 2107
9 rootL2_10153920 3300003322 Bacteria 2987
10 rootH1_10021184 3300003323 Bacteria 8168
11 Ga0055530_10002580 3300003791 Bacteria 11485
12 Ga0065714_10002226 3300005288 Bacteria 54034
13 Ga0065714_10004195 3300005288 Bacteria 10540
14 Ga0065714_10005810 3300005288 Bacteria 4946
15 Ga0065714_10064438 3300005288 Bacteria 113441
16 Ga0065714_10105661 3300005288 Bacteria 1562
17 Ga0065714_10108754 3300005288 Bacteria 1510
18 Ga0065704_10070225 3300005289 Bacteria 60561
19 Ga0065704_10196207 3300005289 Bacteria 1150
20 Ga0065704_10212070 3300005289 Unclassified 1105
21 Ga0070658_10087573 3300005327 Bacteria 2563
22 Ga0070658_10493003 3300005327 Unclassified 1058
23 Ga0070683_100510768 3300005329 Bacteria 1148
24 Ga0070680_100085386 3300005336 Bacteria 2608
25 Ga0070680_100730075 3300005336 Bacteria 852
26 Ga0070680_100941537 3300005336 Bacteria 745
27 Ga0070682_100059190 3300005337 Bacteria 2419
28 Ga0070660_100010297 3300005339 Bacteria 6602
29 Ga0070660_100088439 3300005339 Bacteria 2439
30 Ga0070661_101147388 3300005344 Bacteria 649
31 Ga0070674_101169499 3300005356 Unclassified 682
32 Ga0070659_100014438 3300005366 Bacteria 5902
33 Ga0070663_101038215 3300005455 Bacteria 714
34 Ga0070681_10044409 3300005458 Bacteria 4448
35 Ga0070679_100000555 3300005530 Bacteria 31656
36 Ga0070679_100278874 3300005530 Bacteria 1624
37 Ga0070679_101032128 3300005530 Bacteria 766
38 Ga0070679_101408286 3300005530 Bacteria 643
39 Ga0068853_100100641 3300005539 Bacteria 2555
40 Ga0068853_100228405 3300005539 Bacteria 1702
41 Ga0068853_100549166 3300005539 Bacteria 1094
42 Ga0068855_100106243 3300005563 Bacteria 3227
43 Ga0068855_100217868 3300005563 Bacteria 2142
44 Ga0068855_100308709 3300005563 Bacteria 1751
45 Ga0068855_102195457 3300005563 Unclassified 554
46 Ga0068857_100022272 3300005577 Bacteria 5574
47 Ga0068857_100215297 3300005577 Bacteria 1753
48 Ga0068857_100297691 3300005577 Bacteria 1487
49 Ga0068857_101963858 3300005577 Bacteria 573
50 Ga0068854_100050190 3300005578 Bacteria 2984
51 Ga0068854_101279009 3300005578 Bacteria 660
52 Ga0068856_100531854 3300005614 Bacteria 1197
53 Ga0068856_100576620 3300005614 Bacteria 1146
54 Ga0068856_101617236 3300005614 Bacteria 661
55 Ga0068852_100091220 3300005616 Bacteria 2726
56 Ga0068852_101080131 3300005616 Bacteria 822
57 Ga0068852_101598364 3300005616 Unclassified 674
58 Ga0097621_100551219 3300006237 Bacteria 1049
59 Ga0068871_102139629 3300006358 Bacteria 533
60 Ga0105240_10011866 3300009093 Bacteria 12096
61 Ga0105240_10179740 3300009093 Bacteria 2498
62 Ga0105240_12689957 3300009093 Unclassified 513
63 Ga0105243_11407730 3300009148 Bacteria 718
64 Ga0105241_10204892 3300009174 Bacteria 1650
65 Ga0105241_12008937 3300009174 Bacteria 569
66 Ga0105237_10057595 3300009545 Bacteria 3888
67 Ga0105237_10092840 3300009545 Bacteria 3008
68 Ga0105237_10704967 3300009545 Bacteria 1016
69 Ga0105239_10014994 3300010375 Bacteria 8591
70 Ga0105239_10083378 3300010375 Bacteria 3520
71 Ga0105239_10599799 3300010375 Bacteria 1256
72 Ga0157373_10007873 3300013100 Bacteria 7925
73 Ga0157373_10008968 3300013100 Bacteria 7400
74 Ga0157373_10009255 3300013100 Bacteria 7281
75 Ga0157373_10013180 3300013100 Bacteria 6068
76 Ga0157373_10025531 3300013100 Bacteria 4272
77 Ga0157373_10348895 3300013100 Bacteria 1055
78 Ga0157373_11283985 3300013100 Bacteria 554
79 Ga0157371_10000021 3300013102 Bacteria 301017
80 Ga0157371_10001775 3300013102 Bacteria 21813
81 Ga0157371_10003548 3300013102 Bacteria 14072
82 Ga0157371_10004299 3300013102 Bacteria 12498
83 Ga0157371_10005145 3300013102 Bacteria 11150
84 Ga0157371_10005632 3300013102 Bacteria 10519
85 Ga0157371_10018806 3300013102 Bacteria 5103
86 Ga0157371_10079899 3300013102 Bacteria 2316
87 Ga0157371_10273392 3300013102 Bacteria 1219
88 Ga0157371_10321977 3300013102 Bacteria 1122
89 Ga0157371_10838201 3300013102 Bacteria 695
90 Ga0157370_10053008 3300013104 Bacteria 3870
91 Ga0157370_10054364 3300013104 Bacteria 3816
92 Ga0157370_10055606 3300013104 Bacteria 3769
93 Ga0157370_10059269 3300013104 Bacteria 3638
94 Ga0157370_10106203 3300013104 Bacteria 2628
95 Ga0157370_10356156 3300013104 Bacteria 1349
96 Ga0157370_10429727 3300013104 Bacteria 1215
97 Ga0157370_10686308 3300013104 Unclassified 935
98 Ga0157370_10768435 3300013104 Bacteria 877
99 Ga0157370_11509853 3300013104 Bacteria 604
100 Ga0157370_11617167 3300013104 Bacteria 582
101 Ga0157369_10000008 3300013105 Bacteria 309315
102 Ga0157369_10020151 3300013105 Bacteria 7457
103 Ga0157369_10062388 3300013105 Bacteria 4016
104 Ga0157369_10144416 3300013105 Bacteria 2516
105 Ga0157378_10352817 3300013297 Bacteria 1437
106 Ga0163162_10000049 3300013306 Bacteria 122455
107 Ga0157372_10002815 3300013307 Bacteria 18793
108 Ga0157372_10019782 3300013307 Bacteria 7255
109 Ga0157372_10060655 3300013307 Bacteria 4232
110 Ga0157372_10075948 3300013307 Bacteria 3793
111 Ga0157372_10153717 3300013307 Unclassified 2657
112 Ga0157372_10163175 3300013307 Bacteria 2576
113 Ga0157372_10237414 3300013307 Bacteria 2115
114 Ga0157372_10339431 3300013307 Bacteria 1750
115 Ga0157372_10419911 3300013307 Bacteria 1559
116 Ga0157372_11021198 3300013307 Bacteria 958
117 Ga0157375_12159113 3300013308 Bacteria 663
118 Ga0182008_10001116 3300014497 Bacteria 18469
119 Ga0182008_10067501 3300014497 Bacteria 1760
120 Ga0182008_10087736 3300014497 Bacteria 1532
121 Ga0182006_1000267 3300015261 Bacteria 47415
122 Ga0182006_1000407 3300015261 Bacteria 34782
123 Ga0182006_1000805 3300015261 Bacteria 21002
124 Ga0182006_1002776 3300015261 Bacteria 9360
125 Ga0182007_10000003 3300015262 Bacteria 548244
126 Ga0182007_10011989 3300015262 Bacteria 3349
127 Ga0183373_1001 3300015682 Bacteria 1410374
128 Ga0163161_10000124 3300017792 Bacteria 72378
129 Ga0163161_10001012 3300017792 Bacteria 21410
130 Ga0163161_10109503 3300017792 Bacteria 2063
131 Ga0163161_10291201 3300017792 Bacteria 1283
132 Ga0209563_121515 3300025230 Bacteria 710
133 Ga0207427_100634 3300025231 Bacteria 17069
134 Ga0209437_100041 3300025233 Bacteria 444465
135 Ga0209437_100715 3300025233 Bacteria 17079
136 Ga0209129_1004121 3300025258 Bacteria 5898
137 Ga0209233_1000650 3300025261 Bacteria 17080
138 Ga0209233_1002284 3300025261 Bacteria 7144
139 Ga0209455_1022013 3300025272 Bacteria 1224
140 Ga0209676_1000001 3300025292 Bacteria 1852142
141 Ga0209050_1000018 3300025298 Bacteria 723263
142 Ga0207647_10000072 3300025904 Bacteria 79050
143 Ga0207647_10153675 3300025904 Bacteria 1344
144 Ga0207647_10163605 3300025904 Bacteria 1297
145 Ga0207705_10028168 3300025909 Bacteria 4005
146 Ga0207705_10059038 3300025909 Bacteria 2767
147 Ga0207705_10177874 3300025909 Bacteria 1605
148 Ga0207705_10799678 3300025909 Unclassified 732
149 Ga0207654_10007848 3300025911 Bacteria 5381
150 Ga0207654_10448050 3300025911 Bacteria 905
151 Ga0207707_10330614 3300025912 Bacteria 1315
152 Ga0207695_10000267 3300025913 Bacteria 131133
153 Ga0207695_10102976 3300025913 Bacteria 2847
154 Ga0207695_10397954 3300025913 Unclassified 1262
155 Ga0207695_10425417 3300025913 Bacteria 1212
156 Ga0207671_10002145 3300025914 Bacteria 21527
157 Ga0207671_10019673 3300025914 Bacteria 5157
158 Ga0207671_10044432 3300025914 Bacteria 3286
159 Ga0207660_10064150 3300025917 Bacteria 2650
160 Ga0207660_10119590 3300025917 Bacteria 1994
161 Ga0207660_10490406 3300025917 Bacteria 996
162 Ga0207657_10009751 3300025919 Bacteria 9628
163 Ga0207657_10023784 3300025919 Bacteria 5697
164 Ga0207657_10622324 3300025919 Unclassified 841
165 Ga0207649_11030178 3300025920 Bacteria 648
166 Ga0207652_10001640 3300025921 Bacteria 19636
167 Ga0207652_10061437 3300025921 Bacteria 3244
168 Ga0207652_10228210 3300025921 Bacteria 1678
169 Ga0207690_10021972 3300025932 Bacteria 3964
170 Ga0207709_10777993 3300025935 Bacteria 771
171 Ga0207661_10298575 3300025944 Bacteria 1444
172 Ga0207667_10029827 3300025949 Bacteria 5909
173 Ga0207667_10218923 3300025949 Bacteria 1951
174 Ga0207667_10436020 3300025949 Unclassified 1332
175 Ga0207640_10091908 3300025981 Bacteria 2104
176 Ga0207640_10699872 3300025981 Bacteria 869
177 Ga0207639_10648775 3300026041 Bacteria 976
178 Ga0207702_10450871 3300026078 Bacteria 1248
179 Ga0207674_10018292 3300026116 Bacteria 7619
180 Ga0207674_10108969 3300026116 Bacteria 2746
181 Ga0207674_10192177 3300026116 Bacteria 1991
182 Ga0207674_10347263 3300026116 Bacteria 1434
183 Ga0207698_11655689 3300026142 Bacteria 655
184 Ga0316176_1065061 3300030732 Bacteria 11660
185 Ga0316183_1013128 3300030742 Bacteria 592
186 Ga0316183_1160955 3300030742 Bacteria 11940
187 Ga0316181_1182971 3300030744 Bacteria 6001
188 Ga0316181_1233599 3300030744 Bacteria 2375
189 Ga0307509_10156528 3300031507 Bacteria 2184
190 Ga0307405_10000042 3300031731 Bacteria 79124
191 Ga0307405_10983759 3300031731 Bacteria 719
192 Ga0307413_10044573 3300031824 Bacteria 2623
193 Ga0307407_10000026 3300031903 Bacteria 108029
194 Ga0307412_10000038 3300031911 Bacteria 187857
195 Ga0307412_10056258 3300031911 Bacteria 2621
196 Ga0307412_10519998 3300031911 Bacteria 994
197 Ga0307409_100014062 3300031995 Bacteria 5186
198 Ga0307416_100000053 3300032002 Bacteria 108029
199 Ga0307414_10002114 3300032004 Bacteria 10354
200 Ga0307414_10014709 3300032004 Bacteria 4701
201 Ga0307414_10051834 3300032004 Bacteria 2851
202 Ga0307414_10123239 3300032004 Bacteria 1997
203 Ga0307414_10360404 3300032004 Bacteria 1251
204 Ga0307414_10376875 3300032004 Unclassified 1226
205 Ga0395905_0201103 3300037471 Unclassified 1868
206 Ga0395901_0223230 3300038443 Bacteria 1969
207 Ga0451802_0047533 3300041460 Bacteria 759
208 Ga0451806_616402 3300041462 Bacteria 1229
209 Ga0466966_0442737 3300044684 Bacteria 781
210 Ga0495651_0081779 3300046462 Bacteria 2438
211 Ga0495653_0850583 3300046463 Unclassified 546
212 Ga0495650_0168308 3300046471 Bacteria 777
213 Ga0495583_0129301 3300046506 Bacteria 1058
214 Ga0495606_0198573 3300046507 Bacteria 1145
215 Ga0495606_0377448 3300046507 Bacteria 744
216 Ga0495610_0002030 3300046512 Bacteria 17317
217 Ga0495610_0002618 3300046512 Bacteria 14904
218 Ga0495631_0145607 3300046518 Bacteria 1017
219 Ga0495644_0003331 3300046523 Bacteria 6354
220 Ga0495625_0009972 3300046660 Bacteria 7902
221 Ga0495625_0035447 3300046660 Bacteria 3678
222 Ga0495661_0005641 3300046665 Bacteria 8874
223 Ga0495661_0508870 3300046665 Unclassified 573
224 Ga0495670_0261849 3300046691 Bacteria 923
225 Ga0495686_0001146 3300047472 Bacteria 31183
226 Ga0495686_0056856 3300047472 Bacteria 2443
227 Ga0496115_1193157 3300048918 Bacteria 572
228 Ga0501033_0326819 3300049570 Bacteria 1077
229 Ga0501033_0442088 3300049570 Bacteria 904
230 Ga0501034_0061251 3300049571 Unclassified 3779
231 Ga0501070_0293046 3300049586 Bacteria 1326
232 Ga0501257_217795 3300049686 Unclassified 555
233 Ga0501241_009067 3300049758 Bacteria 1813
234 Ga0501035_0678326 3300049822 Bacteria 833
235 Ga0501035_0682693 3300049822 Bacteria 830
236 Ga0501044_0116951 3300049823 Bacteria 2671
237 nmdc:mga07m45_145371_c1 3300050496 Unclassified 1084
238 nmdc:mga07m45_206745_c1 3300050496 Bacteria 1142
239 Ga0500650_0334041 3300053098 Bacteria 665
240 Ga0500608_018886 3300053122 Bacteria 3153
241 Ga0500624_000303 3300053157 Bacteria 16855
242 Ga0500634_0141685 3300053161 Bacteria 1138

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2585427687 2586208950 117
2 iso_pu_bacteria 2738541283 2738754572 117
3 iso_pu_bacteria 2738541284 2738761975 117
4 iso_pu_bacteria 2738541302 2738856282 117
5 iso_pu_bacteria 2738543023 2739303854 117
6 iso_pu_bacteria 2739367651 2739590480 117
7 iso_pu_bacteria 2775506987 2776615383 117
8 iso_pu_bacteria 2818991437 2819549365 117
9 iso_pu_bacteria 2842722452 2842724772 117
10 iso_pu_bacteria 2842909656 2842913202 117
11 iso_pu_bacteria 2849281842 2849285506 117
12 iso_pu_bacteria 2852627209 2852630766 117
13 iso_pu_bacteria 2904445276 2904448267 117
14 iso_pu_bacteria 2919186247 2919188883 117
15 iso_pu_bacteria 2939664404 2939666962 117
16 iso_pu_bacteria 2945997725 2946001780 117
17 iso_pu_bacteria 2954016120 2954018603 117
18 3300003323 rootH1_10021184 rootH1_100211844 119
19 3300005327 Ga0070658_10087573 Ga0070658_100875732 119
20 3300013104 Ga0157370_10686308 Ga0157370_106863082 119
21 3300025909 Ga0207705_10177874 Ga0207705_101778743 119
22 3300002067 JGI24735J21928_10000002 JGI24735J21928_10000002100 120
23 3300002067 JGI24735J21928_10016714 JGI24735J21928_100167141 120
24 3300002772 JGI25164J39214_1000613 JGI25164J39214_10006135 120
25 3300003214 JGI25165J46597_1001106 JGI25165J46597_100110614 120
26 3300003316 rootH1_10024311 rootH1_100243112 120
27 3300003320 rootH2_10021466 rootH2_100214667 120
28 3300003320 rootH2_10186657 rootH2_101866573 120
29 3300003322 rootL2_10153920 rootL2_101539202 120
30 3300003791 Ga0055530_10002580 Ga0055530_100025809 120
31 3300005288 Ga0065714_10002226 Ga0065714_1000222632 120
32 3300005288 Ga0065714_10004195 Ga0065714_100041956 120
33 3300005288 Ga0065714_10005810 Ga0065714_100058102 120
34 3300005288 Ga0065714_10064438 Ga0065714_10064438114 120
35 3300005288 Ga0065714_10105661 Ga0065714_101056612 120
36 3300005288 Ga0065714_10108754 Ga0065714_101087542 120
37 3300005289 Ga0065704_10070225 Ga0065704_1007022559 120
38 3300005289 Ga0065704_10196207 Ga0065704_101962072 120
39 3300005289 Ga0065704_10212070 Ga0065704_102120701 120
40 3300005327 Ga0070658_10493003 Ga0070658_104930031 120
41 3300005329 Ga0070683_100510768 Ga0070683_1005107681 120
42 3300005336 Ga0070680_100085386 Ga0070680_1000853863 120
43 3300005336 Ga0070680_100730075 Ga0070680_1007300752 120
44 3300005336 Ga0070680_100941537 Ga0070680_1009415371 120
45 3300005337 Ga0070682_100059190 Ga0070682_1000591903 120
46 3300005339 Ga0070660_100010297 Ga0070660_1000102971 120
47 3300005339 Ga0070660_100088439 Ga0070660_1000884392 120
48 3300005344 Ga0070661_101147388 Ga0070661_1011473881 120
49 3300005356 Ga0070674_101169499 Ga0070674_1011694991 120
50 3300005366 Ga0070659_100014438 Ga0070659_1000144382 120
51 3300005455 Ga0070663_101038215 Ga0070663_1010382152 120
52 3300005458 Ga0070681_10044409 Ga0070681_100444094 120
53 3300005530 Ga0070679_100000555 Ga0070679_10000055518 120
54 3300005530 Ga0070679_100278874 Ga0070679_1002788742 120
55 3300005530 Ga0070679_101032128 Ga0070679_1010321282 120
56 3300005530 Ga0070679_101408286 Ga0070679_1014082861 120
57 3300005539 Ga0068853_100100641 Ga0068853_1001006413 120
58 3300005539 Ga0068853_100228405 Ga0068853_1002284052 120
59 3300005539 Ga0068853_100549166 Ga0068853_1005491662 120
60 3300005563 Ga0068855_100106243 Ga0068855_1001062433 120
61 3300005563 Ga0068855_100217868 Ga0068855_1002178683 120
62 3300005563 Ga0068855_100308709 Ga0068855_1003087092 120
63 3300005563 Ga0068855_102195457 Ga0068855_1021954571 120
64 3300005577 Ga0068857_100022272 Ga0068857_1000222723 120
65 3300005577 Ga0068857_100215297 Ga0068857_1002152971 120
66 3300005577 Ga0068857_100297691 Ga0068857_1002976913 120
67 3300005577 Ga0068857_101963858 Ga0068857_1019638582 120
68 3300005578 Ga0068854_100050190 Ga0068854_1000501902 120
69 3300005578 Ga0068854_101279009 Ga0068854_1012790091 120
70 3300005614 Ga0068856_100531854 Ga0068856_1005318542 120
71 3300005614 Ga0068856_100576620 Ga0068856_1005766202 120
72 3300005614 Ga0068856_101617236 Ga0068856_1016172362 120
73 3300005616 Ga0068852_100091220 Ga0068852_1000912202 120
74 3300005616 Ga0068852_101080131 Ga0068852_1010801312 120
75 3300005616 Ga0068852_101598364 Ga0068852_1015983641 120
76 3300006237 Ga0097621_100551219 Ga0097621_1005512192 120
77 3300006358 Ga0068871_102139629 Ga0068871_1021396291 120
78 3300009093 Ga0105240_10011866 Ga0105240_100118664 120
79 3300009093 Ga0105240_10179740 Ga0105240_101797402 120
80 3300009093 Ga0105240_12689957 Ga0105240_126899571 120
81 3300009148 Ga0105243_11407730 Ga0105243_114077301 120
82 3300009174 Ga0105241_10204892 Ga0105241_102048923 120
83 3300009174 Ga0105241_12008937 Ga0105241_120089371 120
84 3300009545 Ga0105237_10057595 Ga0105237_100575954 120
85 3300009545 Ga0105237_10092840 Ga0105237_100928403 120
86 3300009545 Ga0105237_10704967 Ga0105237_107049672 120
87 3300010375 Ga0105239_10014994 Ga0105239_100149946 120
88 3300010375 Ga0105239_10083378 Ga0105239_100833784 120
89 3300010375 Ga0105239_10599799 Ga0105239_105997992 120
90 3300013100 Ga0157373_10007873 Ga0157373_100078736 120
91 3300013100 Ga0157373_10008968 Ga0157373_100089686 120
92 3300013100 Ga0157373_10009255 Ga0157373_100092553 120
93 3300013100 Ga0157373_10013180 Ga0157373_100131808 120
94 3300013100 Ga0157373_10025531 Ga0157373_100255314 120
95 3300013100 Ga0157373_10348895 Ga0157373_103488952 120
96 3300013100 Ga0157373_11283985 Ga0157373_112839852 120
97 3300013102 Ga0157371_10000021 Ga0157371_1000002193 120
98 3300013102 Ga0157371_10001775 Ga0157371_1000177513 120
99 3300013102 Ga0157371_10003548 Ga0157371_100035483 120
100 3300013102 Ga0157371_10004299 Ga0157371_100042996 120
101 3300013102 Ga0157371_10005145 Ga0157371_100051454 120
102 3300013102 Ga0157371_10005632 Ga0157371_100056324 120
103 3300013102 Ga0157371_10018806 Ga0157371_100188065 120
104 3300013102 Ga0157371_10079899 Ga0157371_100798992 120
105 3300013102 Ga0157371_10273392 Ga0157371_102733922 120
106 3300013102 Ga0157371_10321977 Ga0157371_103219772 120
107 3300013102 Ga0157371_10838201 Ga0157371_108382011 120
108 3300013104 Ga0157370_10053008 Ga0157370_100530082 120
109 3300013104 Ga0157370_10054364 Ga0157370_100543646 120
110 3300013104 Ga0157370_10055606 Ga0157370_100556064 120
111 3300013104 Ga0157370_10059269 Ga0157370_100592694 120
112 3300013104 Ga0157370_10106203 Ga0157370_101062032 120
113 3300013104 Ga0157370_10356156 Ga0157370_103561562 120
114 3300013104 Ga0157370_10429727 Ga0157370_104297272 120
115 3300013104 Ga0157370_10768435 Ga0157370_107684351 120
116 3300013104 Ga0157370_11509853 Ga0157370_115098532 120
117 3300013104 Ga0157370_11617167 Ga0157370_116171671 120
118 3300013105 Ga0157369_10000008 Ga0157369_10000008210 120
119 3300013105 Ga0157369_10020151 Ga0157369_100201514 120
120 3300013105 Ga0157369_10062388 Ga0157369_100623883 120
121 3300013105 Ga0157369_10144416 Ga0157369_101444164 120
122 3300013297 Ga0157378_10352817 Ga0157378_103528172 120
123 3300013306 Ga0163162_10000049 Ga0163162_1000004945 120
124 3300013307 Ga0157372_10002815 Ga0157372_1000281512 120
125 3300013307 Ga0157372_10019782 Ga0157372_100197823 120
126 3300013307 Ga0157372_10060655 Ga0157372_100606551 120
127 3300013307 Ga0157372_10075948 Ga0157372_100759485 120
128 3300013307 Ga0157372_10153717 Ga0157372_101537171 120
129 3300013307 Ga0157372_10163175 Ga0157372_101631752 120
130 3300013307 Ga0157372_10237414 Ga0157372_102374143 120
131 3300013307 Ga0157372_10339431 Ga0157372_103394312 120
132 3300013307 Ga0157372_10419911 Ga0157372_104199113 120
133 3300013307 Ga0157372_11021198 Ga0157372_110211983 120
134 3300013308 Ga0157375_12159113 Ga0157375_121591131 120
135 3300014497 Ga0182008_10001116 Ga0182008_100011165 120
136 3300014497 Ga0182008_10067501 Ga0182008_100675012 120
137 3300014497 Ga0182008_10087736 Ga0182008_100877362 120
138 3300015261 Ga0182006_1000267 Ga0182006_100026718 120
139 3300015261 Ga0182006_1000407 Ga0182006_100040712 120
140 3300015261 Ga0182006_1000805 Ga0182006_100080510 120
141 3300015261 Ga0182006_1002776 Ga0182006_10027766 120
142 3300015262 Ga0182007_10000003 Ga0182007_1000000350 120
143 3300015262 Ga0182007_10011989 Ga0182007_100119895 120
144 3300015682 Ga0183373_1001 Ga0183373_1001920 120
145 3300017792 Ga0163161_10000124 Ga0163161_1000012427 120
146 3300017792 Ga0163161_10001012 Ga0163161_1000101211 120
147 3300017792 Ga0163161_10109503 Ga0163161_101095031 120
148 3300017792 Ga0163161_10291201 Ga0163161_102912012 120
149 3300025230 Ga0209563_121515 Ga0209563_1215152 120
150 3300025231 Ga0207427_100634 Ga0207427_10063412 120
151 3300025233 Ga0209437_100041 Ga0209437_100041276 120
152 3300025233 Ga0209437_100715 Ga0209437_10071512 120
153 3300025258 Ga0209129_1004121 Ga0209129_10041215 120
154 3300025261 Ga0209233_1000650 Ga0209233_10006504 120
155 3300025261 Ga0209233_1002284 Ga0209233_10022842 120
156 3300025272 Ga0209455_1022013 Ga0209455_10220132 120
157 3300025292 Ga0209676_1000001 Ga0209676_10000011166 120
158 3300025298 Ga0209050_1000018 Ga0209050_1000018418 120
159 3300025904 Ga0207647_10000072 Ga0207647_100000726 120
160 3300025904 Ga0207647_10153675 Ga0207647_101536752 120
161 3300025904 Ga0207647_10163605 Ga0207647_101636052 120
162 3300025909 Ga0207705_10028168 Ga0207705_100281686 120
163 3300025909 Ga0207705_10059038 Ga0207705_100590383 120
164 3300025909 Ga0207705_10799678 Ga0207705_107996782 120
165 3300025911 Ga0207654_10007848 Ga0207654_100078484 120
166 3300025911 Ga0207654_10448050 Ga0207654_104480502 120
167 3300025912 Ga0207707_10330614 Ga0207707_103306142 120
168 3300025913 Ga0207695_10000267 Ga0207695_100002677 120
169 3300025913 Ga0207695_10102976 Ga0207695_101029762 120
170 3300025913 Ga0207695_10397954 Ga0207695_103979542 120
171 3300025913 Ga0207695_10425417 Ga0207695_104254171 120
172 3300025914 Ga0207671_10002145 Ga0207671_1000214510 120
173 3300025914 Ga0207671_10019673 Ga0207671_100196734 120
174 3300025914 Ga0207671_10044432 Ga0207671_100444322 120
175 3300025917 Ga0207660_10064150 Ga0207660_100641503 120
176 3300025917 Ga0207660_10119590 Ga0207660_101195902 120
177 3300025917 Ga0207660_10490406 Ga0207660_104904061 120
178 3300025919 Ga0207657_10009751 Ga0207657_100097516 120
179 3300025919 Ga0207657_10023784 Ga0207657_100237843 120
180 3300025919 Ga0207657_10622324 Ga0207657_106223241 120
181 3300025920 Ga0207649_11030178 Ga0207649_110301781 120
182 3300025921 Ga0207652_10001640 Ga0207652_1000164010 120
183 3300025921 Ga0207652_10061437 Ga0207652_100614374 120
184 3300025921 Ga0207652_10228210 Ga0207652_102282101 120
185 3300025932 Ga0207690_10021972 Ga0207690_100219724 120
186 3300025935 Ga0207709_10777993 Ga0207709_107779931 120
187 3300025944 Ga0207661_10298575 Ga0207661_102985752 120
188 3300025949 Ga0207667_10029827 Ga0207667_100298275 120
189 3300025949 Ga0207667_10218923 Ga0207667_102189232 120
190 3300025949 Ga0207667_10436020 Ga0207667_104360202 120
191 3300025981 Ga0207640_10091908 Ga0207640_100919081 120
192 3300025981 Ga0207640_10699872 Ga0207640_106998722 120
193 3300026041 Ga0207639_10648775 Ga0207639_106487752 120
194 3300026078 Ga0207702_10450871 Ga0207702_104508712 120
195 3300026116 Ga0207674_10018292 Ga0207674_100182923 120
196 3300026116 Ga0207674_10108969 Ga0207674_101089691 120
197 3300026116 Ga0207674_10192177 Ga0207674_101921772 120
198 3300026116 Ga0207674_10347263 Ga0207674_103472632 120
199 3300026142 Ga0207698_11655689 Ga0207698_116556892 120
200 3300030732 Ga0316176_1065061 Ga0316176_10650614 120
201 3300030742 Ga0316183_1013128 Ga0316183_10131281 120
202 3300030742 Ga0316183_1160955 Ga0316183_11609557 120
203 3300030744 Ga0316181_1182971 Ga0316181_11829713 120
204 3300030744 Ga0316181_1233599 Ga0316181_12335993 120
205 3300031507 Ga0307509_10156528 Ga0307509_101565283 120
206 3300031731 Ga0307405_10000042 Ga0307405_100000429 120
207 3300031731 Ga0307405_10983759 Ga0307405_109837591 120
208 3300031824 Ga0307413_10044573 Ga0307413_100445733 120
209 3300031903 Ga0307407_10000026 Ga0307407_1000002689 120
210 3300031911 Ga0307412_10000038 Ga0307412_1000003843 120
211 3300031911 Ga0307412_10056258 Ga0307412_100562582 120
212 3300031911 Ga0307412_10519998 Ga0307412_105199982 120
213 3300031995 Ga0307409_100014062 Ga0307409_1000140624 120
214 3300032002 Ga0307416_100000053 Ga0307416_10000005389 120
215 3300032004 Ga0307414_10002114 Ga0307414_100021144 120
216 3300032004 Ga0307414_10014709 Ga0307414_100147092 120
217 3300032004 Ga0307414_10051834 Ga0307414_100518343 120
218 3300032004 Ga0307414_10123239 Ga0307414_101232392 120
219 3300032004 Ga0307414_10360404 Ga0307414_103604041 120
220 3300032004 Ga0307414_10376875 Ga0307414_103768751 120
221 3300037471 Ga0395905_0201103 Ga0395905_0201103_28_405 120
222 3300038443 Ga0395901_0223230 Ga0395901_0223230_349_726 120
223 3300041460 Ga0451802_0047533 Ga0451802_0047533_166_546 120
224 3300041462 Ga0451806_616402 Ga0451806_616402_601_981 120
225 3300044684 Ga0466966_0442737 Ga0466966_0442737_21_386 120
226 3300046462 Ga0495651_0081779 Ga0495651_0081779_795_1160 120
227 3300046463 Ga0495653_0850583 Ga0495653_0850583_76_441 120
228 3300046471 Ga0495650_0168308 Ga0495650_0168308_113_475 120
229 3300046506 Ga0495583_0129301 Ga0495583_0129301_533_895 120
230 3300046507 Ga0495606_0198573 Ga0495606_0198573_515_877 120
231 3300046507 Ga0495606_0377448 Ga0495606_0377448_31_411 120
232 3300046512 Ga0495610_0002030 Ga0495610_0002030_12227_12607 120
233 3300046512 Ga0495610_0002618 Ga0495610_0002618_4778_5158 120
234 3300046518 Ga0495631_0145607 Ga0495631_0145607_236_598 120
235 3300046523 Ga0495644_0003331 Ga0495644_0003331_4564_4932 120
236 3300046660 Ga0495625_0009972 Ga0495625_0009972_5045_5407 120
237 3300046660 Ga0495625_0035447 Ga0495625_0035447_299_661 120
238 3300046665 Ga0495661_0005641 Ga0495661_0005641_1798_2160 120
239 3300046665 Ga0495661_0508870 Ga0495661_0508870_116_478 120
240 3300046691 Ga0495670_0261849 Ga0495670_0261849_207_575 120
241 3300047472 Ga0495686_0001146 Ga0495686_0001146_12470_12844 120
242 3300047472 Ga0495686_0056856 Ga0495686_0056856_1535_1900 120
243 3300048918 Ga0496115_1193157 Ga0496115_1193157_102_470 120
244 3300049570 Ga0501033_0326819 Ga0501033_0326819_96_464 120
245 3300049570 Ga0501033_0442088 Ga0501033_0442088_58_426 120
246 3300049571 Ga0501034_0061251 Ga0501034_0061251_336_704 120
247 3300049586 Ga0501070_0293046 Ga0501070_0293046_142_510 120
248 3300049686 Ga0501257_217795 Ga0501257_217795_56_436 120
249 3300049758 Ga0501241_009067 Ga0501241_009067_449_820 120
250 3300049822 Ga0501035_0678326 Ga0501035_0678326_15_383 120
251 3300049822 Ga0501035_0682693 Ga0501035_0682693_217_594 120
252 3300049823 Ga0501044_0116951 Ga0501044_0116951_1224_1592 120
253 3300050496 nmdc:mga07m45_145371_c1 nmdc:mga07m45_145371_c1_13_441 120
254 3300050496 nmdc:mga07m45_206745_c1 nmdc:mga07m45_206745_c1_585_971 120
255 3300053098 Ga0500650_0334041 Ga0500650_0334041_240_602 120
256 3300053122 Ga0500608_018886 Ga0500608_018886_2082_2444 120
257 3300053157 Ga0500624_000303 Ga0500624_000303_14239_14601 120
258 3300053161 Ga0500634_0141685 Ga0500634_0141685_687_1052 120

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF15071

TMEM220

Transmembrane family 220, helix

38

144

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
8to0-assembly1.cif.gz_BM 48-nm repeating structure of doublets from mouse sperm flagella 0.7128 50 119
1vf7-assembly1.cif.gz_E crystal structure of the membrane fusion protein, mexa of the multidrug transporter 0.631 47 117
7rro-assembly1.cif.gz_F4 structure of the 48-nm repeat doublet microtubule from bovine tracheal cilia 0.5751 32 119
7tnj-assembly1.cif.gz_A complex nnnn of ampa-subtype iglur glua2 in complex with auxiliary subunit gamma2 (stargazin) at low glutamate concentration (20 um) in the presence of cyclothiazide (100 um) 0.5306 22 119
7tnn-assembly1.cif.gz_C complex ggnn of ampa-subtype iglur glua2 in complex with auxiliary subunit gamma2 (stargazin) at low glutamate concentration (20 um) in the presence of cyclothiazide (100 um) 0.5118 22 119
ID Description Score Start End Superfamily
af_Q95Q17_63_165_6.10.140.200 Special;Helix non-globular;Helix Hairpins; 0.7555 47 119 6.10.140.200
af_Q4DMD4_110_261_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.6573 50 119 3.30.40.10
af_Q9ZUN5_4_252_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6212 2 68 1.20.140.150
af_M9PJS6_227_355_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.5899 1 119 1.20.140.150
af_Q8BYY4_1_498_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.5867 29 117 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A4Q5YIR7-F1-model_v4 deleted 0.9076 2 119
AF-A0A4U3KXY6-F1-model_v4 Transmembrane family 220, helix 0.9049 2 119 GO:0016020
AF-A0A7X0E0W8-F1-model_v4 Transmembrane family 220 protein 0.9047 2 120 GO:0016020
AF-F4C6J8-F1-model_v4 Transmembrane family 220, helix 0.9039 2 119 GO:0016020
AF-A0A5B2VNZ9-F1-model_v4 Transmembrane family 220 protein 0.9022 2 119 GO:0016020

Feature Viewer

pLDDT pTM Quality
83.74 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map